BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019C03

Length=746
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFH68055.1|  seven transmembrane calmodulin binding protein          271   7e-84   Capsicum annuum
gb|AIT98397.1|  MLO1                                                    263   1e-80   Solanum melongena [aubergine]
ref|NP_001234814.1|  MLO1 protein                                       261   5e-80   Solanum lycopersicum
gb|AIT98395.1|  MLO1                                                    261   7e-80   Solanum tuberosum [potatoes]
emb|CDO99726.1|  unnamed protein product                                258   2e-78   Coffea canephora [robusta coffee]
ref|XP_009595993.1|  PREDICTED: MLO-like protein 6 isoform X1           253   5e-77   Nicotiana tomentosiformis
gb|AIT98396.1|  MLO1                                                    253   6e-77   Nicotiana tabacum [American tobacco]
ref|XP_009782286.1|  PREDICTED: MLO-like protein 6 isoform X1           253   6e-77   Nicotiana sylvestris
ref|XP_010099632.1|  MLO-like protein 12                                238   5e-72   
ref|XP_011089887.1|  PREDICTED: MLO-like protein 6                      242   5e-72   Sesamum indicum [beniseed]
gb|KDP44089.1|  hypothetical protein JCGZ_05556                         231   2e-71   Jatropha curcas
emb|CAN64133.1|  hypothetical protein VITISV_032771                     237   3e-70   Vitis vinifera
ref|NP_001268013.1|  MLO11 protein                                      237   3e-70   Vitis vinifera
ref|XP_010046751.1|  PREDICTED: MLO-like protein 6                      236   4e-70   Eucalyptus grandis [rose gum]
gb|EYU41617.1|  hypothetical protein MIMGU_mgv1a0045332mg               231   5e-70   Erythranthe guttata [common monkey flower]
gb|ACO07297.1|  MLO1                                                    236   6e-70   Pisum sativum [garden pea]
gb|KCW88826.1|  hypothetical protein EUGRSUZ_A01164                     236   1e-69   Eucalyptus grandis [rose gum]
gb|ADV40949.1|  MLO1                                                    235   1e-69   Medicago truncatula
ref|XP_008385390.1|  PREDICTED: MLO-like protein 6                      229   1e-69   
emb|CDP07138.1|  unnamed protein product                                235   2e-69   Coffea canephora [robusta coffee]
ref|XP_011044384.1|  PREDICTED: MLO-like protein 6 isoform X1           234   2e-69   Populus euphratica
ref|XP_010905123.1|  PREDICTED: MLO-like protein 6                      235   2e-69   Elaeis guineensis
gb|AFW98802.1|  MLO protein 2                                           234   3e-69   Rosa multiflora [Japanese rose]
ref|XP_008796803.1|  PREDICTED: MLO-like protein 6                      234   3e-69   
ref|XP_009603532.1|  PREDICTED: MLO-like protein 6                      234   6e-69   Nicotiana tomentosiformis
ref|XP_006356488.1|  PREDICTED: MLO-like protein 6-like                 231   1e-68   Solanum tuberosum [potatoes]
ref|XP_007009792.1|  Seven transmembrane MLO family protein             233   1e-68   
ref|XP_010558749.1|  PREDICTED: MLO-like protein 6                      233   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_011044385.1|  PREDICTED: MLO-like protein 6 isoform X2           233   2e-68   Populus euphratica
ref|XP_004148785.1|  PREDICTED: MLO-like protein 6-like                 232   2e-68   Cucumis sativus [cucumbers]
ref|XP_008796805.1|  PREDICTED: MLO-like protein 6                      233   2e-68   
ref|XP_010905121.1|  PREDICTED: MLO-like protein 6                      232   2e-68   Elaeis guineensis
ref|XP_002533246.1|  Protein MLO, putative                              232   4e-68   Ricinus communis
ref|XP_009801961.1|  PREDICTED: MLO-like protein 6                      232   5e-68   Nicotiana sylvestris
ref|XP_007015437.1|  Seven transmembrane MLO family protein isofo...    230   5e-68   
gb|AGV68799.1|  MLO1                                                    231   6e-68   Prunus armeniaca
ref|XP_008338448.1|  PREDICTED: MLO-like protein 6                      230   7e-68   
gb|EPS69703.1|  hypothetical protein M569_05063                         222   1e-67   Genlisea aurea
ref|XP_007015436.1|  Seven transmembrane MLO family protein isofo...    230   1e-67   
ref|XP_009347038.1|  PREDICTED: MLO-like protein 6                      230   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_007204981.1|  hypothetical protein PRUPE_ppa003207mg             230   2e-67   Prunus persica
ref|XP_009596416.1|  PREDICTED: MLO-like protein 6                      230   3e-67   Nicotiana tomentosiformis
ref|XP_006436274.1|  hypothetical protein CICLE_v10031130mg             228   5e-67   
ref|XP_008463775.1|  PREDICTED: MLO-like protein 6                      228   6e-67   Cucumis melo [Oriental melon]
gb|KDO48443.1|  hypothetical protein CISIN_1g008391mg                   228   6e-67   Citrus sinensis [apfelsine]
ref|XP_004304413.1|  PREDICTED: MLO-like protein 6                      228   7e-67   Fragaria vesca subsp. vesca
ref|XP_009385958.1|  PREDICTED: MLO-like protein 6                      228   8e-67   
ref|XP_002314276.1|  hypothetical protein POPTR_0009s01710g             228   1e-66   
ref|XP_009378090.1|  PREDICTED: MLO-like protein 6                      227   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_008463924.1|  PREDICTED: MLO-like protein 6 isoform X1           228   2e-66   Cucumis melo [Oriental melon]
gb|KDP25722.1|  hypothetical protein JCGZ_23943                         226   2e-66   Jatropha curcas
ref|XP_010253610.1|  PREDICTED: MLO-like protein 6 isoform X1           227   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_007208289.1|  hypothetical protein PRUPE_ppa003437mg             226   3e-66   Prunus persica
ref|XP_008387611.1|  PREDICTED: MLO-like protein 6 isoform X1           222   3e-66   
ref|XP_010264735.1|  PREDICTED: MLO-like protein 6 isoform X1           226   3e-66   Nelumbo nucifera [Indian lotus]
gb|EYU36196.1|  hypothetical protein MIMGU_mgv1a014001mg                216   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_008225371.1|  PREDICTED: MLO-like protein 6                      226   4e-66   Prunus mume [ume]
ref|XP_011077127.1|  PREDICTED: MLO-like protein 12                     224   4e-66   Sesamum indicum [beniseed]
ref|XP_006343449.1|  PREDICTED: MLO-like protein 6-like                 226   5e-66   Solanum tuberosum [potatoes]
ref|XP_009335054.1|  PREDICTED: MLO-like protein 6                      226   5e-66   Pyrus x bretschneideri [bai li]
gb|KGN47314.1|  hypothetical protein Csa_6G292430                       226   6e-66   Cucumis sativus [cucumbers]
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                226   7e-66   Erythranthe guttata [common monkey flower]
ref|XP_004163384.1|  PREDICTED: MLO-like protein 6-like                 226   7e-66   
gb|KHN17123.1|  MLO-like protein 6                                      224   1e-65   Glycine soja [wild soybean]
ref|XP_006340147.1|  PREDICTED: MLO-like protein 6-like                 225   1e-65   Solanum tuberosum [potatoes]
ref|XP_010313404.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    224   2e-65   
ref|XP_003555433.1|  PREDICTED: MLO-like protein 12-like isoform X1     224   2e-65   Glycine max [soybeans]
ref|XP_004240581.1|  PREDICTED: MLO-like protein 6                      224   2e-65   Solanum lycopersicum
emb|CDP06724.1|  unnamed protein product                                224   3e-65   Coffea canephora [robusta coffee]
ref|XP_010104115.1|  MLO-like protein 6                                 224   3e-65   Morus notabilis
ref|XP_007027290.1|  Seven transmembrane MLO family protein             223   4e-65   
gb|AGV68800.1|  MLO3                                                    224   4e-65   Prunus armeniaca
ref|XP_002282216.1|  PREDICTED: MLO-like protein 6                      224   4e-65   Vitis vinifera
ref|XP_008243901.1|  PREDICTED: MLO-like protein 6                      223   4e-65   Prunus mume [ume]
ref|NP_001268008.1|  MLO7 protein                                       222   6e-65   Vitis vinifera
emb|CBI31482.3|  unnamed protein product                                222   6e-65   Vitis vinifera
ref|XP_009777573.1|  PREDICTED: MLO-like protein 6                      223   7e-65   Nicotiana sylvestris
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          223   8e-65   Amborella trichopoda
ref|XP_010318227.1|  PREDICTED: MLO-like protein 2 isoform X2           219   8e-65   Solanum lycopersicum
ref|XP_004515994.1|  PREDICTED: MLO-like protein 2-like                 222   8e-65   Cicer arietinum [garbanzo]
gb|KHN00832.1|  MLO-like protein 6                                      222   9e-65   Glycine soja [wild soybean]
ref|XP_002312021.2|  MLO-like protein 12                                223   9e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006424615.1|  hypothetical protein CICLE_v10028092mg             223   1e-64   Citrus clementina [clementine]
gb|AAL06900.1|  At1g11310/T28P6_23                                      215   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004309423.1|  PREDICTED: MLO-like protein 6                      223   1e-64   Fragaria vesca subsp. vesca
emb|CBI16290.3|  unnamed protein product                                224   2e-64   Vitis vinifera
gb|AAX31277.1|  MLO1                                                    222   2e-64   Capsicum annuum
ref|XP_002526372.1|  Protein MLO, putative                              222   2e-64   Ricinus communis
ref|XP_011040971.1|  PREDICTED: MLO-like protein 6                      221   2e-64   Populus euphratica
ref|XP_004235223.1|  PREDICTED: MLO-like protein 2 isoform X1           220   3e-64   Solanum lycopersicum
ref|XP_006307103.1|  hypothetical protein CARUB_v10008691mg             221   3e-64   Capsella rubella
gb|AFW98801.1|  MLO protein 1                                           221   3e-64   Rosa multiflora [Japanese rose]
dbj|BAJ34622.1|  unnamed protein product                                219   4e-64   Eutrema halophilum
ref|XP_010505587.1|  PREDICTED: MLO-like protein 12 isoform X2          221   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010505586.1|  PREDICTED: MLO-like protein 12 isoform X1          221   5e-64   Camelina sativa [gold-of-pleasure]
gb|KJB09233.1|  hypothetical protein B456_001G130800                    221   5e-64   Gossypium raimondii
dbj|BAF00789.1|  membrane protein Mlo12                                 219   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538050.1|  PREDICTED: MLO-like protein 6-like                 221   5e-64   Glycine max [soybeans]
ref|XP_010509062.1|  PREDICTED: MLO-like protein 12                     220   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002315295.2|  hypothetical protein POPTR_0010s22730g             220   9e-64   
gb|AGV68801.1|  MLO4                                                    219   1e-63   Prunus armeniaca
ref|XP_006411145.1|  hypothetical protein EUTSA_v10016436mg             220   1e-63   Eutrema salsugineum [saltwater cress]
ref|NP_565902.1|  protein MILDEW RESISTANCE LOCUS O 12                  219   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892636.1|  hypothetical protein ARALYDRAFT_471266             219   1e-63   
ref|XP_002881634.1|  hypothetical protein ARALYDRAFT_903160             219   1e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010032020.1|  PREDICTED: MLO-like protein 6                      219   2e-63   Eucalyptus grandis [rose gum]
ref|XP_007143692.1|  hypothetical protein PHAVU_007G093600g             219   2e-63   Phaseolus vulgaris [French bean]
ref|XP_009133342.1|  PREDICTED: MLO-like protein 12 isoform X1          219   2e-63   Brassica rapa
ref|NP_001185281.1|  MLO-like protein 6                                 218   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302048.1|  hypothetical protein CARUB_v10020030mg             219   2e-63   Capsella rubella
ref|XP_009133344.1|  PREDICTED: MLO-like protein 12 isoform X2          219   2e-63   Brassica rapa
gb|AAX77015.1|  MLO1                                                    218   2e-63   Lotus japonicus
ref|XP_003548912.1|  PREDICTED: MLO-like protein 12-like isoform X1     219   2e-63   Glycine max [soybeans]
ref|XP_007151752.1|  hypothetical protein PHAVU_004G071700g             219   3e-63   Phaseolus vulgaris [French bean]
ref|XP_004142393.1|  PREDICTED: MLO-like protein 6-like                 218   3e-63   Cucumis sativus [cucumbers]
ref|XP_004157520.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    218   3e-63   
gb|KHN13369.1|  MLO-like protein 12                                     219   3e-63   Glycine soja [wild soybean]
gb|KJB73619.1|  hypothetical protein B456_011G240700                    218   3e-63   Gossypium raimondii
ref|NP_176350.1|  MLO-like protein 6                                    218   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886534.1|  hypothetical protein ARALYDRAFT_315221             218   4e-63   
gb|KFK36813.1|  hypothetical protein AALP_AA4G174800                    218   4e-63   Arabis alpina [alpine rockcress]
ref|XP_006417368.1|  hypothetical protein EUTSA_v10007208mg             218   4e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009342695.1|  PREDICTED: MLO-like protein 6 isoform X1           218   6e-63   Pyrus x bretschneideri [bai li]
ref|XP_007218951.1|  hypothetical protein PRUPE_ppa003466mg             218   6e-63   Prunus persica
ref|XP_006293900.1|  hypothetical protein CARUB_v10022893mg             218   7e-63   Capsella rubella
ref|XP_008365656.1|  PREDICTED: MLO-like protein 6                      217   8e-63   
gb|AFW98803.1|  MLO protein 3                                           217   9e-63   Rosa multiflora [Japanese rose]
gb|AEC12478.1|  membrane protein                                        217   9e-63   Rosa multiflora [Japanese rose]
ref|XP_008246012.1|  PREDICTED: MLO-like protein 6                      213   9e-63   Prunus mume [ume]
emb|CDY47582.1|  BnaA01g22680D                                          216   1e-62   Brassica napus [oilseed rape]
gb|AFW98804.1|  MLO protein 4                                           216   1e-62   Rosa multiflora [Japanese rose]
ref|XP_010473362.1|  PREDICTED: MLO-like protein 6 isoform X1           217   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009104728.1|  PREDICTED: MLO-like protein 6                      217   1e-62   Brassica rapa
ref|XP_010043720.1|  PREDICTED: MLO-like protein 6 isoform X1           216   2e-62   Eucalyptus grandis [rose gum]
gb|KJB67707.1|  hypothetical protein B456_010G205000                    216   2e-62   Gossypium raimondii
ref|XP_010418123.1|  PREDICTED: MLO-like protein 6                      217   2e-62   Camelina sativa [gold-of-pleasure]
gb|KJB55486.1|  hypothetical protein B456_009G078600                    216   2e-62   Gossypium raimondii
ref|XP_010430162.1|  PREDICTED: MLO-like protein 6 isoform X1           217   2e-62   Camelina sativa [gold-of-pleasure]
ref|NP_172598.1|  MLO-like protein 2                                    216   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001284458.1|  MLO-like protein 12                                215   7e-62   Cucumis melo [Oriental melon]
ref|XP_008369779.1|  PREDICTED: MLO-like protein 6 isoform X2           215   8e-62   Malus domestica [apple tree]
ref|XP_010412940.1|  PREDICTED: MLO-like protein 12                     213   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006391995.1|  hypothetical protein EUTSA_v10023372mg             215   9e-62   Eutrema salsugineum [saltwater cress]
ref|XP_008369778.1|  PREDICTED: MLO-like protein 6 isoform X1           215   1e-61   Malus domestica [apple tree]
ref|XP_007132193.1|  hypothetical protein PHAVU_011G073800g             214   1e-61   Phaseolus vulgaris [French bean]
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      214   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011031756.1|  PREDICTED: MLO-like protein 6                      214   2e-61   Populus euphratica
ref|XP_008233336.1|  PREDICTED: MLO-like protein 6                      213   2e-61   Prunus mume [ume]
gb|KFK40693.1|  hypothetical protein AALP_AA2G029100                    213   4e-61   Arabis alpina [alpine rockcress]
emb|CDY34841.1|  BnaA09g47670D                                          204   6e-61   Brassica napus [oilseed rape]
emb|CDY07669.1|  BnaA03g18420D                                          211   6e-61   Brassica napus [oilseed rape]
emb|CDY26348.1|  BnaA03g60240D                                          213   6e-61   Brassica napus [oilseed rape]
ref|XP_009124631.1|  PREDICTED: MLO-like protein 6                      212   8e-61   Brassica rapa
ref|XP_010534417.1|  PREDICTED: MLO-like protein 12                     212   9e-61   Tarenaya hassleriana [spider flower]
emb|CDY14402.1|  BnaC03g21930D                                          211   1e-60   Brassica napus [oilseed rape]
emb|CDY20991.1|  BnaA08g25340D                                          211   1e-60   Brassica napus [oilseed rape]
ref|XP_009141792.1|  PREDICTED: MLO-like protein 12                     211   2e-60   Brassica rapa
ref|XP_009358149.1|  PREDICTED: MLO-like protein 6                      211   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_009133345.1|  PREDICTED: MLO-like protein 12                     211   4e-60   Brassica rapa
emb|CDY15021.1|  BnaCnng04240D                                          210   7e-60   Brassica napus [oilseed rape]
ref|XP_011089323.1|  PREDICTED: MLO-like protein 6                      208   1e-59   
ref|XP_009113127.1|  PREDICTED: MLO-like protein 6                      209   1e-59   Brassica rapa
gb|ADW95395.1|  MLO1                                                    201   2e-59   Petunia x hybrida [garden petunia]
gb|ADW95398.1|  MLO1                                                    201   2e-59   Solanum tuberosum [potatoes]
emb|CDY07075.1|  BnaA04g22400D                                          208   3e-59   
ref|XP_009110727.1|  PREDICTED: MLO-like protein 2                      207   3e-59   Brassica rapa
gb|ADW95396.1|  MLO1                                                    200   4e-59   Solanum melongena [aubergine]
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      207   5e-59   Glycine max [soybeans]
gb|AFM35696.1|  Mlo                                                     206   8e-59   Vitis pseudoreticulata
ref|NP_001268005.1|  MLO6 protein                                       206   1e-58   Vitis vinifera
gb|KHN00604.1|  MLO-like protein 12                                     206   1e-58   Glycine soja [wild soybean]
gb|KJB74724.1|  hypothetical protein B456_012G004100                    206   2e-58   Gossypium raimondii
emb|CBI31481.3|  unnamed protein product                                204   3e-58   Vitis vinifera
ref|XP_003519926.1|  PREDICTED: MLO-like protein 12-like                205   3e-58   Glycine max [soybeans]
gb|KHN13370.1|  MLO-like protein 12                                     204   7e-58   Glycine soja [wild soybean]
gb|KJB67708.1|  hypothetical protein B456_010G205100                    200   8e-58   Gossypium raimondii
gb|ADW95397.1|  MLO1                                                    197   8e-58   Nicotiana tabacum [American tobacco]
gb|KFK35674.1|  hypothetical protein AALP_AA4G022500                    204   9e-58   Arabis alpina [alpine rockcress]
ref|XP_003548913.1|  PREDICTED: MLO-like protein 12-like                203   2e-57   Glycine max [soybeans]
ref|NP_001288934.1|  MLO-like protein 2                                 202   5e-57   Brassica rapa
ref|XP_010547373.1|  PREDICTED: MLO-like protein 6                      200   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_010068861.1|  PREDICTED: MLO-like protein 2                      200   2e-56   
ref|XP_010476039.1|  PREDICTED: MLO-like protein 2 isoform X1           200   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010476040.1|  PREDICTED: MLO-like protein 2 isoform X2           200   2e-56   Camelina sativa [gold-of-pleasure]
emb|CDY07665.1|  BnaA03g18460D                                          199   2e-56   Brassica napus [oilseed rape]
emb|CDY14401.1|  BnaC03g21940D                                          199   2e-56   Brassica napus [oilseed rape]
ref|XP_010430163.1|  PREDICTED: MLO-like protein 6 isoform X2           201   2e-56   Camelina sativa [gold-of-pleasure]
ref|NP_001185282.1|  MLO-like protein 6                                 199   3e-56   
ref|XP_010032207.1|  PREDICTED: MLO-like protein 2 isoform X1           199   4e-56   Eucalyptus grandis [rose gum]
ref|XP_009133347.1|  PREDICTED: MLO-like protein 12                     199   4e-56   Brassica rapa
ref|XP_010032208.1|  PREDICTED: MLO-like protein 2 isoform X2           199   4e-56   Eucalyptus grandis [rose gum]
ref|XP_010476041.1|  PREDICTED: MLO-like protein 2 isoform X3           199   4e-56   
gb|KCW65389.1|  hypothetical protein EUGRSUZ_G02819                     194   7e-56   Eucalyptus grandis [rose gum]
emb|CDX97946.1|  BnaA06g06970D                                          197   3e-55   
ref|XP_010458517.1|  PREDICTED: MLO-like protein 2                      197   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009148458.1|  PREDICTED: MLO-like protein 2                      196   6e-55   Brassica rapa
ref|XP_010492667.1|  PREDICTED: MLO-like protein 2                      196   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      196   1e-54   
ref|XP_004487134.1|  PREDICTED: MLO-like protein 6-like                 195   2e-54   Cicer arietinum [garbanzo]
gb|KHN21533.1|  MLO-like protein 6                                      184   5e-54   Glycine soja [wild soybean]
ref|XP_007150219.1|  hypothetical protein PHAVU_005G136700g             193   9e-54   Phaseolus vulgaris [French bean]
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      193   1e-53   Phoenix dactylifera
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      192   2e-53   
emb|CDY19353.1|  BnaC05g08620D                                          192   2e-53   Brassica napus [oilseed rape]
ref|XP_011469670.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    191   6e-53   Fragaria vesca subsp. vesca
ref|XP_009342698.1|  PREDICTED: MLO-like protein 6 isoform X2           190   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_007151753.1|  hypothetical protein PHAVU_004G071800g             189   1e-52   Phaseolus vulgaris [French bean]
gb|KHN25050.1|  MLO-like protein 6                                      187   2e-52   Glycine soja [wild soybean]
ref|XP_003597192.1|  MLO-like protein                                   189   2e-52   Medicago truncatula
ref|XP_009333712.1|  PREDICTED: MLO-like protein 6                      188   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_010492678.1|  PREDICTED: MLO-like protein 2                      188   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_003539406.1|  PREDICTED: MLO-like protein 6-like                 187   1e-51   Glycine max [soybeans]
ref|XP_010107562.1|  MLO-like protein 12                                188   2e-51   
ref|XP_011013684.1|  PREDICTED: MLO-like protein 12                     185   2e-51   Populus euphratica
ref|XP_011004622.1|  PREDICTED: MLO-like protein 6                      185   2e-51   Populus euphratica
gb|KDP36763.1|  hypothetical protein JCGZ_08054                         186   2e-51   Jatropha curcas
ref|XP_011074078.1|  PREDICTED: MLO protein homolog 1-like              183   3e-50   Sesamum indicum [beniseed]
gb|EYU39586.1|  hypothetical protein MIMGU_mgv1a020874mg                180   4e-50   Erythranthe guttata [common monkey flower]
emb|CDY66806.1|  BnaC08g49800D                                          175   5e-50   Brassica napus [oilseed rape]
ref|XP_007150221.1|  hypothetical protein PHAVU_005G136800g             182   1e-49   Phaseolus vulgaris [French bean]
emb|CDP07269.1|  unnamed protein product                                181   2e-49   Coffea canephora [robusta coffee]
ref|XP_006595457.1|  PREDICTED: MLO-like protein 6-like                 180   5e-49   
ref|XP_010917470.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    180   1e-48   
ref|XP_003539407.1|  PREDICTED: MLO-like protein 6-like                 179   1e-48   Glycine max [soybeans]
emb|CAN79931.1|  hypothetical protein VITISV_007489                     182   6e-48   Vitis vinifera
ref|XP_002301907.2|  hypothetical protein POPTR_0002s00830g             175   1e-47   
emb|CDY03836.1|  BnaC01g29530D                                          174   2e-47   
gb|KHN33781.1|  MLO protein like 1                                      175   3e-47   Glycine soja [wild soybean]
ref|XP_002273002.1|  PREDICTED: MLO protein homolog 1-like              175   5e-47   Vitis vinifera
ref|XP_004500844.1|  PREDICTED: MLO protein homolog 1-like              174   1e-46   Cicer arietinum [garbanzo]
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                173   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_010030836.1|  PREDICTED: MLO protein homolog 1-like              172   3e-46   
ref|XP_002310696.2|  hypothetical protein POPTR_0007s08570g             172   3e-46   
emb|CBI40746.3|  unnamed protein product                                171   5e-46   Vitis vinifera
ref|XP_010319697.1|  PREDICTED: MLO1 protein isoform X1                 169   9e-46   Solanum lycopersicum
gb|KEH36350.1|  seven transmembrane MLO family protein                  169   3e-45   Medicago truncatula
ref|XP_002510708.1|  Protein MLO, putative                              169   3e-45   
ref|XP_006473919.1|  PREDICTED: MLO protein homolog 1-like              169   4e-45   
gb|KDO85189.1|  hypothetical protein CISIN_1g041242mg                   169   4e-45   Citrus sinensis [apfelsine]
ref|XP_002519555.1|  calmodulin binding protein, putative               167   5e-45   
ref|XP_003603854.1|  MLO protein-like protein                           169   6e-45   Medicago truncatula
gb|KHN20094.1|  MLO protein like 1                                      168   9e-45   Glycine soja [wild soybean]
ref|XP_003527634.1|  PREDICTED: MLO protein homolog 1-like              168   9e-45   Glycine max [soybeans]
ref|XP_011034835.1|  PREDICTED: MLO protein homolog 1-like              168   1e-44   Populus euphratica
ref|XP_004985865.1|  PREDICTED: MLO protein homolog 1-like              168   1e-44   Setaria italica
ref|XP_007135967.1|  hypothetical protein PHAVU_009G006800g             166   5e-44   Phaseolus vulgaris [French bean]
ref|XP_008237952.1|  PREDICTED: MLO protein homolog 1-like              164   4e-43   Prunus mume [ume]
ref|XP_008228898.1|  PREDICTED: MLO protein homolog 1-like              164   4e-43   
ref|XP_007210822.1|  hypothetical protein PRUPE_ppa020311mg             164   4e-43   Prunus persica
gb|KHN25048.1|  MLO-like protein 6                                      164   6e-43   Glycine soja [wild soybean]
ref|XP_010245561.1|  PREDICTED: MLO-like protein 12                     162   8e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006435410.1|  hypothetical protein CICLE_v10003446mg             163   8e-43   
gb|AAC69142.3|  hypothetical protein                                    154   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306989.1|  hypothetical protein POPTR_0005s27570g             162   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009372684.1|  PREDICTED: MLO protein homolog 1-like              160   9e-42   Pyrus x bretschneideri [bai li]
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      160   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_011465778.1|  PREDICTED: MLO protein homolog 1-like              159   2e-41   Fragaria vesca subsp. vesca
ref|XP_008786683.1|  PREDICTED: MLO-like protein 10                     158   2e-41   
ref|XP_002322867.1|  hypothetical protein POPTR_0016s08940g             158   2e-41   
ref|XP_010064953.1|  PREDICTED: MLO protein homolog 1-like              159   2e-41   Eucalyptus grandis [rose gum]
gb|KJB34883.1|  hypothetical protein B456_006G088500                    157   2e-41   Gossypium raimondii
gb|KCW70337.1|  hypothetical protein EUGRSUZ_F03580                     159   2e-41   Eucalyptus grandis [rose gum]
gb|KJB34882.1|  hypothetical protein B456_006G088500                    157   2e-41   Gossypium raimondii
ref|XP_010064954.1|  PREDICTED: MLO-like protein 9                      159   3e-41   Eucalyptus grandis [rose gum]
ref|NP_001105660.1|  barley mlo defense gene homolog1                   158   6e-41   Zea mays [maize]
ref|XP_010260351.1|  PREDICTED: MLO-like protein 12 isoform X1          157   6e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008786739.1|  PREDICTED: MLO protein homolog 1                   157   8e-41   
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   157   8e-41   Elaeis guineensis
gb|KHG26183.1|  MLO-like protein 12                                     156   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010260350.1|  PREDICTED: MLO-like protein 12 isoform X2          157   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010260349.1|  PREDICTED: MLO-like protein 12 isoform X1          157   2e-40   Nelumbo nucifera [Indian lotus]
emb|CDP01770.1|  unnamed protein product                                155   4e-40   Coffea canephora [robusta coffee]
ref|XP_006855670.1|  hypothetical protein AMTR_s00044p00123510          155   6e-40   Amborella trichopoda
ref|XP_007025524.1|  Seven transmembrane MLO family protein             154   7e-40   
ref|NP_180923.1|  MLO-like protein 5                                    154   9e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006592218.1|  PREDICTED: MLO-like protein 6-like isoform X2      153   1e-39   
ref|XP_010256542.1|  PREDICTED: MLO-like protein 9                      154   1e-39   Nelumbo nucifera [Indian lotus]
gb|KHN05728.1|  MLO-like protein 6                                      153   2e-39   Glycine soja [wild soybean]
ref|XP_011041289.1|  PREDICTED: MLO protein homolog 1-like              154   2e-39   Populus euphratica
ref|XP_008464826.1|  PREDICTED: MLO-like protein 9                      154   2e-39   
gb|AAK53798.1|AF369566_1  membrane protein Mlo5                         153   2e-39   
ref|XP_004158585.1|  PREDICTED: MLO-like protein 12-like                152   6e-39   
ref|XP_002893934.1|  hypothetical protein ARALYDRAFT_473744             151   7e-39   
ref|XP_010656958.1|  PREDICTED: MLO-like protein 9 isoform X1           152   9e-39   
ref|XP_002465934.1|  hypothetical protein SORBIDRAFT_01g048500          152   9e-39   
ref|XP_010473363.1|  PREDICTED: MLO-like protein 6 isoform X2           151   1e-38   
gb|KFK31027.1|  hypothetical protein AALP_AA6G058600                    151   1e-38   
ref|XP_009395397.1|  PREDICTED: MLO-like protein 9                      151   1e-38   
emb|CBI21912.3|  unnamed protein product                                151   1e-38   
ref|XP_011027760.1|  PREDICTED: MLO-like protein 12                     150   1e-38   
ref|XP_002305106.2|  hypothetical protein POPTR_0004s04960g             150   1e-38   
ref|XP_008783282.1|  PREDICTED: MLO-like protein 12                     150   2e-38   
gb|AAK53802.1|AF369570_1  membrane protein Mlo9                         147   2e-38   
ref|XP_010270522.1|  PREDICTED: MLO-like protein 9 isoform X1           150   3e-38   
ref|XP_010509851.1|  PREDICTED: MLO-like protein 5                      150   3e-38   
ref|XP_004144292.1|  PREDICTED: MLO-like protein 5-like                 150   3e-38   
ref|XP_009386660.1|  PREDICTED: MLO-like protein 9                      150   3e-38   
gb|AAK94907.1|AF384030_1  seven transmembrane protein MLO2              150   3e-38   
ref|XP_009141335.1|  PREDICTED: MLO-like protein 5                      149   3e-38   
ref|XP_010469445.1|  PREDICTED: MLO-like protein 5                      149   4e-38   
ref|XP_010413828.1|  PREDICTED: MLO-like protein 5                      149   4e-38   
ref|XP_008804588.1|  PREDICTED: MLO-like protein 9 isoform X2           149   4e-38   
ref|XP_006296403.1|  hypothetical protein CARUB_v10025579mg             149   4e-38   
ref|XP_009382074.1|  PREDICTED: MLO-like protein 9                      149   5e-38   
ref|XP_008804580.1|  PREDICTED: MLO-like protein 9 isoform X1           149   5e-38   
ref|NP_001048845.1|  Os03g0129100                                       149   5e-38   
ref|XP_009384603.1|  PREDICTED: MLO-like protein 10                     148   6e-38   
ref|XP_006410510.1|  hypothetical protein EUTSA_v10016533mg             149   6e-38   
ref|XP_004151948.1|  PREDICTED: MLO-like protein 12-like                149   6e-38   
ref|XP_010539025.1|  PREDICTED: MLO-like protein 9                      149   6e-38   
ref|XP_010916782.1|  PREDICTED: MLO-like protein 2                      149   7e-38   
gb|KJB14197.1|  hypothetical protein B456_002G113800                    149   8e-38   
ref|NP_001268082.1|  MLO-like protein 9                                 149   9e-38   
ref|XP_007150220.1|  hypothetical protein PHAVU_005G136700g             147   9e-38   
gb|AAG51314.1|AC025815_1  Mlo-like protein                              148   1e-37   
ref|NP_174980.3|  MLO-like protein 9                                    148   1e-37   
ref|XP_006473920.1|  PREDICTED: MLO-like protein 9-like                 149   1e-37   
ref|XP_004166937.1|  PREDICTED: MLO-like protein 6-like                 147   1e-37   
gb|AAK94905.1|AF361933_1  seven transmembrane-spanning protein          147   1e-37   
ref|XP_010478983.1|  PREDICTED: MLO-like protein 9                      147   1e-37   
ref|XP_003558907.1|  PREDICTED: protein MLO-like                        148   1e-37   
gb|KHG28669.1|  MLO-like protein 12                                     148   2e-37   
ref|XP_006855658.1|  hypothetical protein AMTR_s00044p00117330          142   2e-37   
ref|XP_008455945.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    148   2e-37   
ref|XP_006435412.1|  hypothetical protein CICLE_v10000748mg             148   2e-37   
gb|KJB69563.1|  hypothetical protein B456_011G030800                    147   2e-37   
gb|EMS47417.1|  Protein MLO                                             147   2e-37   
ref|XP_008783279.1|  PREDICTED: MLO-like protein 2                      147   2e-37   
gb|EYU28022.1|  hypothetical protein MIMGU_mgv1a019894mg                147   2e-37   
gb|AAK60566.1|AF384144_1  MLo protein                                   147   2e-37   
ref|XP_004134943.1|  PREDICTED: MLO-like protein 12-like                147   2e-37   
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      147   3e-37   
gb|AAK60567.1|AF384145_1  MLo1 protein                                  147   3e-37   
gb|ACV31921.1|  Mlo protein                                             147   3e-37   
ref|XP_006649324.1|  PREDICTED: MLO protein homolog 1-like              147   3e-37   
ref|XP_006662559.1|  PREDICTED: MLO-like protein 9-like                 147   3e-37   
ref|NP_001267908.1|  MLO-like protein 6-like                            147   4e-37   
emb|CBI30622.3|  unnamed protein product                                147   4e-37   
gb|AAK94904.1|AF361932_1  seven transmembrane-spanning protein          147   4e-37   
gb|ACV31920.1|  Mlo protein                                             147   4e-37   
ref|XP_010057357.1|  PREDICTED: MLO-like protein 6                      147   5e-37   
ref|NP_001065189.1|  Os10g0541000                                       146   5e-37   
gb|ABB47940.1|  MLO-like protein 10, putative, expressed                146   5e-37   
gb|KFK29153.1|  hypothetical protein AALP_AA7G095800                    145   6e-37   
gb|AAG46114.1|AC073166_12  putative Mlo (pathogen resistance) pro...    146   6e-37   
gb|EAY79378.1|  hypothetical protein OsI_34504                          146   7e-37   
ref|XP_007018107.1|  Seven transmembrane MLO family protein             146   7e-37   
ref|XP_007132761.1|  hypothetical protein PHAVU_011G122800g             146   8e-37   
sp|P93766.1|MLO_HORVU  RecName: Full=Protein MLO                        146   9e-37   
gb|EMT06538.1|  Protein MLO                                             146   9e-37   
ref|XP_007211108.1|  hypothetical protein PRUPE_ppa024488mg             145   1e-36   
emb|CDP06355.1|  unnamed protein product                                145   1e-36   
ref|XP_010523625.1|  PREDICTED: MLO-like protein 9                      145   1e-36   
sp|Q0DC45.2|MLOH1_ORYSJ  RecName: Full=MLO protein homolog 1; Alt...    145   1e-36   
dbj|BAD37345.1|  putative Mlo                                           145   2e-36   
gb|AHF52923.1|  Mlo protein                                             145   2e-36   
gb|AIK01832.1|  MLO                                                     145   2e-36   
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      145   2e-36   
gb|KHG27081.1|  MLO-like protein 3                                      145   2e-36   
gb|AHF52924.1|  Mlo protein                                             145   2e-36   
gb|KJB63473.1|  hypothetical protein B456_010G000800                    144   2e-36   
ref|XP_008439801.1|  PREDICTED: MLO-like protein 6                      145   2e-36   
ref|XP_010500219.1|  PREDICTED: MLO-like protein 9                      144   2e-36   
ref|XP_003574266.1|  PREDICTED: MLO-like protein 9                      145   2e-36   
ref|XP_002465008.1|  hypothetical protein SORBIDRAFT_01g030400          145   2e-36   
ref|XP_010916781.1|  PREDICTED: MLO-like protein 12                     144   3e-36   
ref|XP_008373392.1|  PREDICTED: MLO-like protein 9                      144   3e-36   
ref|XP_009372611.1|  PREDICTED: MLO-like protein 9                      144   3e-36   
emb|CAN84002.1|  hypothetical protein VITISV_021417                     144   3e-36   
ref|XP_006303812.1|  hypothetical protein CARUB_v10012285mg             143   4e-36   
ref|XP_006377427.1|  hypothetical protein POPTR_0011s05820g             144   4e-36   
gb|KDP43787.1|  hypothetical protein JCGZ_22414                         144   4e-36   
ref|XP_007046462.1|  Seven transmembrane MLO family protein             144   6e-36   
emb|CDY57371.1|  BnaCnng31840D                                          142   6e-36   
sp|A2YD22.2|MLOH1_ORYSI  RecName: Full=MLO protein homolog 1; Alt...    143   7e-36   
emb|CAN65415.1|  hypothetical protein VITISV_009740                     141   7e-36   
ref|XP_008237943.1|  PREDICTED: MLO-like protein 9                      143   8e-36   
ref|XP_006656978.1|  PREDICTED: MLO protein homolog 1-like              143   8e-36   
ref|XP_002879463.1|  hypothetical protein ARALYDRAFT_482315             143   9e-36   
ref|XP_009405205.1|  PREDICTED: MLO-like protein 6                      143   9e-36   
gb|KJB10414.1|  hypothetical protein B456_001G200000                    143   1e-35   
ref|XP_011001234.1|  PREDICTED: MLO-like protein 12                     143   1e-35   
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      142   1e-35   
emb|CBI40748.3|  unnamed protein product                                142   1e-35   
ref|XP_009390757.1|  PREDICTED: MLO-like protein 9 isoform X2           142   1e-35   
gb|KJB10419.1|  hypothetical protein B456_001G200000                    142   1e-35   
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           142   1e-35   
ref|XP_004983794.1|  PREDICTED: MLO-like protein 5-like                 142   2e-35   
ref|XP_010035820.1|  PREDICTED: MLO-like protein 2                      142   2e-35   
gb|KJB10418.1|  hypothetical protein B456_001G200000                    142   2e-35   
ref|XP_008440929.1|  PREDICTED: MLO-like protein 8                      142   2e-35   
gb|KHN12501.1|  MLO-like protein 8                                      142   2e-35   
tpg|DAA46106.1|  TPA: hypothetical protein ZEAMMB73_604520              141   2e-35   
ref|XP_006599251.1|  PREDICTED: MLO-like protein 8-like                 142   2e-35   
ref|NP_001105168.1|  barley mlo defense gene homolog2                   142   3e-35   
gb|AAK72963.1|AF388195_1  Mlo                                           141   3e-35   
gb|KJB55488.1|  hypothetical protein B456_009G078700                    140   4e-35   
ref|XP_010038680.1|  PREDICTED: MLO-like protein 2                      141   4e-35   
gb|KCW47275.1|  hypothetical protein EUGRSUZ_K01067                     141   4e-35   
gb|KDP21019.1|  hypothetical protein JCGZ_21490                         135   4e-35   
ref|XP_004163965.1|  PREDICTED: MLO-like protein 3-like                 141   4e-35   
gb|KJB55487.1|  hypothetical protein B456_009G078700                    141   4e-35   
ref|XP_004253244.1|  PREDICTED: MLO-like protein 9                      141   4e-35   
gb|EMS61495.1|  MLO-like protein 8                                      141   4e-35   
ref|XP_004147296.1|  PREDICTED: MLO-like protein 3-like                 141   5e-35   
ref|XP_006425251.1|  hypothetical protein CICLE_v10025242mg             140   5e-35   
ref|XP_002276608.1|  PREDICTED: MLO-like protein 10                     141   6e-35   
ref|XP_010104117.1|  MLO-like protein 3                                 140   6e-35   
emb|CDY12904.1|  BnaA09g13700D                                          141   6e-35   
gb|KDO71552.1|  hypothetical protein CISIN_1g008408mg                   140   7e-35   
ref|XP_003526251.1|  PREDICTED: MLO-like protein 12-like                140   7e-35   
gb|KDO71547.1|  hypothetical protein CISIN_1g008408mg                   140   7e-35   
ref|XP_004509461.1|  PREDICTED: MLO-like protein 10-like                140   7e-35   
ref|XP_006366656.1|  PREDICTED: MLO-like protein 8-like isoform X2      140   7e-35   
ref|XP_006366655.1|  PREDICTED: MLO-like protein 8-like isoform X1      140   8e-35   
ref|XP_002310695.2|  MLO-like protein 8                                 140   8e-35   
ref|XP_006425252.1|  hypothetical protein CICLE_v10025242mg             140   1e-34   
ref|XP_006467107.1|  PREDICTED: MLO-like protein 10-like                140   1e-34   
gb|EYU41181.1|  hypothetical protein MIMGU_mgv1a007661mg                139   1e-34   
ref|XP_011460582.1|  PREDICTED: MLO-like protein 6 isoform X2           139   1e-34   
ref|XP_011098015.1|  PREDICTED: MLO-like protein 10 isoform X1          140   1e-34   
ref|XP_009619517.1|  PREDICTED: MLO-like protein 8                      140   1e-34   
gb|KHN08481.1|  MLO-like protein 6                                      139   1e-34   
ref|XP_008808081.1|  PREDICTED: MLO-like protein 2                      140   1e-34   
ref|XP_004293900.1|  PREDICTED: MLO-like protein 12 isoform X1          139   1e-34   
ref|XP_006594567.1|  PREDICTED: MLO-like protein 6-like                 139   1e-34   
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      140   1e-34   
ref|XP_011098016.1|  PREDICTED: MLO-like protein 10 isoform X2          139   1e-34   
ref|XP_004308899.1|  PREDICTED: MLO-like protein 12                     140   2e-34   
ref|XP_007135969.1|  hypothetical protein PHAVU_009G007000g             139   2e-34   
gb|KDO71546.1|  hypothetical protein CISIN_1g008408mg                   139   2e-34   
ref|XP_003540949.1|  PREDICTED: MLO-like protein 12-like                139   2e-34   
ref|XP_004232584.1|  PREDICTED: MLO-like protein 8                      139   2e-34   
emb|CAN71969.1|  hypothetical protein VITISV_007364                     142   2e-34   
ref|XP_004134822.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    139   3e-34   
ref|XP_009352843.1|  PREDICTED: MLO-like protein 6                      139   3e-34   
ref|XP_004169166.1|  PREDICTED: MLO-like protein 8-like                 139   3e-34   
emb|CDP07140.1|  unnamed protein product                                139   3e-34   
ref|XP_010033601.1|  PREDICTED: MLO-like protein 8                      139   3e-34   
gb|KGN49000.1|  hypothetical protein Csa_6G509690                       139   3e-34   
gb|ACX55086.1|  Mlo3                                                    138   3e-34   
ref|NP_001054825.2|  Os05g0183300                                       135   3e-34   
ref|XP_009601693.1|  PREDICTED: MLO-like protein 3                      138   3e-34   
ref|XP_007204311.1|  hypothetical protein PRUPE_ppa003435mg             139   3e-34   
sp|O49873.1|MLOH1_HORVU  RecName: Full=MLO protein homolog 1            138   4e-34   
ref|XP_007211843.1|  hypothetical protein PRUPE_ppa004687mg             138   4e-34   
ref|XP_009790030.1|  PREDICTED: MLO-like protein 8                      138   4e-34   
gb|KHN33779.1|  MLO-like protein 5                                      138   4e-34   
ref|XP_011014773.1|  PREDICTED: MLO-like protein 10 isoform X1          138   5e-34   
ref|XP_002526370.1|  Protein MLO, putative                              138   5e-34   
ref|XP_011014774.1|  PREDICTED: MLO-like protein 10 isoform X2          138   5e-34   
ref|XP_009359622.1|  PREDICTED: MLO-like protein 8                      138   5e-34   
ref|XP_006587547.1|  PREDICTED: MLO-like protein 10-like isoform X2     137   5e-34   
ref|XP_003523524.1|  PREDICTED: MLO-like protein 5-like                 138   5e-34   
gb|AAU44315.1|  hypothetical protein                                    136   6e-34   
ref|XP_008383677.1|  PREDICTED: MLO-like protein 12                     138   6e-34   
gb|EEC78643.1|  hypothetical protein OsI_18731                          136   6e-34   
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             138   6e-34   
gb|EEE62569.1|  hypothetical protein OsJ_17368                          136   6e-34   
ref|XP_003534232.1|  PREDICTED: MLO-like protein 10-like isoform X1     138   6e-34   
gb|KDP39614.1|  hypothetical protein JCGZ_02634                         137   7e-34   
ref|XP_008380968.1|  PREDICTED: MLO-like protein 3                      137   8e-34   
ref|XP_004240662.1|  PREDICTED: MLO-like protein 3                      137   8e-34   
ref|XP_011089886.1|  PREDICTED: MLO-like protein 3                      137   8e-34   
ref|XP_007015440.1|  MLO, putative                                      137   8e-34   
ref|XP_008463703.1|  PREDICTED: MLO-like protein 3                      137   9e-34   
ref|XP_011034833.1|  PREDICTED: MLO-like protein 5 isoform X2           137   9e-34   
gb|KCW85715.1|  hypothetical protein EUGRSUZ_B02481                     137   9e-34   
ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 137   1e-33   
ref|XP_006654121.1|  PREDICTED: MLO-like protein 5-like                 137   1e-33   
gb|ADV29809.1|  MLO1 protein                                            137   1e-33   
ref|XP_011034832.1|  PREDICTED: MLO-like protein 9 isoform X1           137   1e-33   
gb|KHN20092.1|  MLO-like protein 5                                      137   1e-33   
ref|XP_003527633.1|  PREDICTED: MLO-like protein 5-like                 137   1e-33   
ref|XP_011074255.1|  PREDICTED: MLO-like protein 9                      137   1e-33   
ref|XP_008225160.1|  PREDICTED: MLO-like protein 12                     137   1e-33   
ref|XP_008379649.1|  PREDICTED: MLO-like protein 8                      137   1e-33   
gb|EYU36197.1|  hypothetical protein MIMGU_mgv1a003903mg                137   1e-33   
gb|EMS52084.1|  MLO protein-like protein 1                              136   2e-33   
ref|XP_009369784.1|  PREDICTED: MLO-like protein 8                      137   2e-33   
ref|XP_010466376.1|  PREDICTED: MLO-like protein 10                     137   2e-33   
ref|XP_002301905.2|  hypothetical protein POPTR_0002s00800g             136   2e-33   
ref|XP_010043719.1|  PREDICTED: MLO-like protein 3                      137   2e-33   
ref|XP_009779293.1|  PREDICTED: MLO-like protein 9                      136   2e-33   
gb|ADV04500.1|  MLO-like protein                                        135   2e-33   
ref|XP_008242102.1|  PREDICTED: MLO-like protein 8                      136   2e-33   
ref|XP_009772716.1|  PREDICTED: MLO-like protein 10                     136   2e-33   
ref|XP_007029886.1|  Seven transmembrane MLO family protein             136   2e-33   
emb|CDO99471.1|  unnamed protein product                                135   2e-33   
gb|AIZ94062.1|  Mlo protein                                             136   2e-33   
gb|KJB82477.1|  hypothetical protein B456_013G197800                    136   2e-33   
ref|XP_010550512.1|  PREDICTED: MLO-like protein 10 isoform X2          136   2e-33   
ref|XP_006281817.1|  hypothetical protein CARUB_v10028002mg             136   2e-33   
ref|XP_007027288.1|  Seven transmembrane MLO family protein, puta...    136   3e-33   
ref|XP_010550511.1|  PREDICTED: MLO-like protein 10 isoform X1          136   3e-33   
ref|XP_007018110.1|  Seven transmembrane MLO family protein             136   3e-33   
ref|XP_009586729.1|  PREDICTED: MLO-like protein 9                      136   3e-33   
ref|XP_009399990.1|  PREDICTED: MLO-like protein 3                      135   3e-33   
gb|EMS53724.1|  MLO-like protein 5                                      135   3e-33   
gb|KHG04571.1|  MLO-like protein 1                                      135   3e-33   



>gb|AFH68055.1| seven transmembrane calmodulin binding protein [Capsicum annuum]
Length=528

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 166/225 (74%), Gaps = 11/225 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP L+LFFI FVLFQNAFQVAFF WSW KFG  SC
Sbjct  304  RISERGDIVKGVPVVEIGDHLFWFNRPGLVLFFINFVLFQNAFQVAFFVWSWWKFGFPSC  363

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FHRNAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH  A
Sbjct  364  FHRNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWHNTA  423

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++R R G+ SEN+TP +SRPATPL G SPVHLL  +     D++QA PR    +++ WAN
Sbjct  424  KKRVRHGRVSENTTPISSRPATPLRGTSPVHLLRGYPKYNEDNVQAYPRTSNVENEGWAN  483

Query  204  SAAATSASPRRN-----------LSSNDDQHEIQIVSNDFSFVNN  103
              +  +   +                + DQH+I+I  +DF+F N 
Sbjct  484  ETSTENKDHQEEGQILQHASTSMQHPHTDQHQIEIAMSDFTFGNK  528



>gb|AIT98397.1| MLO1 [Solanum melongena]
Length=523

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 162/220 (74%), Gaps = 6/220 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP L+LF I FVLFQNAFQVAFF WSW KF   SC
Sbjct  304  RISERGDIVKGVPVVETGDHLFWFNRPGLVLFLINFVLFQNAFQVAFFVWSWWKFDFPSC  363

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH  A
Sbjct  364  FHKNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWHHMA  423

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++R + G+ S N+TP +SRP TPLHG SPVHLL  +     DS+QASPR    +++ WAN
Sbjct  424  KKRVKHGRLSGNTTPVSSRPTTPLHGTSPVHLLRGYPQYNEDSVQASPRTSNVENEGWAN  483

Query  204  SAAATSASPRRNLSSND------DQHEIQIVSNDFSFVNN  103
              +  +   +   +S           +I+I  +DF+F N 
Sbjct  484  EISTDNKDYQEGHASTSVRPPHAHNQQIEITMSDFTFGNK  523



>ref|NP_001234814.1| MLO1 protein [Solanum lycopersicum]
 gb|AAX77013.1| MLO1 [Solanum lycopersicum]
Length=507

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 4/214 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP+L+LF I FVLFQNAFQVAFFFWSW KFG  SC
Sbjct  298  RISERGDIVKGVPVVETGDHLFWFNRPALVLFLINFVLFQNAFQVAFFFWSWWKFGFPSC  357

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH   
Sbjct  358  FHKNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWH-HT  416

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  +   S ++TP  SRP TPL G SPVHLL  +     DS+QASPR    +++ WAN
Sbjct  417  AKKRVKHGLSGHTTPANSRPTTPLRGTSPVHLLRGYPQYNEDSVQASPRTSNVENEGWAN  476

Query  204  SAAATSASPRRNLSSNDDQHEIQIVSNDFSFVNN  103
                         +S D   +I+I  +DF+F N 
Sbjct  477  ENQEGEILQH---ASTDHNKQIEITMSDFTFGNK  507



>gb|AIT98395.1| MLO1 [Solanum tuberosum]
Length=518

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 158/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP L+LF I FVLFQNAFQVAFF WSW KFG  SC
Sbjct  305  RISERGDIVKGVPVVETGDHLFWFNRPGLVLFLINFVLFQNAFQVAFFVWSWWKFGFPSC  364

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH   
Sbjct  365  FHQNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWH-HT  423

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  +   S ++TP  SRP TPLHG SPVHLL  +     DS+QASPR    +++ WAN
Sbjct  424  AKKRVKHGLSGHTTPANSRPTTPLHGTSPVHLLRGYPQYNEDSVQASPRTSNVENEGWAN  483

Query  204  SAAATSASPR-RNLSSNDDQHEIQIVSNDFSFVNN  103
              +  +        +S D   +I+I  +DF+F N 
Sbjct  484  EISNDNQEGEILQHASTDHNKQIEITMSDFTFGNK  518



>emb|CDO99726.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 172/241 (71%), Gaps = 32/241 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KG PVVE GD+LFWFNRP L+L+ I+FVLFQNAFQ+AFF ++W K+G+ SC
Sbjct  308  RIQERGDVVKGTPVVETGDHLFWFNRPRLLLYLIQFVLFQNAFQMAFFAFTWYKYGVPSC  367

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DIAIRLS+G++ Q+LCSYVTLPLYALVTQMG++MKPVIF + V+SA+K+WH+ A
Sbjct  368  FHKGPKDIAIRLSVGIVTQVLCSYVTLPLYALVTQMGTTMKPVIFDEKVSSALKSWHKTA  427

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA--DSLQASPRGPASDDQVW  211
            ++  +  ++S ++TPF+SRP TPLHGMSPVHLL  F+ +    DSLQA+PRG  SD+++W
Sbjct  428  KKNIKEDRKSGSTTPFSSRPGTPLHGMSPVHLLQGFRCSTVDDDSLQATPRGSNSDNEIW  487

Query  210  ANSA-------AATSA---------------------SPRRNLSSNDDQHEIQIVSNDFS  115
             + A       AA SA                     SP++   S   QHE+ I S DFS
Sbjct  488  DHEALHNADDNAAGSAGRVTVMHHTVQEIQLASTSRISPKQR--SVKTQHEVNIGSTDFS  545

Query  114  F  112
            F
Sbjct  546  F  546



>ref|XP_009595993.1| PREDICTED: MLO-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=525

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 167/228 (73%), Gaps = 22/228 (10%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RGD+++G PVVE GD+LFWFNRP  +LF I FVLFQNAFQVAFF WSW KF   SC
Sbjct  304  RISKRGDIVRGVPVVETGDHLFWFNRPGFVLFLINFVLFQNAFQVAFFVWSWWKFSYPSC  363

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NAADIAIRL+MGVIIQ+ CSYVTLPLYALVTQMG+SMKP+IFGDNVA+A+++WH  A
Sbjct  364  FHQNAADIAIRLTMGVIIQVHCSYVTLPLYALVTQMGTSMKPIIFGDNVATALRSWHNTA  423

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDF-QHNAADSLQASPRGPASDDQVWA  208
            ++R + G+ SEN+TP +SRPATPLHG SPVHLL  + Q++  +S     R   ++++ WA
Sbjct  424  KKRVKHGRLSENTTPVSSRPATPLHGTSPVHLLRSYPQYSNEES-----RTSNAENEGWA  478

Query  207  NSAAATSASPRR---NLSSNDDQ----------HEIQIVSNDFSFVNN  103
            N       SPRR   N+  +D Q          H+++I  ++F+F N 
Sbjct  479  NE---IPTSPRRQIENIKDDDHQEGEIHASSSVHQVEIAMSEFTFGNK  523



>gb|AIT98396.1| MLO1 [Nicotiana tabacum]
Length=519

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 167/228 (73%), Gaps = 22/228 (10%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RGD+++G PVVE GD+LFWFNRP  +LF I FVLFQNAFQVAFF WSW KF   SC
Sbjct  298  RISKRGDIVRGVPVVETGDHLFWFNRPGFVLFLINFVLFQNAFQVAFFVWSWWKFSYPSC  357

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NAADIAIRL+MGVIIQ+ CSYVTLPLYALVTQMG+SMKP+IFGDNVA+A+++WH  A
Sbjct  358  FHQNAADIAIRLTMGVIIQVHCSYVTLPLYALVTQMGTSMKPIIFGDNVATALRSWHNTA  417

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDF-QHNAADSLQASPRGPASDDQVWA  208
            ++R + G+ SEN+TP +SRPATPLHG SPVHLL  + Q++  +S     R   ++++ WA
Sbjct  418  KKRVKHGRLSENTTPVSSRPATPLHGTSPVHLLRSYPQYSNEES-----RTSNAENEGWA  472

Query  207  NSAAATSASPRR---NLSSNDDQ----------HEIQIVSNDFSFVNN  103
            N       SPRR   N+  +D Q          H+++I  ++F+F N 
Sbjct  473  NE---IPTSPRRQIENIKDDDHQEGEIHASSSVHQVEIAMSEFTFGNK  517



>ref|XP_009782286.1| PREDICTED: MLO-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=532

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 168/235 (71%), Gaps = 29/235 (12%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RGD+++G PVVE GD+LFWFNRP+ +LF I FVLFQNAFQVAFF WSW KFG  SC
Sbjct  304  RISKRGDIVRGVPVVETGDHLFWFNRPAFVLFLINFVLFQNAFQVAFFVWSWWKFGYPSC  363

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NAADIAIRL+MGVIIQ+ CSYVTLPLYALVTQMG+SMKP+IFGDNVA+A+++WH  A
Sbjct  364  FHQNAADIAIRLTMGVIIQVHCSYVTLPLYALVTQMGTSMKPIIFGDNVATALRSWHNTA  423

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDF-QHNAADSLQASPRGPASDDQVWA  208
            ++R + G+ S N+TP +SRPATPLHG SPVHLL  + Q++  +S     R   ++++ WA
Sbjct  424  KKRVKHGRLSGNNTPVSSRPATPLHGTSPVHLLRSYPQYSNEES-----RTSNAENEGWA  478

Query  207  NSAAATSASPRRNLSSND--------------------DQHEIQIVSNDFSFVNN  103
            N     S SPRR + +                      DQH++++  ++F+F N 
Sbjct  479  NE---ISTSPRRQIENTKDDDHQEGEIHASSSMQRPHPDQHQVEVTLSEFTFGNK  530



>ref|XP_010099632.1| MLO-like protein 12 [Morus notabilis]
 gb|EXB80098.1| MLO-like protein 12 [Morus notabilis]
Length=419

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 161/238 (68%), Gaps = 27/238 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGD++KGAP+V+PGD+LFWF RP  MLF I FVLFQNAFQ+AFF WS  +F + SC
Sbjct  180  RIQERGDIVKGAPLVQPGDDLFWFGRPGFMLFLIHFVLFQNAFQLAFFAWSTYEFKIKSC  239

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH  + DIAIRLSMG+IIQILCSYVTLPLYALVTQMGS+M+P IF D VA+A+K WH +A
Sbjct  240  FHSRSEDIAIRLSMGIIIQILCSYVTLPLYALVTQMGSNMRPTIFHDRVATALKKWHHSA  299

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPRGPASDDQVW-  211
            ++  +  + SE ++PF+SRPATP +GMSPVHLL +++ + A +S+  SPRG   +   + 
Sbjct  300  KKNKKHNRHSEGNSPFSSRPATPTYGMSPVHLLHNYRSSTAPNSMHTSPRGSNVEINYYD  359

Query  210  -------------ANSAAATSASPRRNLSSNDDQ------------HEIQIVSNDFSF  112
                         AN     + +   N+ S + +            HE+QI  ++FSF
Sbjct  360  PESSPSPNNGPANANDNTQGNIAKFANVISEEGKQSQEPSSSQQHQHEVQISLSEFSF  417



>ref|XP_011089887.1| PREDICTED: MLO-like protein 6 [Sesamum indicum]
Length=587

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 4/200 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  339  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  399  FHEHVEDIVIRITMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ + S  +TP +S PATP HGMSP+HLL  ++    DSLQ SPR    D   W +
Sbjct  459  KKHIKQNKHSAPTTPMSSHPATPSHGMSPIHLLRHYKSEMTDSLQTSPRKSNYDMDNWES  518

Query  204  SAAATSASPRRNLSSNDDQH  145
                 S SP R     D  H
Sbjct  519  E----SPSPTRFHGQGDAFH  534



>gb|KDP44089.1| hypothetical protein JCGZ_05556 [Jatropha curcas]
Length=261

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 135/168 (80%), Gaps = 3/168 (2%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FGL SCF
Sbjct  5    IQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWKEFGLKSCF  64

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H +  DI IR+SMGV+IQILCSYVTLPLYALVTQMGSSMKP IF + VA+A++ WH+ A+
Sbjct  65   HEHLEDIIIRISMGVLIQILCSYVTLPLYALVTQMGSSMKPTIFNERVAAALRNWHQTAK  124

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR  238
            +  +  + S   TP +SRPATP H MSPVHLL  ++ N  DSLQ SPR
Sbjct  125  KHIKHRKGS--ITPLSSRPATPSHNMSPVHLLRYYR-NEIDSLQNSPR  169



>emb|CAN64133.1| hypothetical protein VITISV_032771 [Vitis vinifera]
Length=569

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 158/247 (64%), Gaps = 39/247 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFN+P L+L+ I FVLFQNAFQVAFF W+W +FGL SC
Sbjct  320  RIQERGEVVKGTPVVEPGDDLFWFNQPRLILYLINFVLFQNAFQVAFFAWTWYEFGLKSC  379

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ IR+SMGVI+QILCSYVTLPLYALVTQMGS+MKP IF D VA A++ WH AA
Sbjct  380  FHERIEDVVIRISMGVIVQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAKALRNWHHAA  439

Query  384  rqrarrgq--------RSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR---  238
            R+  ++ +         S   TPF+SRP TPLHGMSPVHLL   + +  DS+Q SPR   
Sbjct  440  RKHIKQSKQSSAVTPVSSRAGTPFSSRPGTPLHGMSPVHLLRHHR-SELDSVQTSPRMSN  498

Query  237  ----GPASD------DQVWA---------------NSAAATSASPRRNLSSNDDQHEIQI  133
                GP +D      D  W+               N    T   P     +++ QHEI I
Sbjct  499  FDNEGPETDEYRHREDISWSEHHRNPGPEEEGRDTNHRILTRTMPAPQ--ADNAQHEIDI  556

Query  132  VSNDFSF  112
               DFSF
Sbjct  557  QPMDFSF  563



>ref|NP_001268013.1| MLO11 protein [Vitis vinifera]
 gb|ACF25910.1| MLO-like protein 3 [Vitis vinifera]
 emb|CBI32709.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 158/247 (64%), Gaps = 39/247 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFN+P L+L+ I FVLFQNAFQVAFF W+W +FGL SC
Sbjct  334  RIQERGEVVKGTPVVEPGDDLFWFNQPRLILYLINFVLFQNAFQVAFFAWTWYEFGLKSC  393

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ IR+SMGVI+QILCSYVTLPLYALVTQMGS+MKP IF D VA A++ WH AA
Sbjct  394  FHERIEDVVIRISMGVIVQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAKALRNWHHAA  453

Query  384  rqrarrgq--------RSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR---  238
            R+  ++ +         S   TPF+SRP TPLHGMSPVHLL   + +  DS+Q SPR   
Sbjct  454  RKHIKQSKQSSAVTPVSSRAGTPFSSRPGTPLHGMSPVHLLRHHR-SELDSVQTSPRMSN  512

Query  237  ----GPASD------DQVWA---------------NSAAATSASPRRNLSSNDDQHEIQI  133
                GP +D      D  W+               N    T   P     +++ QHEI I
Sbjct  513  FDNEGPETDEYRHREDISWSEHHRNPGPEEEGRDTNHRILTRTMPAPQ--ADNAQHEIDI  570

Query  132  VSNDFSF  112
               DFSF
Sbjct  571  QPMDFSF  577



>ref|XP_010046751.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
Length=569

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 153/224 (68%), Gaps = 17/224 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+G ++KG PVV+PGD+LFWFNRP ++L+ I FVLFQNAFQ+AFF W+W +FGL SCF
Sbjct  349  IQEKGQIVKGTPVVKPGDDLFWFNRPRILLYLIHFVLFQNAFQLAFFAWTWYEFGLRSCF  408

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H    D+ IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF D VA+A++ WHR+A+
Sbjct  409  HEKLQDVIIRISMGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNDRVANALRNWHRSAK  468

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            +  ++ + S   TPF+SRP TP  GMSPVHLL  ++ +A DS+Q +PR     ++ W   
Sbjct  469  KHLKQNRGS--VTPFSSRPGTPSRGMSPVHLLQHYK-SALDSVQTTPRTSNFGNEGWETD  525

Query  201  AAATSASPRRNLSSNDD-----------QHEIQIVSNDFSFVNN  103
                  SP R      D           QHEI   S DFSF N 
Sbjct  526  G---QNSPSRRKEDRGDTEMRVQHAIQVQHEIGTCSVDFSFENR  566



>gb|EYU41617.1| hypothetical protein MIMGU_mgv1a0045332mg, partial [Erythranthe 
guttata]
Length=390

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 155/219 (71%), Gaps = 20/219 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            R QERG+V+KG PVV+P DNLFWFNRP L+L  + FV FQNAFQ+AFF W+W +FG+ SC
Sbjct  156  RFQERGEVVKGTPVVQPADNLFWFNRPYLLLHLVHFVFFQNAFQLAFFIWAWYEFGIRSC  215

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA A++TWH+ A
Sbjct  216  FHETTKDITIRITMGVVIQILCSYVTLPLYALVTQMGSNMKPTIFNERVAKALRTWHQTA  275

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA--DSLQASPRG--------  235
            R++ ++   S   TP +SRP+TPLHG SP+HLL   +HN +  DS+ ASPR         
Sbjct  276  RKQIKKNSHSGLGTPPSSRPSTPLHGSSPLHLL---RHNKSEFDSVNASPRTTIHKTESW  332

Query  234  PASDDQV-WANSAAATSASPRRNLSSNDDQHEIQIVSND  121
            PA  D V W+N+    +A+P       +++ EIQ  SN+
Sbjct  333  PAEHDDVPWSNNNNTGTANP------IEEETEIQEYSNN  365



>gb|ACO07297.1| MLO1 [Pisum sativum]
 gb|AGJ01118.1| MLO1 protein [Pisum sativum subsp. sativum]
Length=574

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 144/204 (71%), Gaps = 4/204 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KGAPVVEPGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  339  RIQDRGEVIKGAPVVEPGDHLFWFNRPHLLLFTIHLVLFQNAFQLAFFAWSTYEFSITSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+  AD  IR+++GV+IQ LCSYVTLPLYALVTQMGS+MKP IF + VA+A+K WH  A
Sbjct  399  FHKTTADSVIRITVGVVIQTLCSYVTLPLYALVTQMGSTMKPTIFNERVATALKNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ ++   S N+TP++SRP+TP H MSPVHLL       +DSLQ SP      ++ W  
Sbjct  459  KKQVKQSNHSNNTTPYSSRPSTPTHAMSPVHLLHRHTAGNSDSLQTSPEKSDYKNEQWDI  518

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
                    P    +    QHEIQI
Sbjct  519  EGEG----PTSLRNDQTGQHEIQI  538



>gb|KCW88826.1| hypothetical protein EUGRSUZ_A01164 [Eucalyptus grandis]
Length=590

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 153/224 (68%), Gaps = 17/224 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+G ++KG PVV+PGD+LFWFNRP ++L+ I FVLFQNAFQ+AFF W+W +FGL SCF
Sbjct  370  IQEKGQIVKGTPVVKPGDDLFWFNRPRILLYLIHFVLFQNAFQLAFFAWTWYEFGLRSCF  429

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H    D+ IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF D VA+A++ WHR+A+
Sbjct  430  HEKLQDVIIRISMGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNDRVANALRNWHRSAK  489

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            +  ++ + S   TPF+SRP TP  GMSPVHLL  ++ +A DS+Q +PR     ++ W   
Sbjct  490  KHLKQNRGS--VTPFSSRPGTPSRGMSPVHLLQHYK-SALDSVQTTPRTSNFGNEGWETD  546

Query  201  AAATSASPRRNLSSNDD-----------QHEIQIVSNDFSFVNN  103
                  SP R      D           QHEI   S DFSF N 
Sbjct  547  G---QNSPSRRKEDRGDTEMRVQHAIQVQHEIGTCSVDFSFENR  587



>gb|ADV40949.1| MLO1 [Medicago truncatula]
 gb|KEH25654.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=574

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KGAPVVEPGD+LFWFN P+L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  337  RIQDRGEVIKGAPVVEPGDHLFWFNSPNLLLFIIHLVLFQNAFQLAFFSWSTYEFSINSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FHR  AD  IR+S+G++IQ LCSYVTLPLYALVTQMGS+MKP IF + +A+A+K WH  A
Sbjct  397  FHRTTADNVIRVSVGILIQFLCSYVTLPLYALVTQMGSTMKPTIFNERLATALKKWHHTA  456

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ +  + S N+TP++SR +TP HGMSPVHLL       +DSLQ SPR    +++ W +
Sbjct  457  KKQVKHNKHSNNTTPYSSRQSTPTHGMSPVHLLHRQTFGNSDSLQTSPRTSNYENEQW-D  515

Query  204  SAAATSASPRRN  169
                 S SPR N
Sbjct  516  VEGGGSTSPRNN  527



>ref|XP_008385390.1| PREDICTED: MLO-like protein 6 [Malus domestica]
Length=368

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE G+V+KG PVV+PGD+LFW NRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  112  RIQESGEVVKGLPVVQPGDHLFWLNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  171

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMG++IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  172  FHEHTEDVVIRVSMGILIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  231

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRP TP H  SPVHLL +++ N  DS  ASPR    + + WAN
Sbjct  232  RKHIKQNKGS--VTPMSSRPVTPSHHTSPVHLLRNYR-NEVDSFHASPRRSNFEGERWAN  288

Query  204  SAAATSASPRRNLSSNDDQHEIQIVSND  121
             + + S     + SS+   H I++   D
Sbjct  289  ESPSPSHHLHVDGSSSSYHHHIEMGDVD  316



>emb|CDP07138.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 152/207 (73%), Gaps = 4/207 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  335  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLRSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A+K WH  A
Sbjct  395  FHEHLEDIIIRISMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALKNWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  + S  ++P +SR ATP H +SPVHLL  ++ +  DSLQ SPR    D + W  
Sbjct  455  KKHIKESKHSGLASPISSRAATPSHHLSPVHLLRRYK-SELDSLQTSPRKSNFDVEQWDT  513

Query  204  SAAATSASPR---RNLSSNDDQHEIQI  133
             + + S   +    ++SS+  QH I++
Sbjct  514  ESPSPSQFHQGSIDHVSSSQHQHNIEL  540



>ref|XP_011044384.1| PREDICTED: MLO-like protein 6 isoform X1 [Populus euphratica]
Length=560

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 149/209 (71%), Gaps = 3/209 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+VLKG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FG+ SC
Sbjct  300  RIQERGEVLKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFGIKSC  359

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV+I+ILCSYVTLPLYALVTQMG+SMKP IF + VA+A++ WH  A
Sbjct  360  FHEHLEDIVIRVSMGVLIEILCSYVTLPLYALVTQMGTSMKPTIFNERVATALRNWHHTA  419

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ +R + S + TP +SRP TP    SPVHLL  ++    DSL  SPR    D + W  
Sbjct  420  KKQIKRNKGSVSVTPMSSRPTTPSRHTSPVHLLRYYRGGEIDSLHTSPRRSNFDVEHWET  479

Query  204  SAAATSASPR---RNLSSNDDQHEIQIVS  127
             + + S  P       S++  Q ++++ S
Sbjct  480  ESPSPSHHPNYAGEGSSTHRHQQQLELAS  508



>ref|XP_010905123.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
Length=587

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG P+V+P D+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FG  SC
Sbjct  344  RIMERGDVVKGIPIVKPTDDLFWFNRPGLLLYLIHFVLFQNAFQLAFFAWSWFEFGYPSC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IR+SMGV+IQ+LCSYVTLPLYALVTQMGS+MKP IF D VA+A++ WH  A
Sbjct  404  FHKRIEDIIIRISMGVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSDRVATALRKWHNTA  463

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            R+  +  +RS + TP  TSRPATP+HG+SPVHLL  ++ +  DSLQASPR    DD+
Sbjct  464  RKHLKENRRSSSVTPLSTSRPATPIHGLSPVHLLRHYR-SEVDSLQASPRRYTIDDE  519



>gb|AFW98802.1| MLO protein 2 [Rosa multiflora]
Length=588

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 153/238 (64%), Gaps = 28/238 (12%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQERG+V+KG P+VEPGD+LFWFN P L+L  I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  346  KIQERGEVVKGTPLVEPGDHLFWFNNPRLILHIIHFVLFQNAFQLAFFAWTWYEFGLKSC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R++MGVIIQILCSYVTLPLYALVTQMGS+MKP IF D VA+AI+ WH   
Sbjct  406  FHDKLEDVVLRITMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIRKWH---  462

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ-HNAADSLQASPR-------GP-  232
                +  ++S++S P TS P TPLHGMSPVHLL  +Q     +S+   PR       GP 
Sbjct  463  HAAKKHVKQSKHSVP-TSAPGTPLHGMSPVHLLRHYQSEQDVESMHTLPRMSYFESEGPN  521

Query  231  ------ASDDQVWANSAAATSASPRRNLSS---------NDDQHEIQIVSNDFSFVNN  103
                   +DD  W+N       S     +S         N  QHEIQI + DFSF  N
Sbjct  522  ESPSRHDNDDVPWSNQGQEEEISAHYQPNSVNNPLPGHGNRIQHEIQIHTRDFSFEKN  579



>ref|XP_008796803.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVV+P D+LFWFN P L+L+ I FVLFQNAFQ+AFF WSW +FGL SC
Sbjct  343  RIMERGDVVKGIPVVQPTDDLFWFNHPGLLLYLIHFVLFQNAFQLAFFAWSWSEFGLPSC  402

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+N  DI IR+SMGV+IQ+LCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  403  FHKNIEDINIRISMGVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSERVATALRKWHDTA  462

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            R+  +  +RS + TP  TSRPATP HG+SPVHLL  ++ +  DSLQASPR    DD+
Sbjct  463  RKHLKESRRSSSVTPLSTSRPATPTHGLSPVHLLRHYR-SEVDSLQASPRRSTIDDE  518



>ref|XP_009603532.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   234 bits (597),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 148/211 (70%), Gaps = 9/211 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  341  RIHERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +  DI IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A+K WH  A
Sbjct  401  YHDHTEDIVIRISMGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNEKVATALKNWHHTA  460

Query  384  rqrarrgqRSENS-TPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD-QVW  211
            ++  +   +  N+ TP +SRP TP HGMSPVHLL     +   SLQ SPR    D    W
Sbjct  461  KKHIKDQSKHSNTVTPMSSRPGTPSHGMSPVHLLRSHYRSDVGSLQNSPRRSNYDHADHW  520

Query  210  ANSAAATSASPRR-----NLSSNDDQHEIQI  133
             N     S SP R     + SS+   H+IQ+
Sbjct  521  DNEGG--SPSPSRFYQEGDGSSSSYMHQIQL  549



>ref|XP_006356488.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 157/216 (73%), Gaps = 14/216 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+++KG P+VEPGD+LFWFNRP+L+LFFI FVLFQNA+Q+AFF WSW KF + SC
Sbjct  312  RIQERGEIVKGTPLVEPGDDLFWFNRPALLLFFIHFVLFQNAYQLAFFAWSWWKFNVPSC  371

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+NA DIAI L+MG +IQ+LCSYVTLPLYALVTQMGS+MKPVIFGDNVASAI+TWH+ A
Sbjct  372  FHKNATDIAITLTMGALIQVLCSYVTLPLYALVTQMGSTMKPVIFGDNVASAIRTWHQTA  431

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMS-PVHLLSDFQHNAADSLQASPRGPASDDQVWA  208
            +QRA+ G+ SEN +P  SR A+PL G S PV      +H      Q  P  P S  +   
Sbjct  432  KQRAKNGRPSENVSPVRSRAASPLRGGSFPVQQ----KHG-----QLYPPSPNSSRR---  479

Query  207  NSAAATSASPRRNL-SSNDDQHEIQIVSNDFSFVNN  103
             S     +S R+   + +D+Q EI+I  ND S  N 
Sbjct  480  RSGGNPESSSRQIFDAGSDEQSEIEITLNDLSLENK  515



>ref|XP_007009792.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY18602.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=574

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 146/204 (72%), Gaps = 8/204 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RGDV+KGAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F + SC
Sbjct  335  RIQDRGDVVKGAPVVQPGDDLFWFGRPRFLLFLIHLVLFTNAFQLAFFVWSTYEFTIKSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +  DI IR+SMGVIIQ LCSYVTLPLYALVTQMG++M+P IF D VA+A+K+WH  A
Sbjct  395  YHEHLEDIIIRVSMGVIIQFLCSYVTLPLYALVTQMGTNMRPTIFNDRVAAALKSWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  + SEN+TPF+SRPATP HGMSPVHLL +    + +S   SPR    ++  W  
Sbjct  455  KKHTKHSRHSENTTPFSSRPATPTHGMSPVHLLHN-HPRSVESYHTSPRNSNLENDQWDL  513

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
                   SPRR  + ND  H+ Q+
Sbjct  514  D------SPRRR-AINDSVHDRQL  530



>ref|XP_010558749.1| PREDICTED: MLO-like protein 6 [Tarenaya hassleriana]
Length=573

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 152/230 (66%), Gaps = 21/230 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQE+GDV+KGAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  341  QIQEKGDVVKGAPVVQPGDDLFWFGRPRFILFLIHVVLFTNAFQLAFFAWSTYEFNLKNC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+ MGVI+QILCSYVTLPLYALVTQMGS+MKP +F + VA A+K WH  A
Sbjct  401  FHESTVDVIIRVVMGVIVQILCSYVTLPLYALVTQMGSTMKPTVFNERVAVALKNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++++  + S ++TPF+SRP TP  G SP+HLLS+FQ+ + +SL ASP    SD   W +
Sbjct  461  KKQSKHSKHSNSTTPFSSRPTTPTRGTSPIHLLSNFQNRSHESLSASPSPRHSDFDQWDH  520

Query  204  SAAATSASPRRNLSSNDD-------------------QHEIQIVSNDFSF  112
                   S   N  +ND+                   QHEI I   DFSF
Sbjct  521  HQEEAETSTHHN--NNDESSEQRPDVALPPGPGPIRTQHEISINVRDFSF  568



>ref|XP_011044385.1| PREDICTED: MLO-like protein 6 isoform X2 [Populus euphratica]
Length=611

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 142/200 (71%), Gaps = 0/200 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+VLKG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FG+ SC
Sbjct  339  RIQERGEVLKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFGIKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV+I+ILCSYVTLPLYALVTQMG+SMKP IF + VA+A++ WH  A
Sbjct  399  FHEHLEDIVIRVSMGVLIEILCSYVTLPLYALVTQMGTSMKPTIFNERVATALRNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ +R + S + TP +SRP TP    SPVHLL  ++    DSL  SPR    D + W  
Sbjct  459  KKQIKRNKGSVSVTPMSSRPTTPSRHTSPVHLLRYYRGGEIDSLHTSPRRSNFDVEHWET  518

Query  204  SAAATSASPRRNLSSNDDQH  145
             + + S  P      +   H
Sbjct  519  ESPSPSHHPNYAGEGSSSHH  538



>ref|XP_004148785.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 ref|XP_004168500.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 gb|KGN64744.1| hypothetical protein Csa_1G085890 [Cucumis sativus]
Length=582

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 155/240 (65%), Gaps = 32/240 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQVAFF W+W +FGL SC
Sbjct  342  RIQERGEVVKGVPVVEPGDDLFWFNRPRLILYLINFVLFQNAFQVAFFAWTWYEFGLNSC  401

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA A++ W+ +A
Sbjct  402  FHEHIEDVVIRISMGVLVQILCSYVTLPLYALVTQMGSTMKPTIFNERVAEALRNWYHSA  461

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  +  + S   TP +SRPATP H MSPVHLL  ++ +  DS   SPR    D   W N
Sbjct  462  RKHIKHNRGS--VTPMSSRPATPTHSMSPVHLLRHYK-SEVDSFHTSPRRSPFDTDRWDN  518

Query  204  SA--------AATSASPRRNL--------------------SSNDDQHEIQIVS-NDFSF  112
             +         ++S+ P   +                    S N +QHEI I    DFSF
Sbjct  519  DSPSPSRHVDGSSSSQPHVEMGGYEKDPVESSSSQVDPVQPSRNRNQHEIHIGGPKDFSF  578



>ref|XP_008796805.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVV+P D+LFWFNRP L+L  I FVLFQNAFQ+AFF WSW +FGL SC
Sbjct  343  RIMERGDVVKGIPVVQPTDDLFWFNRPGLLLHLIHFVLFQNAFQLAFFAWSWSEFGLPSC  402

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+N  DI IR+SMGV+IQ+LCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  403  FHKNIEDIIIRISMGVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSERVATALRKWHDTA  462

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            R+  +  +RS + TP  TSRPATP HG+SPVHLL  ++ +  DSLQASPR     D+
Sbjct  463  RKHLKESRRSSSVTPLSTSRPATPTHGLSPVHLLRHYR-SEVDSLQASPRRSTIYDE  518



>ref|XP_010905121.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
 ref|XP_010905122.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
Length=579

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVV P D+LFWFNRP L+LF I FVLFQNAFQ+AFF WSW++FG  SC
Sbjct  338  RIMERGDVVKGIPVVHPTDDLFWFNRPRLLLFLIHFVLFQNAFQLAFFAWSWLEFGFPSC  397

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IR+SMGV+IQ+LCSYVTLPLYALVTQMGS+MKP IF D VA+A++ WH  A
Sbjct  398  FHKRIEDIIIRISMGVLIQVLCSYVTLPLYALVTQMGSNMKPTIFSDRVATALRKWHETA  457

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            R+  +  +RS ++TP  TSRPATP HG+SPV  L  ++ +  DSLQASPR   +DD+
Sbjct  458  RKHLKENRRSTSATPLSTSRPATPTHGLSPVPFLRRYR-SEVDSLQASPRRHTTDDE  513



>ref|XP_002533246.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29131.1| Protein MLO, putative [Ricinus communis]
Length=583

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAPVVEPGD+LFWF RP L+LF I   LFQNAFQ+AFF WS  K G  SC
Sbjct  341  RIQERGDVVKGAPVVEPGDDLFWFGRPRLILFLIHLCLFQNAFQLAFFAWSVWKIGPKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    DI I+++MGVIIQ+LCSYVTLPLYALVTQMGSSM+P IF D VA+A+K WH  A
Sbjct  401  YHDKTEDIVIKITMGVIIQVLCSYVTLPLYALVTQMGSSMRPTIFNDRVAAALKNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ-HNAADSLQASPRGPASDDQVW  211
            ++ A+  + SEN TP +SRP TP +GMSPVHLL +++   A DS QASPR      + W
Sbjct  461  KKHAKHSKHSENHTPMSSRPTTPTYGMSPVHLLHNYRISTAPDSSQASPRNSNHGAENW  519



>ref|XP_009801961.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=597

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 148/211 (70%), Gaps = 9/211 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  341  RIHERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +  DI IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A+K WH  A
Sbjct  401  YHDHTEDIVIRISMGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNEKVATALKNWHHTA  460

Query  384  rqrarrgqRSENS-TPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD-QVW  211
            ++  +   +  N+ TP +SRP TP HGMSP+HLL     +   SLQ SPR    D    W
Sbjct  461  KKHIKDQSKHSNTVTPMSSRPGTPSHGMSPIHLLRGHYMSDMGSLQNSPRRSNFDHVDHW  520

Query  210  ANSAAATSASPRR-----NLSSNDDQHEIQI  133
             N     S SP R     + SS+   H+IQ+
Sbjct  521  DNEGG--SPSPSRFYQEGDGSSSSYMHQIQL  549



>ref|XP_007015437.1| Seven transmembrane MLO family protein isoform 2 [Theobroma cacao]
 gb|EOY33056.1| Seven transmembrane MLO family protein isoform 2 [Theobroma cacao]
Length=519

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 3/186 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+LF I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  277  RIQERGEVVKGVPVVQPGDDLFWFNRPRLVLFLINFVLFQNAFQLAFFAWTWFEFGLKSC  336

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  337  FHEHVEDVVIRISMGVLVQILCSYVTLPLYALVTQMGSNMKPTIFNERVATALRKWHHTA  396

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ + S   TPF+SRP TP H  SPVHLL +++ +  DSL ASPR    D + W  
Sbjct  397  KKHIKQNKGS--GTPFSSRPNTPSHHTSPVHLLRNYR-SEMDSLHASPRRSNFDIEHWDT  453

Query  204  SAAATS  187
             + + S
Sbjct  454  DSPSPS  459



>gb|AGV68799.1| MLO1 [Prunus armeniaca]
Length=591

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 149/204 (73%), Gaps = 3/204 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  339  RIQERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMG++IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  399  FHEHIEDIIIRVSMGILIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  +  + S   TP +SRPATP H MSP+HLL +++ +  DS   SPR    + + W  
Sbjct  459  RKHIKHNKGS--VTPMSSRPATPSHHMSPIHLLRNYR-SEVDSFYNSPRRSNFEGERWDT  515

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
             +A+ S     + +S+   H+I++
Sbjct  516  ESASPSHHLHVDGTSSSHHHQIEL  539



>ref|XP_008338448.1| PREDICTED: MLO-like protein 6 [Malus domestica]
Length=560

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG  VV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  313  RIQERGEVVKGLLVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  372

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  373  FHEHTEDVIIRVSMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  432

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRPATP H MSPVHLL +++ +  DS   SPR    + + WAN
Sbjct  433  RKHIKQNKGS--VTPMSSRPATPSHHMSPVHLLRNYR-SEVDSFHTSPRKSNFEGERWAN  489

Query  204  SAAATSASPRRNLSSNDDQHEIQIVSND  121
             + + S     + +S+   H  ++  N+
Sbjct  490  ESXSPSHHLHVDDTSSSYHHHERVDVNE  517



>gb|EPS69703.1| hypothetical protein M569_05063, partial [Genlisea aurea]
Length=278

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV P D+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FGL SC
Sbjct  106  RIQERGEVVKGVPVVRPEDDLFWFNRPRLILYLINFVLFQNAFQLAFFVWSWYEFGLRSC  165

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH++  DIAIR+SMGV+IQILCSYVTLPLYALVTQMGS+M+  IF + VA+A++ WH  A
Sbjct  166  FHQHWEDIAIRISMGVLIQILCSYVTLPLYALVTQMGSTMRLTIFNERVATALRNWHHTA  225

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS  226
            ++  +        TP +S PATP H +SPVHLL  ++ N ADSL ASPR P+S
Sbjct  226  KKNIKHAA----KTPPSSHPATPSHSLSPVHLLRHYR-NEADSLDASPRIPSS  273



>ref|XP_007015436.1| Seven transmembrane MLO family protein isoform 1 [Theobroma cacao]
 gb|EOY33055.1| Seven transmembrane MLO family protein isoform 1 [Theobroma cacao]
Length=580

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 3/186 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+LF I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  338  RIQERGEVVKGVPVVQPGDDLFWFNRPRLVLFLINFVLFQNAFQLAFFAWTWFEFGLKSC  397

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  398  FHEHVEDVVIRISMGVLVQILCSYVTLPLYALVTQMGSNMKPTIFNERVATALRKWHHTA  457

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ + S   TPF+SRP TP H  SPVHLL +++ +  DSL ASPR    D + W  
Sbjct  458  KKHIKQNKGS--GTPFSSRPNTPSHHTSPVHLLRNYR-SEMDSLHASPRRSNFDIEHWDT  514

Query  204  SAAATS  187
             + + S
Sbjct  515  DSPSPS  520



>ref|XP_009347038.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=587

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 145/197 (74%), Gaps = 7/197 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG  VV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  341  RIQERGEVVKGLLVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  401  FHEHTEDVIIRVSMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRPATP H MSPVHLL +++ +  DS   SPR    + + WAN
Sbjct  461  RKHIKQNKGS--VTPMSSRPATPSHHMSPVHLLRNYR-SEVDSFHTSPRKSNLEGERWAN  517

Query  204  SAAATSASPRRNLSSND  154
                 S SP  +L  +D
Sbjct  518  E----SPSPSHHLHVDD  530



>ref|XP_007204981.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
 gb|EMJ06180.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
Length=593

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 148/204 (73%), Gaps = 3/204 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  341  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMG++IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  401  FHEHIEDIIIRVSMGILIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  +  + S   TP +SRPATP H MSP+HLL +++ +  DS   SPR    + + W  
Sbjct  461  RKHIKHNKGS--VTPMSSRPATPSHHMSPIHLLRNYR-SEVDSFYNSPRRSNFEGERWDT  517

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
             + + S     + +S+   H+I++
Sbjct  518  ESPSPSHRLHVDGTSSSHHHQIEL  541



>ref|XP_009596416.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 147/215 (68%), Gaps = 14/215 (7%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  335  RIQERGEVVKGVPVVQPGDDLFWFNRPRLLLYLINFVLFQNAFQLAFFAWTWYEFGLKSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR++MGV+IQILCSYVTLPLYALVTQMGSSMKP IF + VA+A+K WH  A
Sbjct  395  FHDHTEDIVIRMTMGVLIQILCSYVTLPLYALVTQMGSSMKPTIFNERVATALKNWHHTA  454

Query  384  rqrarrgqRSENS-TPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWA  208
            ++  +   +  N+ TP +SRP TP HGMSPVHLL    H  +D +  SPR    +   W 
Sbjct  455  KKHVKEINKHSNTVTPMSSRPTTPSHGMSPVHLLRG-NHLRSD-MDDSPRRSNYNVDHWD  512

Query  207  ----------NSAAATSASPRRNLSSNDDQHEIQI  133
                      N     S SP R  +   D H+IQI
Sbjct  513  TEGSPSPTRFNQGREGSPSPTR-FNQGGDGHQIQI  546



>ref|XP_006436274.1| hypothetical protein CICLE_v10031130mg [Citrus clementina]
 gb|ESR49514.1| hypothetical protein CICLE_v10031130mg [Citrus clementina]
Length=554

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 10/213 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAPVV+PGD+LFWF RP  +LF I  VLFQNAFQ+AFF WS  +F L SC
Sbjct  324  RIQERGDVVKGAPVVQPGDDLFWFGRPRFILFLIHLVLFQNAFQLAFFSWSTYEFALKSC  383

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DIAIR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF D VA+A+K WH  A
Sbjct  384  FHKKTEDIAIRISMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAAALKNWHHIA  443

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLL---------SDFQHNAADSLQASPRGP  232
            ++  ++G+ S ++TP +SRP TP HGMSPVHLL         S+F+H   D  +   R P
Sbjct  444  KKHTKQGRLSGSNTPMSSRPQTPTHGMSPVHLLHNYPNSSYHSNFEHEHWDP-ENQIRSP  502

Query  231  ASDDQVWANSAAATSASPRRNLSSNDDQHEIQI  133
                ++   S    + S  + +++ ++  +I++
Sbjct  503  RHHREIMNESPPHYAESSEQEVAALEEPRQIEM  535



>ref|XP_008463775.1| PREDICTED: MLO-like protein 6 [Cucumis melo]
Length=580

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 156/240 (65%), Gaps = 34/240 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQVAFF W+W +FGL SC
Sbjct  342  RIQERGEVVKGVPVVEPGDDLFWFNRPRLILYLINFVLFQNAFQVAFFAWTWYEFGLNSC  401

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA A++ W+ +A
Sbjct  402  FHEHIEDVVIRISMGVLVQILCSYVTLPLYALVTQMGSTMKPTIFNERVAEALRNWYHSA  461

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  +  + S   TP +SRPATP H MSPVHLL  ++ +  DS   SPR   +D   W N
Sbjct  462  RKHIKHNRGS--VTPMSSRPATPTHSMSPVHLLRHYK-SEVDSFHTSPRRFDTDR--WDN  516

Query  204  SA--------AATSASPRRNL--------------------SSNDDQHEIQIVS-NDFSF  112
             +         ++S+ P   +                    S N +QHEI I    DFSF
Sbjct  517  DSPSPSRHVDGSSSSQPHVEMGGYEKDPVDSSSSQVDPIQPSRNRNQHEIHIGGPKDFSF  576



>gb|KDO48443.1| hypothetical protein CISIN_1g008391mg [Citrus sinensis]
Length=567

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 10/213 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAPVV+PGD+LFWF RP  +LF I  VLFQNAFQ+AFF WS  +F L SC
Sbjct  337  RIQERGDVVKGAPVVQPGDDLFWFGRPRFILFLIHLVLFQNAFQLAFFSWSTYEFALKSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DIAIR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF D VA+A+K WH  A
Sbjct  397  FHKKTEDIAIRISMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAAALKNWHHIA  456

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLL---------SDFQHNAADSLQASPRGP  232
            ++  ++G+ S ++TP +SRP TP HGMSPVHLL         S+F+H   D  +   R P
Sbjct  457  KKHTKQGRLSGSNTPMSSRPQTPTHGMSPVHLLHNYPNSSYHSNFEHEHWDP-ENQIRSP  515

Query  231  ASDDQVWANSAAATSASPRRNLSSNDDQHEIQI  133
                ++   S    + S  + +++ ++  +I++
Sbjct  516  RHHREIMNESPPHYAESSEQEVAALEEPRQIEM  548



>ref|XP_004304413.1| PREDICTED: MLO-like protein 6 [Fragaria vesca subsp. vesca]
Length=573

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 149/232 (64%), Gaps = 28/232 (12%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQERG+V+KG P+VEPGD+LFWFN P L+L  I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  346  KIQERGEVVKGTPLVEPGDHLFWFNSPRLILHIIHFVLFQNAFQLAFFAWTWYEFGLKSC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF D VA+AI+ WH   
Sbjct  406  FHDKMEDVVLRITMGVVIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIRKWH---  462

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNA-ADSLQASPR-------GPA  229
                +  ++S++S P TS P TPLHGMSPVHLL  +      DS+Q  PR       GP 
Sbjct  463  HAAKKHVKQSKHSVP-TSAPGTPLHGMSPVHLLRHYHSELDMDSMQTLPRMSYAEREGPN  521

Query  228  -------SDDQVWANSAAATSASPRRNLSS---------NDDQHEIQIVSND  121
                   +DD  W+N       S     +S         N  QHEIQI + D
Sbjct  522  ESPSHHDTDDVPWSNQGQEEEISAHYQPNSVNNPPPGYGNQIQHEIQIHTKD  573



>ref|XP_009385958.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=596

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +I ERGDV+KG PVV PGD LFWFNRP L+LF I FVLFQNAFQ+AFF WSW +FG  SC
Sbjct  348  QIMERGDVVKGVPVVRPGDKLFWFNRPGLLLFLIHFVLFQNAFQLAFFAWSWYEFGYPSC  407

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH++  DI IR+SMGV+IQ+LCSYVTLPLYALVTQMGS++KP IF + VA+A++ WH  A
Sbjct  408  FHKSIEDIVIRISMGVLIQVLCSYVTLPLYALVTQMGSNLKPTIFNERVATALRKWHHTA  467

Query  384  rqrarrgqRSENSTP--FTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD  220
            R+R +  +RS + TP   TSRPATP H +SP+H+L  + HN A+SLQ SP+    DD
Sbjct  468  RKRLKENRRSASVTPSLSTSRPATPTHRLSPLHVL-QYHHNEAESLQNSPKKFTMDD  523



>ref|XP_002314276.1| hypothetical protein POPTR_0009s01710g [Populus trichocarpa]
 gb|EEE88231.1| hypothetical protein POPTR_0009s01710g [Populus trichocarpa]
Length=620

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 148/209 (71%), Gaps = 4/209 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FG+ SC
Sbjct  360  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFGIKSC  419

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV+I+ILCSYVTLPLYALVTQMGSSMKP IF + VA+A++ WH  A
Sbjct  420  FHEHVEDIVIRVSMGVLIEILCSYVTLPLYALVTQMGSSMKPTIFNERVATALRNWHHTA  479

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ +R + S + TP +SRP TP    SP+HLL  ++    DSL  SP     D + W  
Sbjct  480  KKQIKRNKGSVSVTPMSSRPTTPSRHTSPIHLLRHYR-GEIDSLHTSPGRSNFDVEHWET  538

Query  204  SAAATSASPR---RNLSSNDDQHEIQIVS  127
             + + S  P       SS+  Q ++++ S
Sbjct  539  ESPSPSHHPNYAGEGSSSHRHQQQLELAS  567



>ref|XP_009378090.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=569

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 156/242 (64%), Gaps = 33/242 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAP+V+PGD+LFWF  P LMLF I FVLFQNAFQ+AFF WS  +FG+ SC
Sbjct  326  RIQERGDVVKGAPLVQPGDHLFWFGSPRLMLFLIHFVLFQNAFQLAFFAWSTYQFGIKSC  385

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IRLS+G+++Q+LCSYVTLPLYALVTQMGS+MKP IF + VA+A+K  H  A
Sbjct  386  FHQRTEDIVIRLSIGIMVQVLCSYVTLPLYALVTQMGSTMKPTIFNEEVAAAVKNCHHKA  445

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD-SLQASPRGPASDDQVWA  208
            ++ A+    S ++TPF++ P TP  GMSPVHLL    + + D     SPRG  S+ ++  
Sbjct  446  KKNAKHSHHSPSTTPFSTMPPTPTQGMSPVHLLHTHNYRSNDDGFITSPRG--SNLEMDH  503

Query  207  NSAAATSASPRRNLSSND------------------------------DQHEIQIVSNDF  118
             S   +S SP  N+  +D                               QHEI+I+S++F
Sbjct  504  RSTEGSSHSPNNNVGPSDGDEIMQITDIGDLDQEPGSAELARAPRRTRSQHEIEIISSNF  563

Query  117  SF  112
            SF
Sbjct  564  SF  565



>ref|XP_008463924.1| PREDICTED: MLO-like protein 6 isoform X1 [Cucumis melo]
Length=592

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 155/247 (63%), Gaps = 39/247 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG+ SC
Sbjct  342  RIQERGEVVKGVPVVEPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSC  401

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  402  FHEHTEDLVIRITMGVLVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTA  461

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRPATP H +SPVHLL  ++ +  DS+  SPR    D   W  
Sbjct  462  RKHIKQNRGS--MTPMSSRPATPSHHLSPVHLLRHYR-SELDSVHTSPRRSNFDTDQWDP  518

Query  204  S--------------------------------AAATSASPRRNLSS----NDDQHEIQI  133
                                             A   S  P R   S    N +QH+I +
Sbjct  519  ESPSPSHHFHRRPHPGDGSISNHHRDVEAGDLDADVDSPQPDRTTQSMNPINIEQHQIDV  578

Query  132  VSNDFSF  112
             SN+FSF
Sbjct  579  GSNEFSF  585



>gb|KDP25722.1| hypothetical protein JCGZ_23943 [Jatropha curcas]
Length=548

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RGDV+KGAPVV+PGD+LFWF RP L+LF I  VLFQNAFQ+A F WS  K G   C
Sbjct  306  RIQDRGDVVKGAPVVKPGDDLFWFGRPRLILFLIHLVLFQNAFQLALFIWSLWKVGSKGC  365

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    DI I+++MGVIIQ+LCSYVTLPLYALVTQMGSSM+P +F D VA+A+K WH  A
Sbjct  366  YHDKTEDIVIKVTMGVIIQVLCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTA  425

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPRGPASDDQVWA  208
            +++A+  + SE+ TP +SRP TP +GMSPVHLL +++ + A +SLQASPR    +   W 
Sbjct  426  KKQAKHSRHSESHTPMSSRPQTPTYGMSPVHLLHNYRSSTAPNSLQASPRNSNYEADNWD  485

Query  207  NSAAATS---ASPRRNLSSN-DDQHEIQIVSND  121
              A         P  + S +  DQ+E  IV  +
Sbjct  486  PEALNNQQVIGEPEGSESPDARDQNETAIVVQE  518



>ref|XP_010253610.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=581

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+RG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG+ SC
Sbjct  335  KIQDRGEVVKGVPVVEPGDDLFWFNRPRLILYLIHFVLFQNAFQLAFFAWTWFEFGMKSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ I+++MGVIIQ LCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH  A
Sbjct  395  FHEHTEDVVIKITMGVIIQFLCSYVTLPLYALVTQMGSTMKPTIFNERVAIALRKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R++ ++ Q+S  +TP  SRP TP HG SPV LL + + +  DS+Q SPR    D++ W  
Sbjct  455  RKQIKQNQKSGTATPMPSRPTTPRHGFSPVSLLQNQRRSDDDSVQTSPRFSNFDNEQWEG  514

Query  204  S  202
             
Sbjct  515  E  515



>ref|XP_007208289.1| hypothetical protein PRUPE_ppa003437mg [Prunus persica]
 gb|EMJ09488.1| hypothetical protein PRUPE_ppa003437mg [Prunus persica]
Length=574

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 153/242 (63%), Gaps = 33/242 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +++ERG+V+KG P+VEPGD+LFWFN P L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  337  KLKERGEVVKGTPLVEPGDHLFWFNNPRLILYLIHFVLFQNAFQLAFFAWTWYEFGLKSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGVIIQILCSYVTLPLYALVTQMGS+MKP IF D VA+AIK WH   
Sbjct  397  FHEKLEDVILRVSMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIKKWH---  453

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ--HNA-------------ADSLQ  250
               + +     N    TS P TPLH MSPVHLL  +Q  H+              AD   
Sbjct  454  --LSAKKHLKHNKNSPTSVPGTPLHSMSPVHLLRHYQSEHDVDSAHTLQRMSYFDADGPN  511

Query  249  ASPRGPASDDQVWANSA---------AATSASPRRNLSS---NDDQHEIQIVSNDFSFVN  106
            +SP  P  DD  W+N           +A  ++   NL +   +  QHEIQI S +F+F  
Sbjct  512  SSP-SPHQDDLSWSNQGRSHGQEEEISAHESNAMNNLKAGYGSRSQHEIQIHSAEFTFEK  570

Query  105  NK  100
            ++
Sbjct  571  SE  572



>ref|XP_008387611.1| PREDICTED: MLO-like protein 6 isoform X1 [Malus domestica]
Length=406

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            ++ ERG+V++G P+VEPGD+LFWFN P L+L+ I FVLFQNAF +AFF W+W +FGL SC
Sbjct  169  KLSERGEVVRGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSC  228

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGVIIQILCSYVTLPLYALVTQMGS+MKPVIF D VA+A+K WH   
Sbjct  229  FHEKLEDVVLRISMGVIIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWH---  285

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNA-ADSLQASPRGPASDDQ  217
               A++  + +N++P  S P TPLH MSPVHLL ++++    DS+Q SPR P  D++
Sbjct  286  -IAAKKHVKHKNASP-ASAPGTPLHSMSPVHLLRNYKYEQDIDSIQTSPRMPYFDNE  340



>ref|XP_010264735.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=578

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 155/240 (65%), Gaps = 26/240 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQ+AF  W+W +FG  SC
Sbjct  339  RIQERGEVVKGVPVVEPGDDLFWFNRPRLILYLIHFVLFQNAFQLAFLVWTWYEFGRKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMGV++QILCSYVTLPLYALVTQMGSSM+P IF + VA+A++ WH  A
Sbjct  399  FHEHTEDLVIRISMGVLVQILCSYVTLPLYALVTQMGSSMRPTIFNERVATALRNWHHRA  458

Query  384  rqrarr--gqRSENSTPFTSRPATPLHGMSPVH-LLSDFQHNAADSLQASPRGPASDDQV  214
            R+  ++    RS + TP +SRP TP HG SPVH LL+  + + ADS+  SPR    D++ 
Sbjct  459  RKHLKQNGHGRSGSVTPISSRPTTPRHGFSPVHLLLNTHRSDHADSIHTSPRFSNLDNEQ  518

Query  213  WANSAAATSAS-----PRRNLSSND------------------DQHEIQIVSNDFSFVNN  103
                   + +S       R L   D                   QH I++ S DFSFV +
Sbjct  519  REGEGTPSPSSYHHHHHERWLGGQDREAHEAEATTPPTAPPVHTQHVIEMSSADFSFVKS  578



>gb|EYU36196.1| hypothetical protein MIMGU_mgv1a014001mg [Erythranthe guttata]
Length=204

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 143/191 (75%), Gaps = 4/191 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V++G PVV+PGD+LFWFN+P L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  4    RIQERGEVVQGVPVVQPGDDLFWFNQPRLILYLINFVLFQNAFQLAFFAWTWYEFGLRSC  63

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA+A+K WHR A
Sbjct  64   FHEHVEDIVIRISMGVVVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALKNWHRTA  123

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ + S   TP +SRPATP HGMSP+HLL  ++    +SLQ SPR    +   W  
Sbjct  124  KKHVKQSKNSPTGTPMSSRPATPSHGMSPIHLLRHYRSEMDNSLQNSPRKSNPNVDRW--  181

Query  204  SAAATSASPRR  172
                 S SP R
Sbjct  182  --EPESPSPTR  190



>ref|XP_008225371.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=591

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  339  RIQERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMG++IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  399  FHEHIEDIIIRVSMGILIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  +  +     TP +SRPATP H MSP+HLL +++ +  DS   SPR    + + W  
Sbjct  459  RKHIKHNKGP--VTPMSSRPATPSHHMSPIHLLRNYR-SEVDSFYNSPRRSNFEGERWDT  515

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
             + + S     + +S    H+I++
Sbjct  516  ESPSPSHHLHVDGTSASHHHQIEL  539



>ref|XP_011077127.1| PREDICTED: MLO-like protein 12 [Sesamum indicum]
Length=490

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVV+PGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WSW KFG  SC
Sbjct  305  RILERGDVIKGTPVVQPGDDLFWFNRPGLILFLIHLVLFQNAFQLAFFAWSWWKFGYPSC  364

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H N  D+ IR++MGV+IQ+LCSYVTLPLYALVTQMG++MKPVIF D VASA++ WH+ A
Sbjct  365  YHENIEDLVIRIAMGVLIQVLCSYVTLPLYALVTQMGTNMKPVIFSDQVASALRGWHQTA  424

Query  384  rqrarrgqRSENSTPFTSRPATPLHG-MSPVHLLSDFQHNAADSLQASPRGPASDDQVWA  208
            +++ R+G+RS ++TPF+SRPA+PLHG  SPV+LL   +   +D+  ASPR     ++ W 
Sbjct  425  KKQLRQGRRSASTTPFSSRPASPLHGSTSPVYLLRGHK-EYSDNNVASPRASNFSNEGWG  483

Query  207  NSA  199
               
Sbjct  484  GEG  486



>ref|XP_006343449.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=589

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 146/212 (69%), Gaps = 7/212 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  337  RIHERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +  DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MK  IF + VA+A+K WH  A
Sbjct  397  YHDHTEDIVIRITMGVLIQILCSYVTLPLYALVTQMGSNMKSTIFNERVATALKNWHHTA  456

Query  384  rqrarrgqRSENS-TPFTSRPATP-LHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            ++  +   +  N  TP +SRP TP  HGMSPVHLL     +   SLQ SPR    D   W
Sbjct  457  KKHVKDQSKHSNPVTPMSSRPGTPSHHGMSPVHLLRGHYRSDMGSLQNSPRRSNYDVDHW  516

Query  210  ANSAAATSASPRR--NLSSNDDQHEIQIVSND  121
             N     S SP R    +++   H+IQ+   D
Sbjct  517  DNEG---SPSPSRFYQEAADGSLHQIQLGQLD  545



>ref|XP_009335054.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=597

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 154/218 (71%), Gaps = 4/218 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE G+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  341  RIQESGEVVKGLPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMG++IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  401  FHEHTEDVIIRVSMGILIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRPATP H  SP +LL +++ +  DS  ASPR    + + WAN
Sbjct  461  RKHIKQNKGS--VTPMSSRPATPSHHTSPAYLLRNYR-SEVDSFHASPRRSNFEGERWAN  517

Query  204  SAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN-NKHN  94
             + + S     + +S+   H I++   D   V+ N+ N
Sbjct  518  ESPSPSHHLHVDGTSSSYHHHIEMGDVDRERVDVNEQN  555



>gb|KGN47314.1| hypothetical protein Csa_6G292430 [Cucumis sativus]
Length=593

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 154/249 (62%), Gaps = 41/249 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG+ SC
Sbjct  341  RIQERGEVVKGVPVVEPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  401  FHEHTEDLVIRITMGVLVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRPATP H +SPVHLL  ++ +  DS+  SPR    D   W  
Sbjct  461  RKHIKQNRGS--MTPMSSRPATPSHHLSPVHLLRHYR-SELDSVHTSPRRSNFDTDQWDP  517

Query  204  SAA----------------------------------ATSASPRRNLSS----NDDQHEI  139
             +                                     S  P R   S    N + HEI
Sbjct  518  DSPSPSPSHHFHRRPHPGDGSISNHHRDVEAGDLDVDVESPQPDRTTQSINPTNIEHHEI  577

Query  138  QIVSNDFSF  112
             + SN+FSF
Sbjct  578  DVGSNEFSF  586



>gb|EYU18859.1| hypothetical protein MIMGU_mgv1a003503mg [Erythranthe guttata]
Length=581

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 156/241 (65%), Gaps = 31/241 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  335  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR+SMGVIIQILCSYVTLPLYALVTQMGSSMKP IF + VA+A+K WH  A
Sbjct  395  FHEKVEDIIIRISMGVIIQILCSYVTLPLYALVTQMGSSMKPTIFNERVAAALKNWHHTA  454

Query  384  rqrarrgqRSENS---TPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQV  214
            ++  ++ +  ++S   TP +SRPATP  GMSPVHLL   + +  ++ ++  + P  D  V
Sbjct  455  KKHIKQAKHHQHSGPTTPMSSRPATPSTGMSPVHLLRHHR-SETETFESPTKSPNHDIDV  513

Query  213  --W--------------------ANSAAATSASPRRNLSSNDDQHEIQI-----VSNDFS  115
              W                    A        +  R++++  +QHEI +     +  DFS
Sbjct  514  DRWITVGPPPPNNHIELGLLERVAEELHRHEITDSRHVAAPREQHEIDVDGGLMMPKDFS  573

Query  114  F  112
            F
Sbjct  574  F  574



>ref|XP_004163384.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
Length=593

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 154/249 (62%), Gaps = 41/249 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG+ SC
Sbjct  341  RIQERGEVVKGVPVVEPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWKEFGMKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV++QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  401  FHEHTEDLVIRITMGVLVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++ + S   TP +SRPATP H +SPVHLL  ++ +  DS+  SPR    D   W  
Sbjct  461  RKHIKQNRGS--MTPMSSRPATPSHHLSPVHLLRHYR-SELDSVHTSPRRSNFDTDQWDP  517

Query  204  SAA----------------------------------ATSASPRRNLSS----NDDQHEI  139
             +                                     S  P R   S    N + HEI
Sbjct  518  DSPSPSPSHHFHRRPHPGDGSISNHHRDVEAGDLDVDVESPQPDRTTQSINPTNIEHHEI  577

Query  138  QIVSNDFSF  112
             + SN+FSF
Sbjct  578  DVGSNEFSF  586



>gb|KHN17123.1| MLO-like protein 6 [Glycine soja]
Length=563

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 152/249 (61%), Gaps = 33/249 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVK--FGLF  571
            +IQ+RG+V+KGAP+VEPGD LFWFNRP L+LF I  VLFQNAFQ+AFF WS     F + 
Sbjct  310  KIQDRGEVVKGAPLVEPGDELFWFNRPRLILFLIHLVLFQNAFQLAFFAWSTYDNGFKIN  369

Query  570  SCFHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHr  391
            SCFH+  ADI IRL+MGV+ Q+LCSYVTLPLYALVTQMGS+MKP IF +NVA A+K WH 
Sbjct  370  SCFHKTTADIVIRLTMGVLTQVLCSYVTLPLYALVTQMGSTMKPTIFNENVAVALKNWHH  429

Query  390  aarqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
             A++  +  + S ++TPF+SRP TP HGMSPVHLL     + +DS   SPR    +++ W
Sbjct  430  TAKKHIKHNKDSTSNTPFSSRPGTPTHGMSPVHLLHKHPRH-SDSPVVSPRAYNYENEQW  488

Query  210  ANSA------------------------------AATSASPRRNLSSNDDQHEIQIVSND  121
                                              A T+  P   L+    QHEI I  ++
Sbjct  489  GVEGIHSPSHHARDHDPDHEKTMQMQMQMQQQRPAPTAELPPSGLNPIRTQHEINIALSE  548

Query  120  FSFVNNKHN  94
            FSF    H 
Sbjct  549  FSFGRGHHT  557



>ref|XP_006340147.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=587

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 141/193 (73%), Gaps = 8/193 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+LF I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  336  RIQERGEVVKGVPVVQPGDDLFWFNRPRLLLFLINFVLFQNAFQLAFFAWTWYEFGLKSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH +A
Sbjct  396  FHDHTEDIVIRMTMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRKWHHSA  455

Query  384  rqrarr--gqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            ++  +    Q S  +TP +SRPATP HGMSPVHLL   + +  D    SPR  + +   W
Sbjct  456  KKHIKEINKQHSNPTTPMSSRPATPSHGMSPVHLLRGIRTSDMD---VSPRRSSYNVDHW  512

Query  210  ANSAAATSASPRR  172
                   S SP R
Sbjct  513  DIEG---SPSPTR  522



>ref|XP_010313404.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Solanum lycopersicum]
Length=561

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 153/225 (68%), Gaps = 20/225 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+LF I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  336  RIQERGEVVKGVPVVQPGDDLFWFNRPRLLLFLINFVLFQNAFQLAFFAWTWYEFGLKSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH +A
Sbjct  396  FHDQTEDIVIRMTMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAMALRKWHHSA  455

Query  384  rqrarr--gqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD-QV  214
            ++  +    Q S  +TP +SRP TP HGMSPVHLL   + +  D     PR  + ++   
Sbjct  456  KKHIKEINKQHSNPTTPMSSRPPTPSHGMSPVHLLRGIRTSDMD---VGPRRSSYNNIDH  512

Query  213  WANSAAATSASPRR--------NLSSND--DQHEIQIV-SNDFSF  112
            W       S SP R        NLS  +  +Q+EI I  S DFSF
Sbjct  513  WDIEG---SPSPNRHDSEVHEPNLSEIEAREQYEINIARSRDFSF  554



>ref|XP_003555433.1| PREDICTED: MLO-like protein 12-like isoform X1 [Glycine max]
Length=559

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 150/244 (61%), Gaps = 28/244 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVK--FGLF  571
            RIQ+RG+V+KGAPVVEPGD LFWFNRP  +LF I  VLFQNAFQ+AFF WS     F + 
Sbjct  313  RIQDRGEVVKGAPVVEPGDGLFWFNRPRFILFLIHLVLFQNAFQLAFFAWSTFDNGFKIN  372

Query  570  SCFHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHr  391
            SCFHR  ADI IRL+MGV+ Q+LCSYVTLPLYALVTQMGS+MKP IF +NVA+A+  WH 
Sbjct  373  SCFHRTTADIVIRLTMGVLTQVLCSYVTLPLYALVTQMGSTMKPTIFNENVATALMNWHH  432

Query  390  aarqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            +AR   +  + S ++TPF+SRP TP HGMSPVHLL     + +DS   SP     +++ W
Sbjct  433  SARNHIKHNKGSTSNTPFSSRPGTPTHGMSPVHLLHKHPRH-SDSPIVSPMAYNYENEQW  491

Query  210  A-------------------------NSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
                                         A T+  P   L+    QHEI I  ++FSF  
Sbjct  492  GVEGIHSPNHHARDHDHDHGETMQMQQPTAPTADLPPSGLNPIRTQHEINIALSEFSFGR  551

Query  105  NKHN  94
              H 
Sbjct  552  GHHT  555



>ref|XP_004240581.1| PREDICTED: MLO-like protein 6 [Solanum lycopersicum]
Length=591

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 143/212 (67%), Gaps = 7/212 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  339  RIHERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGLKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +  DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MK  IF + VA+A+K WH  A
Sbjct  399  YHDHTEDIVIRITMGVLIQILCSYVTLPLYALVTQMGSNMKSTIFNERVATALKNWHHTA  458

Query  384  rqrarrgqRSEN-STPFTSRPATP-LHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            ++  +   +  N  TP +SRP TP  HGMSPVHLL     +   SLQ SPR    D   W
Sbjct  459  KKHVKDQSKHSNPVTPMSSRPGTPSHHGMSPVHLLRGHYRSDMGSLQNSPRRSNYDFDHW  518

Query  210  ANSAAATSASPRRNLSSNDDQ--HEIQIVSND  121
             N     S SP R      D   H IQ+   D
Sbjct  519  DNEG---SPSPSRFYQEAVDGSLHHIQLGQLD  547



>emb|CDP06724.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V++G P+V+P D+LFWFNRP ++L+ I FVLFQNAFQ+A F WSW ++G  SC
Sbjct  336  RIQERGEVVQGTPLVQPADDLFWFNRPRVLLYLIHFVLFQNAFQLALFVWSWYEYGFQSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N  D+AI +SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF  NVA A+ TWH+ A
Sbjct  396  FHENTKDVAIGISMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNKNVAKALHTWHQTA  455

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  ++   S++  P +S+P+TPL G SPVHLL  ++ N  DS++ S R  + + Q W  
Sbjct  456  RKHIKQKCHSDSVGPVSSQPSTPLQGTSPVHLLHYYK-NEIDSVETSSRISSYNTQPWEK  514

Query  204  SAAATSASPRRNLSSND  154
                   SP+ +   ND
Sbjct  515  ------GSPQLSCLQND  525



>ref|XP_010104115.1| MLO-like protein 6 [Morus notabilis]
 gb|EXB98556.1| MLO-like protein 6 [Morus notabilis]
Length=585

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 153/211 (73%), Gaps = 6/211 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG+ SC
Sbjct  341  RIQERGEVVKGVPVVQPGDHLFWFNRPRLILYLINFVLFQNAFQLAFFAWTWYEFGIRSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV+IQ LCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH   
Sbjct  401  FHEHTEDLVIRITMGVLIQFLCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWH-HT  459

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  +  R+ + TP +SR ATP H  SP+HLL +++ +  DSLQ SPR    D + W +
Sbjct  460  AKKHVKQSRTGSVTPLSSRSATPSHHTSPIHLLRNYR-SEMDSLQNSPRRTYLDAERW-D  517

Query  204  SAAATSASPRRNL---SSNDDQHEIQIVSND  121
            + + + + P++++    S+   H I++   D
Sbjct  518  TDSPSPSHPQQHIPGDGSSSHHHHIEMGQID  548



>ref|XP_007027290.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY07792.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=564

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 142/216 (66%), Gaps = 6/216 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ RG+V+KG PVV+PG++ FWFNRP L+L+ I FVLFQNAFQ+AF  W+  +F L SC
Sbjct  344  RIQARGEVVKGTPVVQPGNDHFWFNRPHLLLYLIHFVLFQNAFQLAFLVWTLYEFSLKSC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR SMG++IQILCSYVTLPLYALVTQMGS+MKP IF + +A+A++ WH+ A
Sbjct  404  FHEKRGDIIIRTSMGMLIQILCSYVTLPLYALVTQMGSTMKPTIFNERIANALRNWHQEA  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWA-  208
            ++     Q S   TPF+SR  TP  G++P+HLL +     ADS Q SPRG    ++ W  
Sbjct  464  KKHIEHNQHSGTMTPFSSRSDTPSRGVTPLHLLHN-HRGEADSSQTSPRGSNFGNEGWEI  522

Query  207  ----NSAAATSASPRRNLSSNDDQHEIQIVSNDFSF  112
                    A       N   N  QHEI+I   DFSF
Sbjct  523  EGPDRGQVAEQKHKATNKVDNPSQHEIEIEPYDFSF  558



>gb|AGV68800.1| MLO3 [Prunus armeniaca]
Length=574

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 152/242 (63%), Gaps = 33/242 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +++ERG+V+KG P+VEPGD+LFWFN P L+L  I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  337  KLKERGEVVKGTPLVEPGDHLFWFNNPRLILHLIHFVLFQNAFQLAFFAWTWYEFGLKSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGVIIQILCSYVTLPLYALVTQMGS+MKP IF D VA+AIK WH   
Sbjct  397  FHEKLEDVILRVSMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIKKWH---  453

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ--HNA-------------ADSLQ  250
               + +     N    TS P TPLH MSPVHLL  +Q  H+              AD   
Sbjct  454  --LSAKKHLKHNKNSPTSVPGTPLHSMSPVHLLRHYQSEHDVDSVHTLQRMSYFDADGPN  511

Query  249  ASPRGPASDDQVWANSA---------AATSASPRRNLSS---NDDQHEIQIVSNDFSFVN  106
            +SP  P  DD  W+N           +A  ++   NL +   +  QHEIQI S +F+F  
Sbjct  512  SSP-SPHQDDLSWSNQGRSHGQEEEISAHESNAVNNLIAGYGSRSQHEIQIHSAEFTFEK  570

Query  105  NK  100
            ++
Sbjct  571  SE  572



>ref|XP_002282216.1| PREDICTED: MLO-like protein 6 [Vitis vinifera]
Length=587

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+ GD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG  SC
Sbjct  339  RIQERGEVVKGVPVVQLGDDLFWFNRPRLVLYLIHFVLFQNAFQLAFFAWTWYEFGFKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F+ +  D+ IR+SMGVIIQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  399  FYAHTEDVVIRISMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFHERVATALRNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  + S  +TP +SRP TP  G SP +LL  ++ +  DSLQASPR    D + W  
Sbjct  459  KKNIKHNKHSGLATPMSSRPTTPSRGTSPAYLLRYYRSD-MDSLQASPRRSNLDMEHWET  517

Query  204  SAAATSASPRRNLSSNDDQHEIQ  136
              + + + P     S+   +++ 
Sbjct  518  DGSPSPSHPHHGDGSSSHHNQLH  540



>ref|XP_008243901.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=579

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 152/242 (63%), Gaps = 33/242 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +++ERG+V+KG P+VEPGD+LFWFN P L+L  I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  337  KLKERGEVVKGTPLVEPGDHLFWFNNPRLILHLIHFVLFQNAFQLAFFAWTWYEFGLKSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGVIIQILCSYVTLPLYALVTQMGS+MKP IF D VA+AIK WH   
Sbjct  397  FHEKLEDVILRVSMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVANAIKKWH---  453

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ--HNA-------------ADSLQ  250
               + +     N    TS P TPLH MSPVHLL  +Q  H+              AD   
Sbjct  454  --LSAKKHLKHNKNSPTSVPGTPLHSMSPVHLLRHYQSEHDVDSVHTLQRMSYFDADGPN  511

Query  249  ASPRGPASDDQVWANSA---------AATSASPRRNLSS---NDDQHEIQIVSNDFSFVN  106
            +SP  P  DD  W+N           +A  ++   NL +   +  QHEIQI S +F+F  
Sbjct  512  SSP-SPHQDDLSWSNQGRSHGQEEEISAHESNAVNNLIAGYGSRSQHEIQIHSAEFTFEK  570

Query  105  NK  100
            ++
Sbjct  571  SE  572



>ref|NP_001268008.1| MLO7 protein [Vitis vinifera]
 gb|ACF25914.1| MLO-like protein 17 [Vitis vinifera]
Length=539

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 147/201 (73%), Gaps = 10/201 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVVEP ++LFWFNRP L+LF I FVLF NAFQ+AFF WS  +FGL SC
Sbjct  303  RIAERGDVVKGTPVVEPANDLFWFNRPHLILFLINFVLFLNAFQLAFFAWSTYEFGLQSC  362

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H+   DIAIR+SMGVI Q+LCSYVTLPLYALVTQMGS+M+P IF + VA+A+++WH+AA
Sbjct  363  YHQKTEDIAIRISMGVITQVLCSYVTLPLYALVTQMGSTMRPTIFNERVATALRSWHQAA  422

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  + G+ S   +P +SRPATP +GMSPVHLL  + ++  D    SPR    D++ +  
Sbjct  423  RKHTKHGRHSNGVSPQSSRPATPSYGMSPVHLLQGYHNHTPD---MSPRRSNLDNEWYGE  479

Query  204  SAAATSASPRRNLSSNDDQHE  142
             A     SP +    +DD+HE
Sbjct  480  GA----GSPGKK---DDDEHE  493



>emb|CBI31482.3| unnamed protein product [Vitis vinifera]
Length=539

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 147/201 (73%), Gaps = 10/201 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVVEP ++LFWFNRP L+LF I FVLF NAFQ+AFF WS  +FGL SC
Sbjct  303  RIAERGDVVKGTPVVEPANDLFWFNRPHLILFLINFVLFLNAFQLAFFAWSTYEFGLQSC  362

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H+   DIAIR+SMGVI Q+LCSYVTLPLYALVTQMGS+M+P IF + VA+A+++WH+AA
Sbjct  363  YHQKTEDIAIRISMGVITQVLCSYVTLPLYALVTQMGSTMRPTIFNERVATALRSWHQAA  422

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  + G+ S   +P +SRPATP +GMSPVHLL  + ++  D    SPR    D++ +  
Sbjct  423  RKHTKHGRHSNGVSPQSSRPATPSYGMSPVHLLQGYHNHTPD---MSPRRSNLDNEWYGE  479

Query  204  SAAATSASPRRNLSSNDDQHE  142
             A     SP +    +DD+HE
Sbjct  480  GA----GSPGKK---DDDEHE  493



>ref|XP_009777573.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=608

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 138/192 (72%), Gaps = 6/192 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  340  RIQERGEVVKGVPVVQPGDDLFWFNRPRLLLYLINFVLFQNAFQLAFFAWTWYEFGLKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR++MGV+IQILCSYVTLPLYALVTQMGSSMK  IF + VA+A+K WH  A
Sbjct  400  FHDHTEDIVIRMTMGVLIQILCSYVTLPLYALVTQMGSSMKSTIFNERVATALKNWHHTA  459

Query  384  rqrarrgqRSENS-TPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWA  208
            ++  +   +  N+ TP +SRP TP HGMSPVHLL    ++    +  SPR    +   W 
Sbjct  460  KKHVKEINKHSNTVTPMSSRPTTPSHGMSPVHLLRG--NHWRSEMDDSPRRSNYNVDHWD  517

Query  207  NSAAATSASPRR  172
            N     S SP R
Sbjct  518  NEG---SPSPTR  526



>ref|XP_006850616.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
 gb|ERN12197.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
Length=600

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 159/255 (62%), Gaps = 41/255 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+RGDV+KG PVV+P D LFWFN+P L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  346  KIQDRGDVVKGVPVVQPTDKLFWFNQPRLILYLIHFVLFQNAFQLAFFTWTWYEFGLRSC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH++  D+ IR+SMGV+IQ LCSYVTLPLYALVTQMGS+MK  +F D VA+A++ WH  A
Sbjct  406  FHKHLEDVIIRISMGVLIQFLCSYVTLPLYALVTQMGSNMKTTVFDDRVAAALRKWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLH------GMSPVHLLSDFQHNAADSLQASPRGPASD  223
            ++  + G++S + TPF+SRP TPLH      G+SPVHLL  ++ +  DS   SPR   SD
Sbjct  466  KKHIKEGRKSASVTPFSSRPGTPLHPSAGGEGLSPVHLLRHYK-SELDSSHVSPRYYNSD  524

Query  222  DQVWANSAAAT--------------------SASPRRNLSSNDD--------------QH  145
            D   + S + T                    + SP R L +  D               H
Sbjct  525  DADGSLSPSPTHHRISDADGSSSHHYRSYHGNPSPERELQTMPDGEREGTAAAHEAPPHH  584

Query  144  EIQIVSNDFSFVNNK  100
            EI +  +DFSF   +
Sbjct  585  EITMPHHDFSFSKGR  599



>ref|XP_010318227.1| PREDICTED: MLO-like protein 2 isoform X2 [Solanum lycopersicum]
Length=445

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 148/215 (69%), Gaps = 12/215 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI+ERGD++KG P+VEPGD+LFWFNRP L+ FFI FVLFQNA+Q+AFF WSW KF L SC
Sbjct  240  RIKERGDIVKGTPLVEPGDDLFWFNRPDLLHFFIHFVLFQNAYQLAFFAWSWWKFNLPSC  299

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+N  DIAI LSMG +IQ+LCSYVTLPLYALVTQMGS+MKPVIFGDNVA AI+TWH+ A
Sbjct  300  FHKNVTDIAITLSMGALIQVLCSYVTLPLYALVTQMGSTMKPVIFGDNVAYAIRTWHQTA  359

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +QRA+ G+ S+N++P  SR  +PL G S     S  Q         SP  P+        
Sbjct  360  KQRAKDGRPSKNASPVRSRAVSPLRGGS-----SPVQQKHGQLYPPSP-NPSR-----RR  408

Query  204  SAAATSASPRRNL-SSNDDQHEIQIVSNDFSFVNN  103
            S     +S R+     + +Q EI+I  ND S  N 
Sbjct  409  SGGNPESSSRQIFDDGSHEQSEIEITLNDLSLENK  443



>ref|XP_004515994.1| PREDICTED: MLO-like protein 2-like [Cicer arietinum]
Length=559

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 155/220 (70%), Gaps = 13/220 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+ G+++KGAP+VEPGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  336  RIQDSGEIIKGAPLVEPGDHLFWFNRPDLLLFLIHLVLFQNAFQLAFFSWSTYEFSVNSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+  A+I IRL++GV+IQILCSY TLPLYALVTQMGS+MKP IF + VA+A+K+WH  A
Sbjct  396  FHKTTAEIIIRLTLGVVIQILCSYSTLPLYALVTQMGSTMKPTIFHERVATALKSWHNTA  455

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  + S N+TPF+SRP+TP HGMSPVHLL     +++DSLQ S      ++Q W N
Sbjct  456  KKHVKESKHSNNTTPFSSRPSTPTHGMSPVHLLHRHTVSSSDSLQTS----NYENQQWDN  511

Query  204  SAAATSASPRRNLSSN---------DDQHEIQIVSNDFSF  112
               + S +     +            ++HEI I S DFSF
Sbjct  512  VEGSNSPTINHTEAHEIRIPTELPVSNRHEISISSKDFSF  551



>gb|KHN00832.1| MLO-like protein 6 [Glycine soja]
Length=563

 Score =   222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 150/248 (60%), Gaps = 32/248 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVK--FGLF  571
            RIQ+RG+V+KGAPVVEPGD LFWFNRP  +LF I  VLFQNAFQ+AFF WS     F + 
Sbjct  313  RIQDRGEVVKGAPVVEPGDGLFWFNRPRFILFLIHLVLFQNAFQLAFFAWSTFDNGFKIN  372

Query  570  SCFHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHr  391
            SCFHR  ADI IRL+MGV+ Q+LCSYVTLPLYALVTQMGS+MKP IF +NVA+A+  WH 
Sbjct  373  SCFHRTTADIVIRLTMGVLTQVLCSYVTLPLYALVTQMGSTMKPTIFNENVATALMNWHH  432

Query  390  aarqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            +AR   +  + S ++TPF+SRP TP HGMSPVHLL     + +DS   SP     +++ W
Sbjct  433  SARNHIKHNKGSTSNTPFSSRPGTPTHGMSPVHLLHKHPRH-SDSPIVSPMAYNYENEQW  491

Query  210  A-----------------------------NSAAATSASPRRNLSSNDDQHEIQIVSNDF  118
                                             A T+  P   L+    QHEI I  ++F
Sbjct  492  GVEGIHSPNHHARDHDHDHDHDHGETMQMQQPTAPTADLPPSGLNPIRTQHEINIALSEF  551

Query  117  SFVNNKHN  94
            SF    H 
Sbjct  552  SFGRGHHT  559



>ref|XP_002312021.2| MLO-like protein 12 [Populus trichocarpa]
 gb|EEE89388.2| MLO-like protein 12 [Populus trichocarpa]
Length=578

 Score =   223 bits (567),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 144/202 (71%), Gaps = 5/202 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAPVV+PGD+LFWF RP  +LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  336  RIQERGDVVKGAPVVQPGDDLFWFGRPRFLLFLIHLVLFQNAFQIAFFIWSVYEFSIKSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H     I IR+++GVIIQI+CSYVTLPLYALVTQMGSSM+P +F D VA+A+KTWH  A
Sbjct  396  YHARTEAIVIRITLGVIIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKTWHHTA  455

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPRGPASDDQVWA  208
            +++++ G+ SE+ TP +SRP TP HGMSPVHLL + + + A +S   SPR    D+    
Sbjct  456  KKQSKHGKNSESHTPMSSRPQTPSHGMSPVHLLRNHRSSTAPNSFPNSPRLSNHDN----  511

Query  207  NSAAATSASPRRNLSSNDDQHE  142
            N    T A+   +   N+  H 
Sbjct  512  NDQWDTEANSVHDYELNESVHH  533



>ref|XP_006424615.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 ref|XP_006424616.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 ref|XP_006488132.1| PREDICTED: MLO-like protein 6-like isoform X1 [Citrus sinensis]
 gb|ESR37855.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 gb|ESR37856.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
Length=576

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 157/230 (68%), Gaps = 22/230 (10%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+VLKG PVV+ GD+LFWF++P L+L+ I FVLFQNAFQ+AFF WSW +FG+ SC
Sbjct  344  RIQERGEVLKGVPVVQLGDDLFWFSQPRLILYLINFVLFQNAFQLAFFAWSWFEFGIESC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A+K WH  A
Sbjct  404  FHEHTEDIVIRITMGVLIQILCSYVTLPLYALVTQMGSNMKPTIFNERVAAALKNWHHTA  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPA-----SDD  220
            ++  ++ + S   TP +SRP+TP + MSPVHLL  ++    DS+Q SPR        S+ 
Sbjct  464  KKHIKQNKGS--VTPLSSRPSTPSYNMSPVHLLRHYR-GEMDSVQTSPRRSMEQYLDSES  520

Query  219  QVWANSAAATSASPRR---------NLSSND----DQHEIQIV-SNDFSF  112
               +++     +SP           N  +ND     QHEI IV + +FSF
Sbjct  521  PSPSHTFHGEGSSPHHIEQGFYIEYNKGANDPGPSQQHEIDIVTTKEFSF  570



>gb|AAL06900.1| At1g11310/T28P6_23 [Arabidopsis thaliana]
Length=311

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  82   RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNC  141

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IRL +G ++QILCSYVTLPLYALVTQMGS MKP +F D VA+A+K WH  A
Sbjct  142  FHESTADVVIRLVVGAVVQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHHTA  201

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP  241
            +   + G+ S ++TPF+SRP TP HG SP+HLL +F + + ++  +SP
Sbjct  202  KNETKHGRHSGSNTPFSSRPTTPTHGSSPIHLLHNFNNRSVENYPSSP  249



>ref|XP_004309423.1| PREDICTED: MLO-like protein 6 [Fragaria vesca subsp. vesca]
Length=590

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 151/221 (68%), Gaps = 13/221 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  339  RIQERGEVVKGTPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  399  FHEHIEDIIIRVSMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRKWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ + S   TP +SRP TP H  SP+HLL  ++ +  DS   SPR    D +    
Sbjct  459  KKHIKQNKGS--VTPMSSRPGTPSHHASPIHLLRHYR-SEVDSFHTSPRRSNFDVE---Q  512

Query  204  SAAATSASPRRNLS-----SNDDQHEIQI--VSNDFSFVNN  103
                 S SP  +L      S+  QH++++  V +D   VN 
Sbjct  513  RYETDSPSPSHHLHIDGSFSHQHQHQVELGNVEHDRMEVNE  553



>emb|CBI16290.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+ GD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FG  SC
Sbjct  339  RIQERGEVVKGVPVVQLGDDLFWFNRPRLVLYLIHFVLFQNAFQLAFFAWTWYEFGFKSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F+ +  D+ IR+SMGVIIQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  399  FYAHTEDVVIRISMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFHERVATALRNWHHTA  458

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  + S  +TP +SRP TP  G SP +LL  ++ +  DSLQASPR    D + W  
Sbjct  459  KKNIKHNKHSGLATPMSSRPTTPSRGTSPAYLLRYYRSD-MDSLQASPRRSNLDMEHWET  517

Query  204  SAAATSASPRRNLSSNDDQHEIQ  136
              + + + P     S+   +++ 
Sbjct  518  DGSPSPSHPHHGDGSSSHHNQLH  540



>gb|AAX31277.1| MLO1 [Capsicum annuum]
Length=587

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+W +FGL SC
Sbjct  336  RIQERGEVVKGVPVVQPGDDLFWFNRPRLLLYLINFVLFQNAFQLAFFAWTWYEFGLKSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH--r  391
            FH    DI IR++MGV+IQILCSYVTLPLYALVTQMGSSMKP IF + VA+A++ WH   
Sbjct  396  FHDKTEDIVIRMTMGVLIQILCSYVTLPLYALVTQMGSSMKPTIFNERVATALRKWHHGA  455

Query  390  aarqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD  259
                +      S  +TP +SRP TP HGMSPVHLL   + +  D
Sbjct  456  KKHIKEINKHHSNPATPMSSRPTTPTHGMSPVHLLRGIRTSDMD  499



>ref|XP_002526372.1| Protein MLO, putative [Ricinus communis]
 gb|EEF36043.1| Protein MLO, putative [Ricinus communis]
Length=594

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 159/222 (72%), Gaps = 10/222 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +FGL SC
Sbjct  340  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWKEFGLKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH ++ DI IR+SMGV+IQILCSYVTLPLYALVTQMGSSMKP IF + VA+A++ WH  A
Sbjct  400  FHEHSEDIIIRISMGVLIQILCSYVTLPLYALVTQMGSSMKPTIFNERVAAALRNWHHTA  459

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRG-----PASDD  220
            ++  ++ + S   TP +SRPATP H MSPVHLL  ++ +  DS + S  G     P+   
Sbjct  460  KKHIKQNKGS--VTPMSSRPATPSHHMSPVHLLRHYR-SEMDSPRRSNFGWETDSPSPSH  516

Query  219  QVWANSAAATSASPRRNLSS--NDDQHEIQIVSNDFSFVNNK  100
             V+ + +++ + +     SS  + +Q +I++   D+   +N+
Sbjct  517  PVYGDGSSSHNPNHGDGSSSFRHQNQQQIELGYVDYDKDDNE  558



>ref|XP_011040971.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=581

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGA VV PGD+LFWF RP  +LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  336  RIQERGDVVKGALVVIPGDDLFWFGRPRFLLFLIHLVLFQNAFQIAFFIWSVYEFTINSC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +   I IR+++GV+IQI+CSYVTLPLYALVTQMGSSM+P +F D VA+A+K WH  A
Sbjct  396  YHAHTEAIVIRITLGVVIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTA  455

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPRGPASDD  220
            +++++ G+ SE+ TP +SRP TP HGMSPVHLL +F+ + A DS Q SPR    D+
Sbjct  456  KKQSKHGKNSESHTPMSSRPQTPAHGMSPVHLLHNFRGSTAPDSFQNSPRHSYYDN  511



>ref|XP_004235223.1| PREDICTED: MLO-like protein 2 isoform X1 [Solanum lycopersicum]
Length=517

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 148/215 (69%), Gaps = 12/215 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI+ERGD++KG P+VEPGD+LFWFNRP L+ FFI FVLFQNA+Q+AFF WSW KF L SC
Sbjct  312  RIKERGDIVKGTPLVEPGDDLFWFNRPDLLHFFIHFVLFQNAYQLAFFAWSWWKFNLPSC  371

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+N  DIAI LSMG +IQ+LCSYVTLPLYALVTQMGS+MKPVIFGDNVA AI+TWH+ A
Sbjct  372  FHKNVTDIAITLSMGALIQVLCSYVTLPLYALVTQMGSTMKPVIFGDNVAYAIRTWHQTA  431

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +QRA+ G+ S+N++P  SR  +PL G S     S  Q         SP  P+        
Sbjct  432  KQRAKDGRPSKNASPVRSRAVSPLRGGS-----SPVQQKHGQLYPPSP-NPSR-----RR  480

Query  204  SAAATSASPRRNL-SSNDDQHEIQIVSNDFSFVNN  103
            S     +S R+     + +Q EI+I  ND S  N 
Sbjct  481  SGGNPESSSRQIFDDGSHEQSEIEITLNDLSLENK  515



>ref|XP_006307103.1| hypothetical protein CARUB_v10008691mg [Capsella rubella]
 gb|EOA40001.1| hypothetical protein CARUB_v10008691mg [Capsella rubella]
Length=578

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 135/184 (73%), Gaps = 6/184 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  346  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLRNC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+++GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  406  FHESNADVVIRIAVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP------RGPASD  223
            + + + G+ SE++TPF+SRP TP HG SP+HLL +F +   DS   SP       G   +
Sbjct  466  KSQTKHGRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRNVDSYPTSPSPRYSGHGHHDE  525

Query  222  DQVW  211
             Q W
Sbjct  526  HQFW  529



>gb|AFW98801.1| MLO protein 1 [Rosa multiflora]
Length=592

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 152/249 (61%), Gaps = 41/249 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WSW +F L SC
Sbjct  340  RIQERGEVVKGTPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFAWSWYEFSLKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  400  FHEHTEDIIIRVSMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTA  459

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR-----------  238
            ++  ++ + S   TP +SRP TP H  SP+HLL  ++ +  DS   SPR           
Sbjct  460  KKHIKQNKGS--VTPMSSRPGTPSHHASPIHLLRHYR-SEVDSFHTSPRRSNFEVEQRYE  516

Query  237  ------------------------GPASDDQVWANSAAATSASPR--RNLSSNDDQHEIQ  136
                                    G    D+V AN   +  A+P   R   S   QHEI 
Sbjct  517  TDSPSPSHHLHIDGSFSHQHQVEVGNMEHDRVDANEPNSVHAAPASVRGSQSTPAQHEIN  576

Query  135  IV-SNDFSF  112
            I    DFSF
Sbjct  577  IGPPKDFSF  585



>dbj|BAJ34622.1| unnamed protein product [Thellungiella halophila]
Length=516

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  275  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  334

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MG++IQ+LCSY+TLPLYALVTQMG+SM+P IF D VASA+K WH  A
Sbjct  335  FHHKTEDIAIRITMGLLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVASALKKWHHTA  394

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + GQ   N TP +SRPATP HGMSPVHLL ++ +   D   S  ASP  P   D
Sbjct  395  KKQTKHGQSGSN-TPHSSRPATPTHGMSPVHLLHNYHNRGMDHQTSFTASPSPPRFSD  451



>ref|XP_010505587.1| PREDICTED: MLO-like protein 12 isoform X2 [Camelina sativa]
Length=576

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR+SMGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHRTEDIAIRISMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++ H + D   S  ASP  P   D
Sbjct  455  KKQTKHGHSGSN-TPQSSRPTTPTHGMSPVHLLHNYNHRSIDQQTSFTASPSPPRFSD  511



>ref|XP_010505586.1| PREDICTED: MLO-like protein 12 isoform X1 [Camelina sativa]
Length=576

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR+SMGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHRTEDIAIRISMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++ H + D   S  ASP  P   D
Sbjct  455  KKQTKHGHSGSN-TPQSSRPTTPTHGMSPVHLLHNYNHRSIDQQTSFTASPSPPRFSD  511



>gb|KJB09233.1| hypothetical protein B456_001G130800 [Gossypium raimondii]
Length=584

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 155/221 (70%), Gaps = 12/221 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVEPGD+LFWF+RP L+L+ I FVLFQNAFQ+AFF  +W +FG  SC
Sbjct  340  RIQERGEVVKGVPVVEPGDDLFWFDRPRLILYLINFVLFQNAFQLAFFACTWYEFGSKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+SMG+++QILCSYVTLPLYALVTQMG++MKP IF + VA+A++ WH  A
Sbjct  400  FHEHVEDVVIRISMGILVQILCSYVTLPLYALVTQMGTNMKPTIFNERVATALRNWHHTA  459

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  + S   TPF+SRP TP H  SPVHLL +++ +  DSL  SPR    D ++ ++
Sbjct  460  KKHIKHNKGS--VTPFSSRPNTPSHHTSPVHLLRNYR-SEVDSLHTSPRRSNFDIEL-SD  515

Query  204  SAAATSASPRRNLSSN--------DDQHEIQIVSNDFSFVN  106
            + + + + P     S+        +DQ ++  + ND + +N
Sbjct  516  TDSLSPSPPNHTEGSSTSHHHVNMEDQVQVDYIDNDINELN  556



>dbj|BAF00789.1| membrane protein Mlo12 [Arabidopsis thaliana]
Length=516

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  275  RIQEKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  334

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  335  FHHKTEDIAIRITMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  394

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++ + + D   S  ASP  P   D
Sbjct  395  KKQTKHGHSGSN-TPHSSRPTTPTHGMSPVHLLHNYNNRSLDQQTSFTASPSPPRFSD  451



>ref|XP_003538050.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=576

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 158/226 (70%), Gaps = 16/226 (7%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+VLKG P+V+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WS ++FG+ SC
Sbjct  341  RIQQRGEVLKGVPLVQPGDHLFWFNRPGLILYLINFVLFQNAFQLAFFAWSALQFGIKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF D VA A++ WH+ A
Sbjct  401  FHSHTEDVVIRITMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAVALRNWHQTA  460

Query  384  rqrarrgqR---SENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQV  214
            ++  R+ +    S + TP +SRP TP H +SPVHLL  ++ +  DS  ASPR    DD  
Sbjct  461  KKHIRQNRVGPLSLSGTPTSSRPTTPSHHLSPVHLLRYYR-SEIDSFPASPRRSNFDDNN  519

Query  213  WANSAAATS-------ASPRRNLSSNDD----QHEIQIV-SNDFSF  112
              + + + S        +   N S+ND+     HEI +V S +FSF
Sbjct  520  MDSPSPSYSLHQLPPQTTATTNDSANDNNATTHHEIVVVHSKEFSF  565



>ref|XP_010509062.1| PREDICTED: MLO-like protein 12 [Camelina sativa]
Length=576

 Score =   220 bits (561),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR+SMGV+IQ+LCSY+TLPLYALVTQMG++M+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRISMGVLIQVLCSYITLPLYALVTQMGTTMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++ H + D   S  ASP  P   D
Sbjct  455  KKQTKHGHSGSN-TPQSSRPTTPTHGMSPVHLLHNYNHRSLDQQTSFTASPSPPRFSD  511



>ref|XP_002315295.2| hypothetical protein POPTR_0010s22730g [Populus trichocarpa]
 gb|EEF01466.2| hypothetical protein POPTR_0010s22730g [Populus trichocarpa]
Length=577

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 150/212 (71%), Gaps = 5/212 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGA VV PGD+LFWF RP  +LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  332  RIQERGDVVKGALVVIPGDDLFWFGRPRFLLFLIHLVLFQNAFQIAFFIWSVYEFTIKSC  391

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +   I IR+++GV+IQI+CSYVTLPLYALVTQMGSSM+P +F D VA+A+K WH  A
Sbjct  392  YHAHTEGIVIRITLGVVIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTA  451

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPRGPASDDQ-VW  211
            +++++ G+ SE+ TP +SRP TP +GMSPVHLL +F+ + A DS Q SPR    D+   W
Sbjct  452  KKQSKHGKNSESHTPMSSRPQTPAYGMSPVHLLHNFRGSTAPDSFQNSPRHSYYDNNDQW  511

Query  210  ---ANSAAATSASPRRNLSSNDDQHEIQIVSN  124
               ANS      +   +  S D + ++Q++  
Sbjct  512  DPEANSVHDHELNEPVHHGSPDVRDQVQVIET  543



>gb|AGV68801.1| MLO4 [Prunus armeniaca]
Length=571

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 144/241 (60%), Gaps = 26/241 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAP+V+PGD+LFWF  P  MLF I FVLFQNAFQ+AFF WS   FG+ SC
Sbjct  328  RIQERGDVVKGAPLVQPGDHLFWFGSPRFMLFLIHFVLFQNAFQLAFFAWSTYAFGIKSC  387

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR+SMGVIIQ LCSYVTLPLYALVTQMGS+MK  +F + V  A+K+WH  A
Sbjct  388  FHERTEDIVIRISMGVIIQFLCSYVTLPLYALVTQMGSTMKRTVFNEEVVGALKSWHNKA  447

Query  384  rqrarrgqRSENSTPFTSRPATPLHG--MSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            ++R +    S ++TPF+S P TP HG  MSPVHLL     + AD    SPR    +   W
Sbjct  448  KKRTKLSPHSHSNTPFSSTPGTPSHGLRMSPVHLLHKHNRSDADGYYVSPRASNLELSNW  507

Query  210  A----------NSAAATSASPRRNLSSN--------------DDQHEIQIVSNDFSFVNN  103
                       N+A  +     R L                   QHE+ I  ++FSF   
Sbjct  508  ETEGSSHSLNNNNAGPSDPEEIRELDQEPTSTTQLPPAPPGIRTQHEVNIGLSEFSFGKG  567

Query  102  K  100
            K
Sbjct  568  K  568



>ref|XP_006411145.1| hypothetical protein EUTSA_v10016436mg [Eutrema salsugineum]
 gb|ESQ52598.1| hypothetical protein EUTSA_v10016436mg [Eutrema salsugineum]
Length=576

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MG++IQ+LCSY+TLPLYALVTQMG+SM+P IF D VASA+K WH  A
Sbjct  395  FHHKTEDIAIRITMGLLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVASALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + GQ   N TP +SRPATP HGMSPVHLL ++ +   D   S  ASP  P   D
Sbjct  455  KKQTKHGQSGSN-TPHSSRPATPTHGMSPVHLLHNYHNRGMDHQTSFTASPSPPRFSD  511



>ref|NP_565902.1| protein MILDEW RESISTANCE LOCUS O 12 [Arabidopsis thaliana]
 sp|O80961.2|MLO12_ARATH RecName: Full=MLO-like protein 12; Short=AtMlo12; Short=AtMlo18 
[Arabidopsis thaliana]
 gb|AAK53805.1|AF369573_1 membrane protein Mlo12 [Arabidopsis thaliana]
 gb|AAC28997.2| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC09645.1| MLO-like protein [Arabidopsis thaliana]
Length=576

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQEKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRITMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++ + + D   S  ASP  P   D
Sbjct  455  KKQTKHGHSGSN-TPHSSRPTTPTHGMSPVHLLHNYNNRSLDQQTSFTASPSPPRFSD  511



>ref|XP_002892636.1| hypothetical protein ARALYDRAFT_471266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68895.1| hypothetical protein ARALYDRAFT_471266 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  342  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNC  401

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IRL +G ++QILCSYVTLPLYALVTQMGS MKP +F D VA+A+K WHR A
Sbjct  402  FHESTADVVIRLVVGAVVQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHRTA  461

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP  241
            +   + G+ SE++TPF+SRP TP HG SP+HLL +F + + +S   SP
Sbjct  462  KSETKHGRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRSVESYPNSP  509



>ref|XP_002881634.1| hypothetical protein ARALYDRAFT_903160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57893.1| hypothetical protein ARALYDRAFT_903160 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQEKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRITMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++ + + D   S  ASP  P   D
Sbjct  455  KKQTKHGHSGSN-TPHSSRPTTPTHGMSPVHLLHNYNNRSLDQQTSFTASPSPPRFSD  511



>ref|XP_010032020.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
 gb|KCW51405.1| hypothetical protein EUGRSUZ_J00942 [Eucalyptus grandis]
Length=583

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 133/169 (79%), Gaps = 3/169 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG V+KG PVVEPGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+  +FG+ SC
Sbjct  340  RIQERGQVVKGVPVVEPGDDLFWFNRPRLILYLINFVLFQNAFQLAFFVWTSYEFGIKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D  IR+SMGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH +A
Sbjct  400  FHEHTEDRIIRISMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHSA  459

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR  238
            ++  ++ + S   TP +SRPATP H MSPVHLL  ++ +  DS+  SPR
Sbjct  460  KKHIKQNKGS--VTPMSSRPATPSHHMSPVHLLRHYR-SEMDSMHTSPR  505



>ref|XP_007143692.1| hypothetical protein PHAVU_007G093600g [Phaseolus vulgaris]
 gb|ESW15686.1| hypothetical protein PHAVU_007G093600g [Phaseolus vulgaris]
Length=556

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 150/234 (64%), Gaps = 24/234 (10%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVK--FGLF  571
            +IQ+RG+V+KG PVV+PGD LFWFN P L+LF I  VLF NAFQ+AFF WS +   F + 
Sbjct  312  KIQDRGEVVKGEPVVQPGDELFWFNNPRLVLFLIHLVLFLNAFQLAFFTWSTLDNGFKIN  371

Query  570  SCFHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHr  391
            SCFHR  ADI IRL+MGV+ Q+LCSYVTLPLYALV QMGSSMKP IF DNVASA+K+WH 
Sbjct  372  SCFHRTTADIVIRLTMGVLTQVLCSYVTLPLYALVIQMGSSMKPTIFKDNVASALKSWHH  431

Query  390  aarqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            +A++  +  + S ++TPF+SRP TP  GMSPVHLL     + +DS   SPR    ++  W
Sbjct  432  SAKKHLKHNRDSTSNTPFSSRPGTPTRGMSPVHLLHKHPRH-SDSPLVSPRASDYENGQW  490

Query  210  ANSAAATSASPRRNLSSND---------------------DQHEIQIVSNDFSF  112
                + + +   R++   +                      QHEI I  ++FSF
Sbjct  491  DAEVSHSPSHHARDIDHEETMQVQPPAAAELPPAGLNPVRTQHEINIALSEFSF  544



>ref|XP_009133342.1| PREDICTED: MLO-like protein 12 isoform X1 [Brassica rapa]
Length=602

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRITMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDKVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++++ + D   S  ASP  P   D
Sbjct  455  KKQTKHGHSGSN-TPHSSRPTTPTHGMSPVHLLHNYRNRSLDQQTSFTASPSPPRYSD  511



>ref|NP_001185281.1| MLO-like protein 6 [Arabidopsis thaliana]
 ref|NP_001185283.1| MLO-like protein 6 [Arabidopsis thaliana]
 gb|AEE33852.1| MLO-like protein 6 [Arabidopsis thaliana]
 gb|AEE33854.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=521

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 152/241 (63%), Gaps = 30/241 (12%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS  +FGL +C
Sbjct  279  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNC  338

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+S+G+++QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  339  FHESRVDVIIRISIGLLVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  398

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQA------SPRGPASD  223
            ++  + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S+        SPR    D
Sbjct  399  KKNIKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNAPHKRSRSVDESFANSFSPRNSDFD  458

Query  222  --DQVWANSAAATSASPRRNLSSNDD---------------------QHEIQIVS-NDFS  115
              D    +  A TS S  R+    ++                     QHEI  +S  DFS
Sbjct  459  SWDPESQHETAETSNSNHRSRFGEEESEKKFVSSSVELPPGPGQIRTQHEISTISLRDFS  518

Query  114  F  112
            F
Sbjct  519  F  519



>ref|XP_006302048.1| hypothetical protein CARUB_v10020030mg [Capsella rubella]
 gb|EOA34946.1| hypothetical protein CARUB_v10020030mg [Capsella rubella]
Length=592

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 146/212 (69%), Gaps = 18/212 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+P D+ FWF RP  +LF I  VLF NAFQ+AFF WS  +FGL +C
Sbjct  346  RIQEKGDVVKGTPLVQPSDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH ++ D+ IR+S+G+I+QILCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH  A
Sbjct  406  FHESSVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVAIALKSWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S+         DD  +AN
Sbjct  466  KKQIKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNVPHKRSRSV---------DDNSFAN  516

Query  204  SAAATSASPRRNLSSN----DDQHEIQIVSND  121
                 S SPRRN   +    + QHE    S +
Sbjct  517  -----SMSPRRNSDFDSWDPESQHETAETSTN  543



>ref|XP_009133344.1| PREDICTED: MLO-like protein 12 isoform X2 [Brassica rapa]
Length=570

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  303  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  362

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  363  FHHKTEDIAIRITMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDKVANALKKWHHTA  422

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            +++ + G    N TP +SRP TP HGMSPVHLL ++++ + D   S  ASP  P   D
Sbjct  423  KKQTKHGHSGSN-TPHSSRPTTPTHGMSPVHLLHNYRNRSLDQQTSFTASPSPPRYSD  479



>gb|AAX77015.1| MLO1 [Lotus japonicus]
Length=551

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 149/212 (70%), Gaps = 7/212 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVK--FGLF  571
            +IQERGDV+KGAP+VEPGD+LFWFNRP L+L  +  VLFQNAFQ+AFF WS     F + 
Sbjct  310  KIQERGDVIKGAPLVEPGDDLFWFNRPRLILSLVHLVLFQNAFQLAFFAWSACDNDFKIN  369

Query  570  SCFHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHr  391
            SCFHR+ AD+ IRL++GV+ Q+LCSYVTLPLYALVTQMGS+M+P IF D VA+A+K+WH 
Sbjct  370  SCFHRSTADVVIRLTLGVVTQVLCSYVTLPLYALVTQMGSTMRPTIFHDRVATALKSWHH  429

Query  390  aarqrarrg--qRSENSTPFTSRPATPLHGMSPVHLLSDFQ-HNAADSLQASPRGPASDD  220
             A++  +      S ++TPF+SRPATP HGMSPVHLL     ++ +DS  ASPR   S+ 
Sbjct  430  TAKKHVKHNRDSNSHSNTPFSSRPATPTHGMSPVHLLHKHHNYHNSDSPLASPRESPSNY  489

Query  219  QVWANSAAATSASPRRNLSSNDDQHEIQIVSN  124
            +           SP  +   +D   ++Q++ +
Sbjct  490  E--TEQWYLEPNSPSNHTRGHDQTLQMQVLGS  519



>ref|XP_003548912.1| PREDICTED: MLO-like protein 12-like isoform X1 [Glycine max]
Length=571

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 138/207 (67%), Gaps = 7/207 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+VLKGAPVVEPGD+LFWFNRP L+L  I  V FQNAFQ+A F WS  +F + SC
Sbjct  337  RIQDRGEVLKGAPVVEPGDDLFWFNRPRLLLSIIHLVFFQNAFQLAHFAWSTYEFSINSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   D  IRL+MGV+IQ+LCSYVTLPLYALV QMGS+MKP IF D VA+A+K WH  +
Sbjct  397  FHKTTVDTIIRLTMGVVIQVLCSYVTLPLYALVAQMGSTMKPTIFNDRVAAALKKWHHTS  456

Query  384  rqrarrgqRSE--NSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            ++  +  + SE  N TPF+SR +TP  GMSP+HLL       +DS Q SPR        +
Sbjct  457  KKHVKDRKHSEGNNVTPFSSRSSTPTFGMSPIHLLHRHLAGRSDSAQTSPRTSN-----Y  511

Query  210  ANSAAATSASPRRNLSSNDDQHEIQIV  130
             N       SP  +     D+  +Q++
Sbjct  512  ENEQCDVDGSPSTSYHPETDETPMQVL  538



>ref|XP_007151752.1| hypothetical protein PHAVU_004G071700g [Phaseolus vulgaris]
 gb|ESW23746.1| hypothetical protein PHAVU_004G071700g [Phaseolus vulgaris]
Length=573

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 158/230 (69%), Gaps = 25/230 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RG+V+KGAP+VEPGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F L SC
Sbjct  339  RITDRGEVVKGAPLVEPGDDLFWFNRPRLLLFLIHLVLFQNAFQLAFFSWSTYEFSLDSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH   AD+AIRL+MGV+IQ+LCSYVTLPLYALVTQMGS+MKP IF   VASA+K WH   
Sbjct  399  FHETTADVAIRLTMGVVIQVLCSYVTLPLYALVTQMGSTMKPTIFNQRVASALKNWH---  455

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW--  211
                ++ + S+ +TPF+S+P+TP +GMSP+HLL       +DS Q SPR    +++ W  
Sbjct  456  STAKKQVKNSKQNTPFSSKPSTPTYGMSPMHLLQKHLAGRSDSAQTSPRTSNYENEQWDV  515

Query  210  ------ANSAAA-----------TSASPRRNLSSNDDQHEIQIVSNDFSF  112
                  +N AAA           +S++P    SS   Q EI++ S++FSF
Sbjct  516  EGSPSTSNHAAAEETQMQVMEPGSSSAPEFPTSS---QIEIRVSSSEFSF  562



>ref|XP_004142393.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 gb|KGN52283.1| hypothetical protein Csa_5G623470 [Cucumis sativus]
Length=574

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQERG V+KG PVV+P D+LFWF RP L+LF I FVLF NAFQ+AFF W+   F    CF
Sbjct  335  IQERGHVVKGVPVVQPRDDLFWFGRPQLILFLIHFVLFMNAFQLAFFAWTTYAFKWMGCF  394

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+   DI IRLSMGVIIQ+LCSYVTLPLYALVTQMGS+M+P IF D VA+A+K WH +A+
Sbjct  395  HQRVEDIVIRLSMGVIIQVLCSYVTLPLYALVTQMGSNMRPTIFNDRVATALKNWHHSAK  454

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            +  ++ +  ++++PF+SRPATP HGMSP+HLL   QH +      SPR   ++   W   
Sbjct  455  KNMKQHRNPDSTSPFSSRPATPTHGMSPIHLLHKHQHGS-----TSPRLSDAEPDRWEEL  509

Query  201  AAATSASPRRNLSSNDDQHE  142
              ++  S   +  ++ DQ E
Sbjct  510  PPSSHHSRAPHHDNHQDQQE  529



>ref|XP_004157520.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6-like [Cucumis 
sativus]
Length=574

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQERG V+KG PVV+P D+LFWF RP L+LF I FVLF NAFQ+AFF W+   F    CF
Sbjct  335  IQERGHVVKGVPVVQPRDDLFWFGRPQLILFLIHFVLFMNAFQLAFFAWTTYAFKWMGCF  394

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+   DI IRLSMGVIIQ+LCSYVTLPLYALVTQMGS+M+P IF D VA+A+K WH +A+
Sbjct  395  HQRVEDIVIRLSMGVIIQVLCSYVTLPLYALVTQMGSNMRPTIFNDRVATALKNWHHSAK  454

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            +  ++ +  ++++PF+SRPATP HGMSP+HLL   QH +      SPR   ++   W   
Sbjct  455  KNMKQHRNPDSTSPFSSRPATPTHGMSPIHLLHKHQHGS-----TSPRLSDAEPDRWEEL  509

Query  201  AAATSASPRRNLSSNDDQHE  142
              ++  S   +  ++ DQ E
Sbjct  510  PPSSHHSRAPHHDNHQDQQE  529



>gb|KHN13369.1| MLO-like protein 12 [Glycine soja]
Length=592

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 138/207 (67%), Gaps = 7/207 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+VLKGAPVVEPGD+LFWFNRP L+L  I  V FQNAFQ+A F WS  +F + SC
Sbjct  358  RIQDRGEVLKGAPVVEPGDDLFWFNRPRLLLSIIHLVFFQNAFQLAHFAWSTYEFSINSC  417

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   D  IRL+MGV+IQ+LCSYVTLPLYALV QMGS+MKP IF D VA+A+K WH  +
Sbjct  418  FHKTTVDTIIRLTMGVVIQVLCSYVTLPLYALVAQMGSTMKPTIFNDRVAAALKKWHHTS  477

Query  384  rqrarrgqRSE--NSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            ++  +  + SE  N TPF+SR +TP  GMSP+HLL       +DS Q SPR        +
Sbjct  478  KKHVKDRKHSEGNNVTPFSSRSSTPTFGMSPIHLLHRHLAGRSDSAQTSPRTSN-----Y  532

Query  210  ANSAAATSASPRRNLSSNDDQHEIQIV  130
             N       SP  +     D+  +Q++
Sbjct  533  ENEQCDVDGSPSTSYHPETDETPMQVL  559



>gb|KJB73619.1| hypothetical protein B456_011G240700 [Gossypium raimondii]
Length=576

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 150/246 (61%), Gaps = 35/246 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RGDV+KGAPVV+PGD+LFWF RPS +LF I  VLF NAFQ+AFF WS  +F + SC
Sbjct  334  RIQDRGDVVKGAPVVQPGDDLFWFGRPSFLLFLIHVVLFTNAFQLAFFVWSMYEFTIRSC  393

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +  D+ IR+SMGVIIQ LCSYVTLPLYALVTQMG++M+P IF D VA+A+K WH  A
Sbjct  394  YHEHIEDVIIRVSMGVIIQFLCSYVTLPLYALVTQMGTNMRPTIFNDRVAAALKNWHHTA  453

Query  384  rqrarrg--qRSENSTPFTSRPATPLHGMSPVHLLSDF----------------------  277
            ++  ++     SEN+TPF+SRPATP HGMSPVH+L                         
Sbjct  454  KKHTKQSRLLHSENTTPFSSRPATPTHGMSPVHILHKHPQRSETYGISSGHSVDHWDPGL  513

Query  276  ------QHNAADSLQASPRGPAS--DDQVWANSAAATSASPRRNLSSNDDQHEIQIVSND  121
                   H   D +    +      D  V  + ++   A   + + +   QHEI I+ +D
Sbjct  514  FHSPLQSHEINDPIHDRTQIEMRDVDRTVQESGSSQMDAETPQTIRT---QHEIDIIPSD  570

Query  120  FSFVNN  103
            FSF  N
Sbjct  571  FSFAKN  576



>ref|NP_176350.1| MLO-like protein 6 [Arabidopsis thaliana]
 sp|Q94KB7.2|MLO6_ARATH RecName: Full=MLO-like protein 6; Short=AtMlo6 [Arabidopsis thaliana]
 gb|AAD25552.1|AC005850_9 Highly Simlilar to Mlo proteins [Arabidopsis thaliana]
 gb|AAK53799.2|AF369567_1 membrane protein Mlo6 [Arabidopsis thaliana]
 gb|AEE33851.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=583

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 152/241 (63%), Gaps = 30/241 (12%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS  +FGL +C
Sbjct  341  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+S+G+++QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  401  FHESRVDVIIRISIGLLVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQA------SPRGPASD  223
            ++  + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S+        SPR    D
Sbjct  461  KKNIKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNAPHKRSRSVDESFANSFSPRNSDFD  520

Query  222  --DQVWANSAAATSASPRRNLSSNDD---------------------QHEIQIVS-NDFS  115
              D    +  A TS S  R+    ++                     QHEI  +S  DFS
Sbjct  521  SWDPESQHETAETSNSNHRSRFGEEESEKKFVSSSVELPPGPGQIRTQHEISTISLRDFS  580

Query  114  F  112
            F
Sbjct  581  F  581



>ref|XP_002886534.1| hypothetical protein ARALYDRAFT_315221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62793.1| hypothetical protein ARALYDRAFT_315221 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 156/242 (64%), Gaps = 31/242 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS  +FGL +C
Sbjct  343  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFGLKNC  402

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR+S+G+I+QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  403  FHESRVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  462

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQA------SPRGPASD  223
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S+        SPR    D
Sbjct  463  KKQIKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNAPHKRSRSVDESFANSMSPRNSDFD  522

Query  222  --DQVWANSAAATS-----------ASPRRNLSSND-----------DQHEIQIVS-NDF  118
              D    + AA TS            S ++ +SS+             QHEI  +S  DF
Sbjct  523  SWDPESQHEAAETSNSNHCSRVREEESEKKFVSSSSVELPPGPGQIRTQHEISTISLRDF  582

Query  117  SF  112
            SF
Sbjct  583  SF  584



>gb|KFK36813.1| hypothetical protein AALP_AA4G174800 [Arabis alpina]
Length=572

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 138/197 (70%), Gaps = 4/197 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR+SMGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRISMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G    N TP +SRPATP HGMSPVHLL +  HN   +  ASP  P   D     
Sbjct  455  KKQTKHGHSGSN-TPQSSRPATPTHGMSPVHLLHN--HNRDSNFAASPSPPRFSDYSGQG  511

Query  204  SAAATSASPR-RNLSSN  157
                    P  +NLSS+
Sbjct  512  HGHHHFYDPESQNLSSH  528



>ref|XP_006417368.1| hypothetical protein EUTSA_v10007208mg [Eutrema salsugineum]
 gb|ESQ35721.1| hypothetical protein EUTSA_v10007208mg [Eutrema salsugineum]
Length=573

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  343  RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  402

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +G ++QILCSYVTLPLYALVTQMG++MKP +F + VA+A+K WHR A
Sbjct  403  FHESNADVVIRIVVGAVVQILCSYVTLPLYALVTQMGTTMKPTVFKERVATALKNWHRTA  462

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASD  223
            +++ + G+ SE++TP++SRP TP HG SP+HLL +F   + +S   SP    SD
Sbjct  463  KKQTKHGRHSESTTPYSSRPTTPTHGSSPIHLLHNFNKRSVESFPNSPSPRYSD  516



>ref|XP_009342695.1| PREDICTED: MLO-like protein 6 isoform X1 [Pyrus x bretschneideri]
Length=578

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 153/241 (63%), Gaps = 31/241 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            ++ ERG+V++G P+VEPGD+LFWFN P L+L+ I FVLFQNAF +AFF W+W +FGL SC
Sbjct  341  QLSERGEVVRGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGVIIQILCSYVTLPLYALVTQMGS+MKP+IF D VA+A+K WH   
Sbjct  401  FHEKLEDVVLRISMGVIIQILCSYVTLPLYALVTQMGSTMKPIIFNDRVATALKKWH---  457

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNA-ADSLQASPR-------GPA  229
               A++  + +N++P  S P TPLH MSPVHLL ++++    DS++ SPR       G  
Sbjct  458  -ITAKKHLKHKNASP-ASAPGTPLHSMSPVHLLHNYRYEQDIDSIRTSPRISYFDNEGSD  515

Query  228  S-----DDQVWANSAAATSASPRR------NLSSND-------DQHEIQIVSNDFSFVNN  103
            S     D+  W+          +       N  SN         QHEIQI S   +F  +
Sbjct  516  SPFHHQDNLTWSQQGTNMEGQKKEISAHGPNSESNALGAYGSIIQHEIQIHSAALTFEKS  575

Query  102  K  100
            +
Sbjct  576  E  576



>ref|XP_007218951.1| hypothetical protein PRUPE_ppa003466mg [Prunus persica]
 gb|EMJ20150.1| hypothetical protein PRUPE_ppa003466mg [Prunus persica]
Length=572

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 147/244 (60%), Gaps = 31/244 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAP+V+PGD+LFWF  P  MLF I FVLFQNAFQ+AFF WS  +FG+ SC
Sbjct  328  RIQERGDVVKGAPLVQPGDHLFWFGSPRFMLFLIHFVLFQNAFQLAFFAWSTYEFGIASC  387

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IR+SMGVIIQ LCSYVTLPLYALVTQMGS+MK  +F +  A A+K+WH  A
Sbjct  388  FHQRTEDIVIRISMGVIIQFLCSYVTLPLYALVTQMGSTMKRTVFKEEEAEALKSWHNKA  447

Query  384  rqrarrgqRSENSTPFTSRPATPLHG--MSPVHLLSDFQHN---AADSLQASPRGPASDD  220
            ++  +    S ++TPF+S P TP HG  MSP+HLL   QHN    AD    SPR    + 
Sbjct  448  KKNTKLSHHSHSNTPFSSTPGTPGHGVRMSPLHLLH--QHNNRSDADGYYVSPRASNLEL  505

Query  219  QVWA----------NSAAATSASPRRNLSSN--------------DDQHEIQIVSNDFSF  112
              W           N+A  +     R L                   QHE+ I  ++FSF
Sbjct  506  SHWETEGSSHSLNNNNAGLSDPEEIRELDQEPTSTTQLPPAPPGIRTQHEVNISLSEFSF  565

Query  111  VNNK  100
               K
Sbjct  566  GKGK  569



>ref|XP_006293900.1| hypothetical protein CARUB_v10022893mg [Capsella rubella]
 gb|EOA26798.1| hypothetical protein CARUB_v10022893mg [Capsella rubella]
Length=577

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 149/221 (67%), Gaps = 9/221 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP L+LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRLILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ++CSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKNEDIAIRITMGVLIQVICSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA----DSLQASPRGPASDDQ  217
            +++ + GQ   N TP +SRPATP HGMSPVHLL ++ + ++     S  ASP  P   D 
Sbjct  455  KKQTKHGQSGSN-TPHSSRPATPTHGMSPVHLLHNYHNRSSLDQQTSFTASPSPPRFSDY  513

Query  216  VWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVNNKHN  94
                        P     S +  ++ +I  ++FS  ++ H 
Sbjct  514  SGHGHGHHQFFDP----ESQNHSYQREITDSEFSNSHHPHT  550



>ref|XP_008365656.1| PREDICTED: MLO-like protein 6 [Malus domestica]
Length=573

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 4/208 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAP+V+P D+LFWF  P  ML+ + FVLFQNAFQ+AFF WS  +FG+ SC
Sbjct  327  RIQERGDVVKGAPLVQPSDHLFWFGSPRFMLYLLHFVLFQNAFQMAFFAWSTYEFGITSC  386

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FHR+  DI +RLS GVI+Q+LCSYVTLPLYALVTQMGS+MKP +F + VA+A+K WH  A
Sbjct  387  FHRSTEDIVVRLSFGVIVQVLCSYVTLPLYALVTQMGSTMKPTVFNEGVAAALKDWHHKA  446

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPRGPASDDQVWA  208
            ++       S ++TPF+S P +P  G SPVHLL +  + +  D    SPR    +   W 
Sbjct  447  KKNTNHSHHSPSTTPFSSMPPSPTRGTSPVHLLHNHNYRSNDDEFYVSPRRSNLEMGHWG  506

Query  207  NSAAATSASPRRNLSSNDDQHEIQIVSN  124
               +  S SP  N+ ++D   EI+  +N
Sbjct  507  TEGS--SHSPNNNVGASDGD-EIRQKTN  531



>gb|AFW98803.1| MLO protein 3 [Rosa multiflora]
Length=563

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG V+ GAP+V+PGD+ FWF RP  MLF I FVLFQNAFQ+AFF WS  +FG+ SC
Sbjct  326  RIQERGGVVMGAPLVQPGDHYFWFGRPRFMLFLIHFVLFQNAFQLAFFAWSTWQFGIDSC  385

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DIAIR+SMGVIIQ+LCSYVTLPLYALVTQMGSSMKP +F + VA A+K+WH  A
Sbjct  386  FHQTPEDIAIRISMGVIIQVLCSYVTLPLYALVTQMGSSMKPTVFNEGVAEAVKSWHHKA  445

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD  259
            +++ +    SE STP +SRP TP HGMSPVHLL +  + + +
Sbjct  446  KKKVKHSLHSERSTPLSSRPGTPTHGMSPVHLLHNVNNRSDE  487



>gb|AEC12478.1| membrane protein [Rosa multiflora]
Length=567

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG V+ GAP+V+PGD+ FWF RP  MLF I FVLFQNAFQ+AFF WS  +FG+ SC
Sbjct  330  RIQERGGVVMGAPLVQPGDHYFWFGRPRFMLFLIHFVLFQNAFQLAFFAWSTWQFGIDSC  389

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DIAIR+SMGVIIQ+LCSYVTLPLYALVTQMGSSMKP +F + VA A+K+WH  A
Sbjct  390  FHQTPEDIAIRISMGVIIQVLCSYVTLPLYALVTQMGSSMKPTVFNEGVAEAVKSWHHKA  449

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD  259
            +++ +    SE STP +SRP TP HGMSPVHLL +  + + +
Sbjct  450  KKKVKHSLHSERSTPLSSRPGTPTHGMSPVHLLHNVNNRSDE  491



>ref|XP_008246012.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=384

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 141/210 (67%), Gaps = 4/210 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAP+V+PGD+LFWF  P  MLF I FVLFQNAFQ+AFF WS   FG+ SC
Sbjct  141  RIQERGDVVKGAPLVQPGDHLFWFGSPRYMLFLIHFVLFQNAFQLAFFAWSTYAFGIKSC  200

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR+SMGVI+Q LCSYVTLPLYALVTQMGS+MK  +F + V  A+K+WH  A
Sbjct  201  FHERNEDIVIRISMGVIVQFLCSYVTLPLYALVTQMGSTMKRTVFNEEVVRALKSWHNKA  260

Query  384  rqrarrgqRSENSTPFTSRPATPLHG--MSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            +++ + G  S ++TPF+S P TP  G  MSPVHLL     + AD    SPR  AS+ ++ 
Sbjct  261  KKKTKLGPHSHSNTPFSSTPGTPSQGLRMSPVHLLHKHNRSDADGYYVSPR--ASNLELS  318

Query  210  ANSAAATSASPRRNLSSNDDQHEIQIVSND  121
                  +S S   N +   D  EI+ +  +
Sbjct  319  HWEIEGSSHSLNNNNAGPSDPEEIRELDQE  348



>emb|CDY47582.1| BnaA01g22680D [Brassica napus]
Length=556

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 139/191 (73%), Gaps = 16/191 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+GD++KG P+V+PGD+LFWF RP  +LF +  VLF NAFQ+AFF W+  +F L +CF
Sbjct  353  IQEKGDIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWTTYEFKLKNCF  412

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+N  D+ IR+S+GVI+Q+LCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH  A+
Sbjct  413  HKNTVDVVIRISVGVIVQVLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAK  472

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            ++ + G+ SE++TPF+SRPATP HG SP+HLL    HN         +   S D+ +AN 
Sbjct  473  KQMKHGRTSESTTPFSSRPATPTHGSSPIHLL----HNVH-------KRSRSADESFAN-  520

Query  201  AAATSASPRRN  169
                S SPRRN
Sbjct  521  ----SMSPRRN  527



>gb|AFW98804.1| MLO protein 4 [Rosa multiflora]
Length=564

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+ GAP+V+PGD+ FWF RP  MLF I FVLFQNAFQ+AFF WS  +FG+ SC
Sbjct  330  RIQERGDVVMGAPLVQPGDHYFWFGRPRFMLFLIHFVLFQNAFQLAFFAWSAWEFGIQSC  389

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH     IAIR+SMGVIIQ+LCSYVTLPLYALVTQMGSSMKP +F + VA A+K+WH  A
Sbjct  390  FHPIPESIAIRISMGVIIQVLCSYVTLPLYALVTQMGSSMKPTVFNEGVAEAVKSWHHKA  449

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD  259
            +++ +    SE STPF+SRP TP HGMSPVHLL +  + + +
Sbjct  450  KKKVKHSLHSERSTPFSSRPGTPTHGMSPVHLLHNVNNRSDE  491



>ref|XP_010473362.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=596

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 15/192 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  346  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH ++ D+ IR+S+G+I+QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  406  FHESSVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S          DD     
Sbjct  466  KKQMKHGRSSESTTPFSSRPTTPTHGSSPIHLLRNVPHKRSRSF---------DD-----  511

Query  204  SAAATSASPRRN  169
               A S SPRRN
Sbjct  512  -GFANSMSPRRN  522



>ref|XP_009104728.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=595

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 139/191 (73%), Gaps = 16/191 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+GD++KG P+V+PGD+LFWF RP  +LF +  VLF NAFQ+AFF W+  +F L +CF
Sbjct  353  IQEKGDIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWTTYEFKLKNCF  412

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+N  D+ IR+S+GVI+Q+LCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH  A+
Sbjct  413  HKNTVDVVIRISVGVIVQVLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAK  472

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            ++ + G+ SE++TPF+SRPATP HG SP+HLL    HN         +   S D+ +AN 
Sbjct  473  KQMKHGRTSESTTPFSSRPATPTHGSSPIHLL----HNVH-------KRSRSADESFAN-  520

Query  201  AAATSASPRRN  169
                S SPRRN
Sbjct  521  ----SMSPRRN  527



>ref|XP_010043720.1| PREDICTED: MLO-like protein 6 isoform X1 [Eucalyptus grandis]
 gb|KCW85717.1| hypothetical protein EUGRSUZ_B02482 [Eucalyptus grandis]
Length=579

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 150/240 (63%), Gaps = 31/240 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG+V+KG P+V PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF W+  +FG  SC
Sbjct  335  RIHERGEVIKGVPLVHPGDDLFWFNRPHLILYLINFVLFQNAFQLAFFAWTVYEFGFKSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A+++WH  +
Sbjct  395  FHAHTEDVVIRITMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRSWH-QS  453

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  +  +S + TP +SRP TP H MSPVHLL  ++ +  DS   SPR    D   W +
Sbjct  454  AKKHIKQNKSSSVTPMSSRPMTPSHHMSPVHLLRHYRVD-RDSFHTSPRRSNVDADHWES  512

Query  204  SAAAT----------SASPRRNLSSN-------------------DDQHEIQIVSNDFSF  112
               +           S+S R + + +                     QHEI I   DFSF
Sbjct  513  ETPSPSHHHHHQGDGSSSHRHHGTEHGHVGPEVGSSQAVPASQPVQTQHEINIGPQDFSF  572



>gb|KJB67707.1| hypothetical protein B456_010G205000 [Gossypium raimondii]
Length=568

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 0/193 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG V+KG P+VEPGD LFWF RPS +L  I  VLF NAFQ+AFF WS  +F + SC
Sbjct  320  RIQERGGVVKGTPLVEPGDELFWFGRPSFLLLLIHIVLFTNAFQLAFFVWSTYEFTINSC  379

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    DI IR+SMGVIIQ+LCSYVTLPLYALV QMG+ M+P IF + VA A+K W   A
Sbjct  380  YHEKVEDIVIRISMGVIIQVLCSYVTLPLYALVNQMGTKMRPTIFNERVADALKNWRDTA  439

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  + G+RSEN+TPF+SRP TP  GMSPVHLL ++Q  + +S   S      ++  W  
Sbjct  440  KENTKHGRRSENTTPFSSRPGTPTRGMSPVHLLHNYQRKSEESGHTSLAHSDFENDNWDP  499

Query  204  SAAATSASPRRNL  166
            +    ++S  R++
Sbjct  500  ADTFANSSSHRDI  512



>ref|XP_010418123.1| PREDICTED: MLO-like protein 6 [Camelina sativa]
Length=597

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 137/192 (71%), Gaps = 15/192 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  346  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH ++ D+ IR+S+G+I+QILCSYVTLPLYALVTQMGS MKP +F + +A+A+K+WH  A
Sbjct  406  FHESSVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERIATALKSWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S          DD     
Sbjct  466  KKQMKHGRSSESTTPFSSRPTTPTHGSSPIHLLRNVPHKRSRSF---------DD-----  511

Query  204  SAAATSASPRRN  169
               A S SPRRN
Sbjct  512  -GFANSMSPRRN  522



>gb|KJB55486.1| hypothetical protein B456_009G078600 [Gossypium raimondii]
Length=587

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 135/189 (71%), Gaps = 2/189 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVVE GD+LFWFNRPSL+LF I FVLFQNAFQ+AFF ++W +FG+ SC
Sbjct  345  RIQERGEVVKGVPVVELGDHLFWFNRPSLILFLINFVLFQNAFQLAFFVYTWYEFGIHSC  404

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ I +SMGVI+QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH   
Sbjct  405  FHEHVEDLVISISMGVIVQILCSYVTLPLYALVTQMGSNMKPTIFNERVATALRNWH-HT  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  R + S   TPF+S P TP H  SP+HLL  ++    DS+  SP   + D +    
Sbjct  464  ARKHVRNKGSTTVTPFSSIPNTPSHHTSPIHLLKHYR-GEMDSVHTSPNRSSFDIESSET  522

Query  204  SAAATSASP  178
             +  TS  P
Sbjct  523  DSPYTSHHP  531



>ref|XP_010430162.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=633

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 15/192 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  381  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFKLKNC  440

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH ++ D+ IR+S+G+I+QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  441  FHESSVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  500

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S          DD     
Sbjct  501  KKQMKHGRSSESTTPFSSRPTTPTHGSSPIHLLRNVPHKRSRSF---------DD-----  546

Query  204  SAAATSASPRRN  169
               A S SPRRN
Sbjct  547  -GFANSMSPRRN  557



>ref|NP_172598.1| MLO-like protein 2 [Arabidopsis thaliana]
 sp|Q9SXB6.1|MLO2_ARATH RecName: Full=MLO-like protein 2; Short=AtMlo2 [Arabidopsis thaliana]
 gb|AAD49991.1|AC007259_4 Highly similar to Mlo proteins [Arabidopsis thaliana]
 gb|AAK53795.1|AF369563_1 membrane protein Mlo2 [Arabidopsis thaliana]
 gb|AAM63648.1| Mlo protein, putative [Arabidopsis thaliana]
 dbj|BAE98591.1| Mlo like protein [Arabidopsis thaliana]
 gb|AEE28715.1| MLO-like protein 2 [Arabidopsis thaliana]
Length=573

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  344  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IRL +G ++QILCSYVTLPLYALVTQMGS MKP +F D VA+A+K WH  A
Sbjct  404  FHESTADVVIRLVVGAVVQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHHTA  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP  241
            +   + G+ S ++TPF+SRP TP HG SP+HLL +F + + ++  +SP
Sbjct  464  KNETKHGRHSGSNTPFSSRPTTPTHGSSPIHLLHNFNNRSVENYPSSP  511



>ref|NP_001284458.1| MLO-like protein 12 [Cucumis melo]
 gb|ACX55084.1| Mlo1 [Cucumis melo]
Length=570

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 136/200 (68%), Gaps = 8/200 (4%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQERG V+KG PVV+P D+LFWF RP L+LF I FVLF NAFQ+AFF W+   F    CF
Sbjct  335  IQERGHVVKGVPVVQPRDDLFWFGRPQLILFLIHFVLFMNAFQLAFFAWTTYAFTWRGCF  394

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+   DIAIRLSMGVIIQ+LCSYVTLPLYALVTQMGS+M+P IF D VA+A+K WH +A+
Sbjct  395  HQRIEDIAIRLSMGVIIQVLCSYVTLPLYALVTQMGSNMRPTIFNDRVATALKNWHHSAK  454

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            +  ++ +  ++++PF+SRP TP HGMSP+HLL   QH +      SPR   ++   W   
Sbjct  455  KNMKQHRNPDSTSPFSSRPTTPTHGMSPIHLLHKHQHGS-----TSPRLSDAEPDQWEE-  508

Query  201  AAATSASPRRNLSSNDDQHE  142
                 +S       N DQ E
Sbjct  509  --LPPSSHHNRAHDNQDQQE  526



>ref|XP_008369779.1| PREDICTED: MLO-like protein 6 isoform X2 [Malus domestica]
Length=579

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 145/237 (61%), Gaps = 30/237 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            ++ ERG+V+KG P+VEPGD+LFWFN P L+L+ I FVLFQNAF +AFF W+W +FGL SC
Sbjct  341  KLSERGEVVKGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGV+IQILCSYVTLPLYALVTQMGS+MKPVIF D VA+A+K WH   
Sbjct  401  FHEKLEDVVLRISMGVVIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWH---  457

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ-HNAADSLQASPR-------GPA  229
                +  + ++N++P    P TP H MSPVHLL ++Q     +S +  PR       G  
Sbjct  458  IAAKKHIKHNKNASP-AGAPGTPSHAMSPVHLLRNYQSEQDTESFRTLPRMSYFDNEGSD  516

Query  228  S-----DDQVWANSAAATSASPR------RNLSSND-------DQHEIQIVSNDFSF  112
            S     DD  W+                 RN  SN         QHEIQ+ S   +F
Sbjct  517  SPFHHQDDLTWSQQGTNRQGQEEEISAHGRNSESNALGGYGSIIQHEIQVQSAKLTF  573



>ref|XP_010412940.1| PREDICTED: MLO-like protein 12, partial [Camelina sativa]
Length=509

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++G V+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGYVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLRNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR+SMG +IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRISMGGLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGP  232
            +++ + G    N TP +SRP TP HGMSPVHLL ++ H + D   S  ASP  P
Sbjct  455  KKQTKHGHSGSN-TPQSSRPTTPTHGMSPVHLLHNYNHRSLDQQTSFTASPSPP  507



>ref|XP_006391995.1| hypothetical protein EUTSA_v10023372mg [Eutrema salsugineum]
 gb|ESQ29281.1| hypothetical protein EUTSA_v10023372mg [Eutrema salsugineum]
Length=585

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 147/240 (61%), Gaps = 30/240 (13%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+GDV+KG P+V+PGD+LFWF RP  +LF I  VLF NAFQ+AFF W+  +F + +CF
Sbjct  344  IQEKGDVVKGMPLVKPGDHLFWFGRPRFILFLIHLVLFSNAFQLAFFAWTTYEFKIDNCF  403

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+N A + IR+S+GVI+QILCSYVTLPLYALVTQMGS MKP +F   VA+A+K+WH  A+
Sbjct  404  HKNRAAVIIRISLGVIVQILCSYVTLPLYALVTQMGSKMKPTVFNKKVATALKSWHHKAK  463

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDF-------------------------  277
            ++ + G+ SE++TPF+SRP TP  G SP+HLL +F                         
Sbjct  464  KQIKHGRNSESTTPFSSRPTTPTRGSSPIHLLRNFHKRSRSADESFVNSLSSPRYSDFDS  523

Query  276  -----QHNAADSLQASPRGPASDDQVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSF  112
                 QH A+ S     R    D +  A+S++      R        QHEI I   DFSF
Sbjct  524  WEPEPQHEASSSAYHHSRVREEDFENKASSSSVVELPSRPEQIPTQLQHEITISLRDFSF  583



>ref|XP_008369778.1| PREDICTED: MLO-like protein 6 isoform X1 [Malus domestica]
Length=587

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 145/237 (61%), Gaps = 30/237 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            ++ ERG+V+KG P+VEPGD+LFWFN P L+L+ I FVLFQNAF +AFF W+W +FGL SC
Sbjct  349  KLSERGEVVKGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSC  408

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGV+IQILCSYVTLPLYALVTQMGS+MKPVIF D VA+A+K WH   
Sbjct  409  FHEKLEDVVLRISMGVVIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWH---  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ-HNAADSLQASPR-------GPA  229
                +  + ++N++P    P TP H MSPVHLL ++Q     +S +  PR       G  
Sbjct  466  IAAKKHIKHNKNASP-AGAPGTPSHAMSPVHLLRNYQSEQDTESFRTLPRMSYFDNEGSD  524

Query  228  S-----DDQVWANSAAATSASPR------RNLSSND-------DQHEIQIVSNDFSF  112
            S     DD  W+                 RN  SN         QHEIQ+ S   +F
Sbjct  525  SPFHHQDDLTWSQQGTNRQGQEEEISAHGRNSESNALGGYGSIIQHEIQVQSAKLTF  581



>ref|XP_007132193.1| hypothetical protein PHAVU_011G073800g [Phaseolus vulgaris]
 gb|ESW04187.1| hypothetical protein PHAVU_011G073800g [Phaseolus vulgaris]
Length=566

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 154/226 (68%), Gaps = 16/226 (7%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG++LKG P+V+PGD LFWFN+P L+L+ I FVLFQNAFQ+AFF WS ++FG+ SC
Sbjct  334  RIQQRGEILKGVPLVQPGDYLFWFNKPGLILYLINFVLFQNAFQLAFFSWSVLQFGIKSC  393

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH+ A
Sbjct  394  FHAHTEDVVIRITMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAEALRNWHQTA  453

Query  384  rqrarrgqR---SENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD--  220
            +++ R+ +    S + TP +SRP TP H MSPVHLL  ++ +  DS   SPR    D   
Sbjct  454  KKQIRQNRVGPLSLSVTPMSSRPTTPSHNMSPVHLLRYYR-SEIDSFPTSPRRSNVDGDH  512

Query  219  -QVWANSAAATSASPRR-------NLSSNDDQHEIQIVSN--DFSF  112
             Q W   + + S S          + ++N   HEI   +N  +FSF
Sbjct  513  TQPWDVESPSPSYSHHEMEMGHTNDPTTNTTHHEIVPAANTREFSF  558



>ref|XP_009411538.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
 ref|XP_009411539.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            I ERGDV+KG P+V+P D+LFWFNRP L+LF I FVLFQNAFQ+ F  WSW +FG  SCF
Sbjct  344  IMERGDVVKGVPIVQPADDLFWFNRPRLLLFLIHFVLFQNAFQLGFLAWSWYEFGYPSCF  403

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+N  DI IR+S+G++IQ+LCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH+ A+
Sbjct  404  HQNIEDIIIRISLGILIQVLCSYVTLPLYALVTQMGSNMKPTIFDERVATALRKWHQLAK  463

Query  381  qrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD  220
            +  +  +RS + +P  TSR ATP HG SPVHLL  +  +  DS+Q SP    +DD
Sbjct  464  KHLKENRRSGSVSPLSTSRTATPRHGWSPVHLL-HYNRSELDSVQNSPGRYLTDD  517



>ref|XP_011031756.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
 ref|XP_011031757.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=577

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V++GAPVV+PGD+LFWF RP  +LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  335  RIQERGEVVRGAPVVQPGDDLFWFGRPRFVLFLIHLVLFQNAFQIAFFIWSVYEFSIKSC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H +   I IR+++GVIIQI+CSYVTLPLYALVTQMGSSM+P +F D VA+A+K WH  A
Sbjct  395  YHAHTEAIVIRITLGVIIQIVCSYVTLPLYALVTQMGSSMRPTVFNDRVAAALKNWHHTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA-DSLQASPR  238
            +++++ G+ SE+ TP  SRP T  HGMSPVHLLS+ + + A +S   SPR
Sbjct  455  KKQSKHGKNSESHTPMLSRPQTRSHGMSPVHLLSNHRSSTAPNSFPNSPR  504



>ref|XP_008233336.1| PREDICTED: MLO-like protein 6 [Prunus mume]
 ref|XP_008233339.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=571

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 138/210 (66%), Gaps = 4/210 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERGDV+KGAP+V+PGD+LFWF  P  MLF I FVLFQNAFQ+AFF WS   FG+ SC
Sbjct  328  RIQERGDVVKGAPLVQPGDHLFWFGSPRYMLFLIHFVLFQNAFQLAFFAWSTYAFGIKSC  387

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR+SMGVI+Q LCSYVTLPLYALVTQMGS+MK  +F + V  A+K+WH  A
Sbjct  388  FHERNEDIVIRISMGVIVQFLCSYVTLPLYALVTQMGSTMKRTVFNEEVVRALKSWHNKA  447

Query  384  rqrarrgqRSENSTPFTSRPATPLHG--MSPVHLLSDFQHNAADSLQASPRGPASDDQVW  211
            +++ + G  S ++TPF+S P TP  G  MSPVHLL     + AD    SPR    +   W
Sbjct  448  KKKTKLGPHSHSNTPFSSTPGTPSQGLRMSPVHLLHKHNRSDADGYYVSPRASNLELSHW  507

Query  210  ANSAAATSASPRRNLSSNDDQHEIQIVSND  121
                  +S S   N +   D  EI+ +  +
Sbjct  508  --EIEGSSHSLNNNNAGPSDPEEIRELDQE  535



>gb|KFK40693.1| hypothetical protein AALP_AA2G029100 [Arabis alpina]
Length=594

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 136/192 (71%), Gaps = 14/192 (7%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI E+GDV+KG P+V+PGD+ FWF RP  MLF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  345  RIHEKGDVVKGTPLVQPGDHFFWFGRPRFMLFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  404

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+N  D+ IR+++GVI+Q LCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  405  FHKNNIDVIIRIALGVIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  464

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +             R  + DD    N
Sbjct  465  KKQIKHGRNSESTTPFSSRPTTPTHGSSPIHLLRNVH----------KRSKSFDD----N  510

Query  204  SAAATSASPRRN  169
            ++ A S SPR +
Sbjct  511  NSFANSISPRHS  522



>emb|CDY34841.1| BnaA09g47670D [Brassica napus]
Length=273

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  43   RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  102

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  103  FHESNADVIIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  162

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS----DDQ  217
            +++ + G+ SE++TP++SRP TP HG SP+HLL +F H +A+S   SP    S    D Q
Sbjct  163  KKQTKHGRHSESTTPYSSRPTTPTHGSSPIHLLHNFNHRSAESFPNSPSPRYSSHHDDHQ  222

Query  216  VW  211
             W
Sbjct  223  FW  224



>emb|CDY07669.1| BnaA03g18420D [Brassica napus]
Length=516

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  274  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  333

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIA+R++MGV+IQ++CSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH+ A
Sbjct  334  FHHKTVDIALRITMGVLIQVVCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHKTA  393

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQAS  244
            +++++ G    N TP +SRPATP HGMSP+HLL    HN +   Q S
Sbjct  394  KKQSKHGTSGSN-TPHSSRPATPTHGMSPMHLLHS--HNRSLDYQTS  437



>emb|CDY26348.1| BnaA03g60240D [Brassica napus]
Length=591

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 138/191 (72%), Gaps = 16/191 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+G+++KG P+V+PGD+LFWF RP  +LF +  VLF NAFQ+AFF WS  +FG+ +CF
Sbjct  345  IQEKGEIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWSTYEFGIKNCF  404

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H++  D+ IR+S+G+I+Q LCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH  A+
Sbjct  405  HKSTVDVVIRISIGLIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAK  464

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            ++ + G+ SE++TPF+SRPATP HG SP+HLL +    +            S D+ +AN 
Sbjct  465  KQIKHGRTSESTTPFSSRPATPTHGSSPIHLLRNVHKRS-----------RSADESFAN-  512

Query  201  AAATSASPRRN  169
                S SPRRN
Sbjct  513  ----SLSPRRN  519



>ref|XP_009124631.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=590

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 138/191 (72%), Gaps = 16/191 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+G+++KG P+V+PGD+LFWF RP  +LF +  VLF NAFQ+AFF WS  +FG+ +CF
Sbjct  345  IQEKGEIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWSTYEFGIKNCF  404

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H++  D+ IR+S+G+I+Q LCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH  A+
Sbjct  405  HKSTVDVVIRISIGLIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAK  464

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            ++ + G+ SE++TPF+SRPATP HG SP+HLL +  H  + S               A+ 
Sbjct  465  KQIKHGRTSESTTPFSSRPATPTHGSSPIHLLRNV-HKRSRS---------------ADE  508

Query  201  AAATSASPRRN  169
            + A S SPRRN
Sbjct  509  SFANSLSPRRN  519



>ref|XP_010534417.1| PREDICTED: MLO-like protein 12 [Tarenaya hassleriana]
Length=581

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  334  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  393

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ IR++MGV+IQILCSY+TLPLYALVTQMGS+M+P IF D VA+A++ WH   
Sbjct  394  FHHKTEDVVIRITMGVLIQILCSYITLPLYALVTQMGSTMRPTIFNDRVATALRNWH-HT  452

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA  262
             +R  +   SE  TP +SRPATP HG+SPVHLL  + H ++
Sbjct  453  AKRHTKHGNSEPHTPLSSRPATPSHGLSPVHLLHSYPHRSS  493



>emb|CDY14402.1| BnaC03g21930D [Brassica napus]
Length=560

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  311  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  370

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIA+R++MGV+IQ++CSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH+ A
Sbjct  371  FHHKTVDIALRITMGVLIQVVCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHKTA  430

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQAS  244
            +++++ G    N TP +SRPATP HGMSP+HLL    HN +   Q S
Sbjct  431  KKQSKHGTSGSN-TPHSSRPATPTHGMSPMHLLHS--HNRSLDYQTS  474



>emb|CDY20991.1| BnaA08g25340D [Brassica napus]
Length=553

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 132/176 (75%), Gaps = 1/176 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAP+V+PGD+LFWF++PS MLF I  VLF NAFQ+AFF WS  +FG+ +C
Sbjct  341  RIQEKGDVVRGAPLVKPGDDLFWFDKPSFMLFLIHLVLFTNAFQLAFFAWSSYEFGISNC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IR+ +G+ +QILCSYVTLPLYALVTQMG++MKP +F   V   +K WH  A
Sbjct  401  FHKKPQDITIRIVVGLFVQILCSYVTLPLYALVTQMGTTMKPTVFNGRVFKMLKKWHHKA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            ++  + G+RSE++TP+ SRPATP HG SP+HLL ++   + +SL  +P  P   D 
Sbjct  461  QEETQHGRRSESNTPYASRPATPTHGSSPIHLLHNYNDRSVESL-PNPPSPNHHDH  515



>ref|XP_009141792.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=572

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 128/178 (72%), Gaps = 6/178 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR+ MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDITIRIVMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHNTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            ++  + G    N TP  SRP TP HGMSPVHLL ++ + + D   S  ASP  P   D
Sbjct  455  KKHTKHGHSGSN-TP--SRPTTPTHGMSPVHLLHNYHNRSLDQQTSFTASPSPPRFSD  509



>ref|XP_009358149.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=579

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 145/237 (61%), Gaps = 30/237 (13%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            ++ ERG+V+KG P+VEPGD+LFWFN P L+L+ I FVLFQNAF +AFF W+W +FGL SC
Sbjct  341  KLSERGEVVKGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGV+IQILCSYVTLPLYALVTQMGS+MKPVIF D VA+A+K WH   
Sbjct  401  FHDKLEDVVLRISMGVVIQILCSYVTLPLYALVTQMGSTMKPVIFNDRVATALKKWH---  457

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ-HNAADSLQASPR-------GPA  229
                +  + ++N++P  S   T  H MSPVHLL ++Q     +S++  PR       G  
Sbjct  458  ITAKKHIKHNKNASP-ASASGTSSHAMSPVHLLRNYQSEQDTESVRTLPRMSYFDNEGSD  516

Query  228  S-----DDQVWANSAAATSASPRR------NLSSND-------DQHEIQIVSNDFSF  112
            S     DD  W+                  NL SN         QHEIQ+ S   +F
Sbjct  517  SPFHHQDDLTWSQQGTNLQGQEEEISAHGHNLESNALGGYGSIIQHEIQVQSAKLTF  573



>ref|XP_009133345.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=584

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF +  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLLHLVLFTNAFQLAFFVWSTYEFTLKNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIA+R++MGV+IQ++CSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH+ A
Sbjct  395  FHHKTVDIALRITMGVLIQVVCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHKTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQAS  244
            +++++ G    N TP +SRPATP HGMSP+HLL    HN +   Q S
Sbjct  455  KKQSKHGTSGSN-TPHSSRPATPTHGMSPMHLLHS--HNRSLDYQTS  498



>emb|CDY15021.1| BnaCnng04240D [Brassica napus]
Length=584

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 137/191 (72%), Gaps = 16/191 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+G+++KG P+V+PGD+LFWF RP  +LF +  VLF NAFQ+AFF WS  +FG+ +CF
Sbjct  345  IQEKGEIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWSTYEFGIKNCF  404

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H++  D+ IR+S+G+I+Q LCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH  A+
Sbjct  405  HKSTVDVVIRISIGLIVQFLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWHHTAK  464

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWANS  202
            ++ + G+ SE++TPF+SRPATP H  SP+HLL +    +            S D+ +AN 
Sbjct  465  KQIKHGRTSESTTPFSSRPATPTHDSSPIHLLRNVHKRS-----------RSADESFAN-  512

Query  201  AAATSASPRRN  169
                S SPRRN
Sbjct  513  ----SLSPRRN  519



>ref|XP_011089323.1| PREDICTED: MLO-like protein 6 [Sesamum indicum]
Length=533

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 156/249 (63%), Gaps = 39/249 (16%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFNRP L+L+ I FVLFQNAFQ+A F W+W +FGL SC
Sbjct  276  RIQERGEVVKGVPVVQPGDDLFWFNRPRLILYLINFVLFQNAFQLALFAWTWYEFGLKSC  335

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  DI IR++MG++IQILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  336  FHEHVEDIVIRITMGILIQILCSYVTLPLYALVTQMGSTMKPTIFNERVAAALRNWHHTA  395

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW-A  208
            ++  ++ + S  +TP ++RP TP HG SPVHLL   + +  DS Q S     S+   W  
Sbjct  396  KKHIKQTKHSAPTTPTSTRPPTPSHGFSPVHLLRHHR-SEMDSFQTSSWKSNSNVDRWDI  454

Query  207  NSAAATSASPRRNLSS-------------------------------------NDDQHEI  139
              + +T+ S + N SS                                     +D+QHEI
Sbjct  455  EGSPSTTRSHQGNGSSPSSHHHRAEVEHEVLELQHELPGSSARVRPPLSVQVPHDEQHEI  514

Query  138  QIVSNDFSF  112
             I + DFSF
Sbjct  515  NIHNEDFSF  523



>ref|XP_009113127.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=582

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 149/239 (62%), Gaps = 29/239 (12%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+GD++KG P+V+PGD+LFWF RP  +LF I  VLF NAFQ+AFF W+  +F L +C+
Sbjct  342  IQEKGDIVKGMPLVQPGDHLFWFGRPRFILFLIHLVLFTNAFQLAFFAWTTYEFQLENCY  401

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H+   D+ IR+S+GVI+QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A+
Sbjct  402  HKTIVDVVIRISVGVIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAK  461

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQA-----SPRGPASDD-  220
            ++ + G+ S ++TPF+SRP TP HG SP+HLL +    +  + ++     SPR    D  
Sbjct  462  KQIKHGRTSGSTTPFSSRPTTPTHGSSPIHLLRNVHKRSRSADESFVNTLSPRNSDFDSW  521

Query  219  ----QVWANSAAATSASPRRNLSSND-------------------DQHEIQIVSNDFSF  112
                Q   +S++A   S  R   S                      QHEI I   DFSF
Sbjct  522  RPEPQQEPSSSSANHHSRFREEDSEKMKPSSSSLELPLGPGQIRTHQHEISISLRDFSF  580



>gb|ADW95395.1| MLO1 [Petunia x hybrida]
Length=292

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG+++KG PVVE GD+LFWFNRP+ +LF I FVLFQNAFQVAFF WSW KFG  SC
Sbjct  175  RIGERGEIVKGVPVVETGDHLFWFNRPAFVLFLINFVLFQNAFQVAFFAWSWWKFGYPSC  234

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
            FH+NAAD+AIRLSMGV IQ+LCSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH
Sbjct  235  FHKNAADLAIRLSMGVTIQVLCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWH  291



>gb|ADW95398.1| MLO1 [Solanum tuberosum]
Length=292

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP L+LF I FVLFQNAFQVAFF WSW KFG  SC
Sbjct  175  RISERGDIVKGVPVVETGDHLFWFNRPGLVLFLINFVLFQNAFQVAFFVWSWWKFGFPSC  234

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
             H+NAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH
Sbjct  235  LHQNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWH  291



>emb|CDY07075.1| BnaA04g22400D [Brassica napus]
Length=574

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 127/178 (71%), Gaps = 6/178 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  337  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IR+ MGV+IQ+LCSY+TLPLYALVTQMG+SM+P IF D VA+A+K WH  A
Sbjct  397  FHHKTEDITIRIVMGVLIQVLCSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHNTA  456

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD---SLQASPRGPASDD  220
            ++  + G    N TP  SRP TP H MSPVHLL ++ + + D   S  ASP  P   D
Sbjct  457  KKHTKHGHSGSN-TP--SRPTTPTHDMSPVHLLHNYHNRSLDQQTSFTASPSPPRFSD  511



>ref|XP_009110727.1| PREDICTED: MLO-like protein 2 [Brassica rapa]
Length=553

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 129/176 (73%), Gaps = 1/176 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAP+V+PGD+LFWF++PS MLF I  VLF NAFQ+AFF WS  +FG+ +C
Sbjct  341  RIQEKGDVVRGAPLVKPGDDLFWFDKPSFMLFLIHLVLFTNAFQLAFFAWSSYEFGISNC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IR+  G+ +QILCSYVTLPLYALVTQMG++MKP +F   V   +K WH  A
Sbjct  401  FHKEPQDITIRIVFGLFVQILCSYVTLPLYALVTQMGTTMKPTVFNGRVFKMLKKWHHKA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            ++  + G+RSE++TP+ SRP TP HG SP+HLL ++   + +S   +P  P   D 
Sbjct  461  QEETQHGRRSESNTPYASRPTTPTHGSSPIHLLHNYNDRSVESF-PNPPSPNHHDH  515



>gb|ADW95396.1| MLO1 [Solanum melongena]
Length=292

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP L+LF + FVLFQNAFQVAFF WSW KF   SC
Sbjct  175  RISERGDIVKGVPVVETGDHLFWFNRPGLVLFLVNFVLFQNAFQVAFFVWSWWKFDFPSC  234

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
            FH+NAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQMGSSMKP+IFGDNVA+A+++WH
Sbjct  235  FHKNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQMGSSMKPIIFGDNVATALRSWH  291



>ref|XP_003540745.1| PREDICTED: MLO-like protein 6-like isoform X1 [Glycine max]
Length=577

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 134/178 (75%), Gaps = 4/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+RG+VLKG P+V+PGD+LFWFNRP L+L+ I FVLFQNAFQ+AFF WS ++FG+ SC
Sbjct  338  KIQQRGEVLKGVPLVQPGDHLFWFNRPGLILYLINFVLFQNAFQLAFFAWSALQFGIKSC  397

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IR++MGV+IQILCSYVTLPLYALVTQMGS+MKP IF + VA  ++ WH+ A
Sbjct  398  FHSHTEDVVIRITMGVLIQILCSYVTLPLYALVTQMGSTMKPTIFNERVALGLRNWHQTA  457

Query  384  rqrarrgqR---SENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD  220
            ++  R+ +    S + TP +SRP TP H +SPVHL   ++ +  DS   SP+    DD
Sbjct  458  KKHIRQNRVGPLSLSGTPTSSRPTTPSHNLSPVHLFRYYR-SEIDSFPTSPQRSNLDD  514



>gb|AFM35696.1| Mlo [Vitis pseudoreticulata]
Length=545

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 143/238 (60%), Gaps = 33/238 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG V+KG P+VEPGD+LFWFNRPSLMLF   FVLF NAFQ+AFF WS   +GL SC
Sbjct  305  RIAERGVVVKGTPIVEPGDHLFWFNRPSLMLFLTNFVLFLNAFQLAFFAWS--TYGLKSC  362

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    D  IR++MGV+ Q+LCSYVTLPLYALVTQMG++M+P +F D VA A++ WH   
Sbjct  363  YHDTTEDYVIRITMGVMTQVLCSYVTLPLYALVTQMGTTMRPTVFNDKVAVALRDWH-EK  421

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  R   S+  +P +SRP+TP +GMSPVHLL  + +N  D    SP     D++ W  
Sbjct  422  ARKHTRHGHSDGVSPQSSRPSTPSYGMSPVHLLQSYDNNTPD---MSPVTSNYDNERWYG  478

Query  204  SAAAT---------------SASPRRNLSSNDD------------QHEIQIVSNDFSF  112
              + +               S  P R    +              QHE+ I S++FSF
Sbjct  479  EGSGSLGKKDDDEQRPENFESREPGRGTQDSSSAQLALGPLPIPTQHEVNITSSEFSF  536



>ref|NP_001268005.1| MLO6 protein [Vitis vinifera]
 gb|ACF25913.1| MLO-like protein 13 [Vitis vinifera]
Length=545

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 143/238 (60%), Gaps = 33/238 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG V+KG P+VEPGD+LFWFNRPSLMLF I FVLF NAFQ+AFF WS   +GL SC
Sbjct  305  RIAERGVVVKGTPIVEPGDHLFWFNRPSLMLFLINFVLFLNAFQLAFFAWS--TYGLKSC  362

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    D  IR++MGV+ Q+LCSYVTLPLYALVTQMG++M+  +F D VA A++ WH   
Sbjct  363  YHDTTEDYVIRITMGVMTQVLCSYVTLPLYALVTQMGTTMRSTVFNDKVAVALRDWH-ET  421

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  R   S+  +P +SRP+TP +GMSPVHLL  + +N  D    SP     D++ W  
Sbjct  422  ARKHTRHGHSDGVSPQSSRPSTPSYGMSPVHLLQSYDNNTPD---MSPVASNYDNERWYG  478

Query  204  SAAAT---------------SASPRRNLSSNDD------------QHEIQIVSNDFSF  112
              + +               S  P R    +              QHE+ I S++FSF
Sbjct  479  EGSGSLGKKDDDEQRPENFESREPGRGTQDSSSAQLALGPLPIQTQHEVNITSSEFSF  536



>gb|KHN00604.1| MLO-like protein 12 [Glycine soja]
Length=567

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 152/231 (66%), Gaps = 26/231 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +I +RG+V+KGAPVV PGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  334  KITDRGEVVKGAPVVVPGDDLFWFNRPGLLLFLIHLVLFQNAFQLAFFSWSTYEFSINSC  393

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IRL MGV+IQ LCSYVTLPLYALVTQMGS+MKP IF   VASA+K WH   
Sbjct  394  FHETTEDIVIRLVMGVVIQFLCSYVTLPLYALVTQMGSTMKPTIFNQRVASALKNWH---  450

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW--  211
                +  + S+++TPF+SRP+TP +GMSP+HLL       ++S Q SPR    +++ W  
Sbjct  451  NTAKKHVKNSKHTTPFSSRPSTPQYGMSPIHLLHKHLAGRSESAQTSPRTSNYENEQWDV  510

Query  210  ---------ANSAAAT---------SASPRRNLSSNDDQHEIQIVSNDFSF  112
                     A +A  T         S++P   +SS   Q +I++ S++FSF
Sbjct  511  EGSPSPSHHAVAAEETQMQVFEPGSSSAPELPISS---QLDIRVSSSEFSF  558



>gb|KJB74724.1| hypothetical protein B456_012G004100 [Gossypium raimondii]
Length=578

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 127/172 (74%), Gaps = 6/172 (3%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQ+RG V+KGAP+V PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F + SC+
Sbjct  338  IQDRGGVVKGAPLVRPGDDLFWFGRPRFLLFLIHLVLFTNAFQLAFFVWSTYEFSIRSCY  397

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H +  DI IR+SMGVI Q +CSYVTLPLYALVTQMGS+M+P IF + VA+A++ WH+ A+
Sbjct  398  HEHLEDIIIRISMGVITQFICSYVTLPLYALVTQMGSNMRPTIFNERVATALRNWHQKAK  457

Query  381  qrar--rgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGP  232
            +  +  +   S+N+TP +SRPATP H MSPVHLL    HN   S+++ P  P
Sbjct  458  KHTKQNKQSHSQNTTPLSSRPATPTHEMSPVHLL----HNYPRSVESYPPSP  505



>emb|CBI31481.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 143/238 (60%), Gaps = 33/238 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERG V+KG P+VEPGD+LFWFNRPSLMLF I FVLF NAFQ+AFF WS   +GL SC
Sbjct  305  RIAERGVVVKGTPIVEPGDHLFWFNRPSLMLFLINFVLFLNAFQLAFFAWS--TYGLKSC  362

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    D  IR++MGV+ Q+LCSYVTLPLYALVTQMG++M+  +F D VA A++ WH   
Sbjct  363  YHDTTEDYVIRITMGVMTQVLCSYVTLPLYALVTQMGTTMRSTVFNDKVAVALRDWH-DT  421

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
             ++  R   S+  +P +SRP+TP +GMSPVHLL  + +N  D    SP     D++ W  
Sbjct  422  ARKHTRHGHSDGVSPQSSRPSTPSNGMSPVHLLQSYDNNTPD---MSPVASNYDNERWYG  478

Query  204  SAAAT---------------SASPRRNLSSNDD------------QHEIQIVSNDFSF  112
              + +               S  P R    +              QHE+ I S++FSF
Sbjct  479  EGSGSLGKKDDDEQRPENFESREPGRGTQDSSSAQLALGPLPIQTQHEVNITSSEFSF  536



>ref|XP_003519926.1| PREDICTED: MLO-like protein 12-like [Glycine max]
Length=573

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 152/231 (66%), Gaps = 26/231 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +I +RG+V+KGAPVV PGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  340  KITDRGEVVKGAPVVVPGDDLFWFNRPGLLLFLIHLVLFQNAFQLAFFSWSTYEFSINSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DI IRL MGV+IQ LCSYVTLPLYALVTQMGS+MKP IF   VASA+K WH   
Sbjct  400  FHETTEDIVIRLVMGVVIQFLCSYVTLPLYALVTQMGSTMKPTIFNQRVASALKNWH---  456

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVW--  211
                +  + S+++TPF+SRP+TP +GMSP+HLL       ++S Q SPR    +++ W  
Sbjct  457  NTAKKHVKNSKHTTPFSSRPSTPQYGMSPIHLLHRHLAGRSESAQTSPRTSNYENEQWDV  516

Query  210  ---------ANSAAAT---------SASPRRNLSSNDDQHEIQIVSNDFSF  112
                     A +A  T         S++P   +SS   Q +I++ S++FSF
Sbjct  517  EGSPSPSHHAVAAEETQMQVFEPGSSSAPELPISS---QLDIRVSSSEFSF  564



>gb|KHN13370.1| MLO-like protein 12 [Glycine soja]
Length=563

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 137/198 (69%), Gaps = 6/198 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RG+V+KGAPVVEPGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  327  RITDRGEVVKGAPVVEPGDDLFWFNRPRLLLFLIHLVLFQNAFQLAFFSWSTYEFSVKSC  386

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D  IRL  GV+IQ+LCSYVTLPLYALVTQMGS+M+P IF   VASA+K WH   
Sbjct  387  FHETTEDNVIRLVTGVVIQVLCSYVTLPLYALVTQMGSTMRPTIFNQRVASALKNWH---  443

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
                +  + S+++TPF+SRP+TP +GMSP+HLL       ++S Q SPR    +++ W  
Sbjct  444  NTAKKHVKNSKHTTPFSSRPSTPQYGMSPIHLLHKHLAGRSESAQTSPRTSNYENEQW--  501

Query  204  SAAATSASPRRNLSSNDD  151
                 S SP  +  + D+
Sbjct  502  -GVEGSPSPSHHAVAADE  518



>gb|KJB67708.1| hypothetical protein B456_010G205100 [Gossypium raimondii]
Length=412

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 131/197 (66%), Gaps = 0/197 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+G V+ GAPVVEPGD  FWF+RP  +L  I  +LF NAFQ+AFF WS  +F + SC
Sbjct  182  RIQEKGGVVWGAPVVEPGDEHFWFDRPGFLLSLIHIILFTNAFQLAFFAWSTYEFTINSC  241

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H    DI IR+SMGVIIQ+LCSYVTLPLYALV  +G+ M+  IF   +A ++K WH  A
Sbjct  242  YHEKTEDIIIRISMGVIIQVLCSYVTLPLYALVNLVGTKMRSTIFDQRIADSLKNWHHTA  301

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  + G+ S+N+TPF+S+PATP HGMSPVHLL  +   + +S   S      ++  W  
Sbjct  302  KENTKHGKLSKNTTPFSSKPATPTHGMSPVHLLHGYPRKSEESGHTSLTHSNFENDRWDP  361

Query  204  SAAATSASPRRNLSSND  154
                T++S  R++   D
Sbjct  362  EDMFTNSSSHRDIDVPD  378



>gb|ADW95397.1| MLO1 [Nicotiana tabacum]
Length=292

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RGD+++G PVVE GD+LFWFNRP  +LF I FVLFQNAFQVAFF WSW KF   SC
Sbjct  175  RISKRGDIVRGVPVVETGDHLFWFNRPGFVLFLINFVLFQNAFQVAFFVWSWWKFSYPSC  234

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
            FH+NAADIAIRL+MGVIIQ+ CSYVTLPLYALVTQMG+SMKP+IFGDNVA+A+++WH
Sbjct  235  FHQNAADIAIRLTMGVIIQVHCSYVTLPLYALVTQMGTSMKPIIFGDNVATALRSWH  291



>gb|KFK35674.1| hypothetical protein AALP_AA4G022500 [Arabis alpina]
Length=576

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 149/229 (65%), Gaps = 15/229 (7%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  346  RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFKLKNC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH ++AD+ IR+ +G ++QILCSYVTLPLYALVTQMG++MKP +F + VA+A+K WH  A
Sbjct  406  FHESSADVVIRIVVGGVVQILCSYVTLPLYALVTQMGTTMKPTVFNERVATALKQWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASD-DQVW-  211
            ++  + G+ SE++TP++SRP TP HG SP+HLL ++   + +S   SP    SD    W 
Sbjct  466  KKETKHGRHSESNTPYSSRPTTPTHGSSPIHLLHNYNKRSVESFPNSPSPRHSDGHHFWD  525

Query  210  --ANSAAATSASPRRNLSSNDDQHEI-----------QIVSNDFSFVNN  103
              +    A S++    +    ++  +           Q    DFSF  N
Sbjct  526  PESQHHVAESSTHHSTVHEGSEKKPVLASVELAPIKTQTSKKDFSFKRN  574



>ref|XP_003548913.1| PREDICTED: MLO-like protein 12-like [Glycine max]
Length=576

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 136/198 (69%), Gaps = 6/198 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI +RG+V+KGAPVVEPGD+LFWFNRP L+LF I  VLFQNAFQ+AFF WS  +F + SC
Sbjct  340  RITDRGEVVKGAPVVEPGDDLFWFNRPRLLLFLIHLVLFQNAFQLAFFSWSTYEFSVKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D  IRL  GV+IQ+LCSYVTLPLYALVTQMGS+M+P IF   VASA+K WH   
Sbjct  400  FHETTEDNVIRLVTGVVIQVLCSYVTLPLYALVTQMGSTMRPTIFNQRVASALKNWH---  456

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
                +  + S+++TPF+SRP+TP +GMSP HLL       ++S Q SPR    +++ W  
Sbjct  457  NTAKKHVKNSKHTTPFSSRPSTPQYGMSPTHLLHKHLAGRSESAQTSPRTSNYENEQW--  514

Query  204  SAAATSASPRRNLSSNDD  151
                 S SP  +  + D+
Sbjct  515  -GVEGSPSPSHHAVAADE  531



>ref|NP_001288934.1| MLO-like protein 2 [Brassica rapa]
 gb|AAX77014.1| MLO1 [Brassica rapa]
Length=574

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  344  RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  404  FHESNADVIIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS----DDQ  217
            +++ + G+ SE++TP++SRP TP HG SP+HLL +F H + +S   SP    S    D Q
Sbjct  464  KKQTKHGRHSESTTPYSSRPTTPTHGSSPIHLLHNFNHRSVESFPNSPSPRYSSHHDDHQ  523

Query  216  VW  211
             W
Sbjct  524  FW  525



>ref|XP_010547373.1| PREDICTED: MLO-like protein 6 [Tarenaya hassleriana]
Length=553

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 142/217 (65%), Gaps = 15/217 (7%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KGAPVV+P D+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  341  RIQEKGDVVKGAPVVQPRDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +  D+ IRL  GVI+QILCSYVTLPLYALVTQMGS+MKP +F + VA+A+K WHR A
Sbjct  401  FHESTEDVIIRLVTGVIVQILCSYVTLPLYALVTQMGSTMKPTVFNERVAAALKNWHRTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R++ +  + S ++TPF+S P TP         + +F++    S  ASP   +SD +   +
Sbjct  461  RKQTKHSRHSNSTTPFSSWPTTP---------IGNFRNRRVASFPASPSRRSSDFEAETS  511

Query  204  SAAATSASPRRNL------SSNDDQHEIQIVSNDFSF  112
            +   + +  R ++       S   +HEI I   DFSF
Sbjct  512  THHYSDSDERPDVELPPEPESVQTRHEISINLTDFSF  548



>ref|XP_010068861.1| PREDICTED: MLO-like protein 2 [Eucalyptus grandis]
Length=560

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 140/221 (63%), Gaps = 21/221 (10%)
 Frame = -3

Query  705  VVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCFHRNAADIAIRLS  526
            + +PGD LFWF RP  +LF I FVLFQNAFQ+AFF WS  +F + +CFH    +I IR++
Sbjct  344  LFQPGDELFWFGRPRFILFLIHFVLFQNAFQLAFFAWSTWQFKVQNCFHYKPEEIIIRIA  403

Query  525  MGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraarqrarrgqRSENS  346
            MGVIIQILCSYVTLPLYALVTQMGS+MKP IF D VA+A++ WH  AR+  R  Q S N 
Sbjct  404  MGVIIQILCSYVTLPLYALVTQMGSTMKPTIFHDRVATALRHWHHGARRHVRHSQHSNNP  463

Query  345  TPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWA--------------  208
            TP  + PATP HG SP+HLL  +Q  + DS   SPR    +++ WA              
Sbjct  464  TPSGTAPATPEHGSSPIHLLHHYQQRSLDSPVTSPRKSDGENEQWAVIGLQSPQNQGIDS  523

Query  207  ---NSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVNNKHN  94
               ++     ++ + N +SN  QHEI I  +DFSF   KH+
Sbjct  524  RHLDTTGQEGSTQQPNSTSN--QHEIDITLSDFSF--QKHS  560



>ref|XP_010476039.1| PREDICTED: MLO-like protein 2 isoform X1 [Camelina sativa]
Length=576

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 6/184 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  344  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  404  FHESNADVVIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP------RGPASD  223
            + + + G+ SE++TPF+SRP TP HG SP+HLL +F + + +S  ASP       G   +
Sbjct  464  KDQTKHGRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPSPRYSGHGHHHE  523

Query  222  DQVW  211
             Q W
Sbjct  524  HQFW  527



>ref|XP_010476040.1| PREDICTED: MLO-like protein 2 isoform X2 [Camelina sativa]
Length=573

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 6/184 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  341  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  401  FHESNADVVIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP------RGPASD  223
            + + + G+ SE++TPF+SRP TP HG SP+HLL +F + + +S  ASP       G   +
Sbjct  461  KDQTKHGRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPSPRYSGHGHHHE  520

Query  222  DQVW  211
             Q W
Sbjct  521  HQFW  524



>emb|CDY07665.1| BnaA03g18460D [Brassica napus]
Length=521

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  281  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  340

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ++CSY+TLPLYALVTQMGSSM+P IF D VA+A+K WH  A
Sbjct  341  FHHKTEDIAIRITMGVLIQVVCSYITLPLYALVTQMGSSMRPTIFNDRVANALKKWHNTA  400

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQH--NAADSLQASPRGPASDD  220
            +++A+ G    N TP +SRP TP H  S  HLL +     +   S  ASP  P   D
Sbjct  401  KKQAKHGNSGSN-TPRSSRPTTPKHNRSLDHLLHNRNRSLDHQTSFTASPSPPRLSD  456



>emb|CDY14401.1| BnaC03g21940D [Brassica napus]
Length=524

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  284  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  343

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ++CSY+TLPLYALVTQMGSSM+P IF D VA+A+K WH  A
Sbjct  344  FHHKTEDIAIRITMGVLIQVVCSYITLPLYALVTQMGSSMRPTIFNDRVANALKKWHNTA  403

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQH--NAADSLQASPRGPASDD  220
            +++A+ G    N TP +SRP TP H  S  HLL +     +   S  ASP  P   D
Sbjct  404  KKQAKHGNSGSN-TPRSSRPTTPKHNRSLDHLLHNRNRSLDHQTSFTASPSPPRLSD  459



>ref|XP_010430163.1| PREDICTED: MLO-like protein 6 isoform X2 [Camelina sativa]
Length=633

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 130/192 (68%), Gaps = 15/192 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS V       
Sbjct  381  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTVSKQNCIL  440

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
               N  D+ IR+S+G+I+QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  441  HKLNNVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  500

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +++ + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S          DD     
Sbjct  501  KKQMKHGRSSESTTPFSSRPTTPTHGSSPIHLLRNVPHKRSRSF---------DD-----  546

Query  204  SAAATSASPRRN  169
               A S SPRRN
Sbjct  547  -GFANSMSPRRN  557



>ref|NP_001185282.1| MLO-like protein 6 [Arabidopsis thaliana]
 gb|AEE33853.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=521

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 144/241 (60%), Gaps = 30/241 (12%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV+KG P+V+PGD+ FWF RP  +LF I  VLF NAFQ+AFF WS V       
Sbjct  279  RIQEKGDVVKGTPLVQPGDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTVSKQSCIL  338

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
                  D+ IR+S+G+++QILCSYVTLPLYALVTQMGS MKP +F + VA+A+K+WH  A
Sbjct  339  HELETVDVIIRISIGLLVQILCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTA  398

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQA------SPRGPASD  223
            ++  + G+ SE++TPF+SRP TP HG SP+HLL +  H  + S+        SPR    D
Sbjct  399  KKNIKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNAPHKRSRSVDESFANSFSPRNSDFD  458

Query  222  --DQVWANSAAATSASPRRNLSSNDD---------------------QHEIQIVS-NDFS  115
              D    +  A TS S  R+    ++                     QHEI  +S  DFS
Sbjct  459  SWDPESQHETAETSNSNHRSRFGEEESEKKFVSSSVELPPGPGQIRTQHEISTISLRDFS  518

Query  114  F  112
            F
Sbjct  519  F  519



>ref|XP_010032207.1| PREDICTED: MLO-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW51610.1| hypothetical protein EUGRSUZ_J01100 [Eucalyptus grandis]
Length=545

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+++KG PVV+PGD LFWF RP L+L  I FVLFQNAFQ+AFF W    FGL +C
Sbjct  329  RIQERGNIVKGIPVVQPGDELFWFGRPRLLLLLIHFVLFQNAFQLAFFAWGTYSFGLKNC  388

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH   ADI  R+SMGV IQ+LCSYVTLPLYALVTQMGS+MKP IF D+VA+AIK WH  A
Sbjct  389  FHERTADIIFRVSMGVFIQVLCSYVTLPLYALVTQMGSTMKPTIFNDHVATAIKHWHTTA  448

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQ  250
            ++  ++   S    PF+SRPAT      P HLL  + H + +SL 
Sbjct  449  KKHTKQSHHSNADPPFSSRPAT------PAHLLQTYNHRSEESLH  487



>ref|XP_009133347.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=575

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++GDV+KGAPVVEPGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  335  RIQDKGDVVKGAPVVEPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNC  394

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    DIAIR++MGV+IQ++CSY+TLPLYALVTQMGSSM+P IF D VA+A+K WH  A
Sbjct  395  FHHKTEDIAIRITMGVLIQVVCSYITLPLYALVTQMGSSMRPTIFNDRVANALKKWHNTA  454

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQH--NAADSLQASPRGPASDD  220
            +++A+ G    N TP +SRP TP H  S  HLL +     +   S  ASP  P   D
Sbjct  455  KKQAKHGNSGSN-TPRSSRPTTPKHNRSLDHLLHNRNRSLDHQTSFTASPSPPRLSD  510



>ref|XP_010032208.1| PREDICTED: MLO-like protein 2 isoform X2 [Eucalyptus grandis]
Length=534

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+++KG PVV+PGD LFWF RP L+L  I FVLFQNAFQ+AFF W    FGL +C
Sbjct  329  RIQERGNIVKGIPVVQPGDELFWFGRPRLLLLLIHFVLFQNAFQLAFFAWGTYSFGLKNC  388

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH   ADI  R+SMGV IQ+LCSYVTLPLYALVTQMGS+MKP IF D+VA+AIK WH  A
Sbjct  389  FHERTADIIFRVSMGVFIQVLCSYVTLPLYALVTQMGSTMKPTIFNDHVATAIKHWHTTA  448

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQ  250
            ++  ++   S    PF+SRPAT      P HLL  + H + +SL 
Sbjct  449  KKHTKQSHHSNADPPFSSRPAT------PAHLLQTYNHRSEESLH  487



>ref|XP_010476041.1| PREDICTED: MLO-like protein 2 isoform X3 [Camelina sativa]
Length=568

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 6/184 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  336  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  395

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  396  FHESNADVVIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  455

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASP------RGPASD  223
            + + + G+ SE++TPF+SRP TP HG SP+HLL +F + + +S  ASP       G   +
Sbjct  456  KDQTKHGRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPSPRYSGHGHHHE  515

Query  222  DQVW  211
             Q W
Sbjct  516  HQFW  519



>gb|KCW65389.1| hypothetical protein EUGRSUZ_G02819 [Eucalyptus grandis]
Length=358

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 136/218 (62%), Gaps = 23/218 (11%)
 Frame = -3

Query  714  GAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCFHRNAADIAI  535
            G P+V+PGD LFWF RP  +LF I F    NAFQ+AFF WS  +F + +CFH    +I I
Sbjct  143  GTPLVQPGDELFWFGRPRFILFLIHF----NAFQLAFFAWSTWQFKVQNCFHYKPEEIII  198

Query  534  RLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraarqrarrgqRS  355
            R++MGVIIQILCSYVTLPLYALVTQMGS+MKP IF D VA+A++ WH  AR+  R  Q S
Sbjct  199  RIAMGVIIQILCSYVTLPLYALVTQMGSTMKPTIFHDRVATALRHWHHGARRHVRHSQHS  258

Query  354  ENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWA-----------  208
             N TP  + PATP HG SP+HLL  +Q  + DS   SPR    +++ WA           
Sbjct  259  NNPTPSGTAPATPEHGSSPIHLLHHYQQRSLDSPVTSPRKSDGENEQWAVIGLQSPQNQG  318

Query  207  ------NSAAATSASPRRNLSSNDDQHEIQIVSNDFSF  112
                  ++     ++ + N +SN  QHEI I  +DFSF
Sbjct  319  IDSRHLDTTGQEGSTQQPNSTSN--QHEIDITLSDFSF  354



>emb|CDX97946.1| BnaA06g06970D [Brassica napus]
Length=543

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 151/229 (66%), Gaps = 21/229 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  316  RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLRNC  375

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F+ N AD+ IR+ +GV++QILCSYVTLPLYALVTQMGS+M+P +F + VA+AIKTWH  A
Sbjct  376  FYENDADVVIRIVVGVVVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTA  435

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSL--QASPRGPASDD--Q  217
            ++  + G+ +E++TP+TSRP TP HG SP+H+L++    + ++L    SPR     D  Q
Sbjct  436  KKHTKHGKHTESNTPYTSRPTTPTHGSSPLHILNN---RSVETLPSSTSPRYSDHHDHHQ  492

Query  216  VWANSAAATSASPRRNLSSNDDQHEIQIV--------------SNDFSF  112
             W   +    A P  + S   +  E Q V              S DFSF
Sbjct  493  FWDPESQYQEAGPSTHHSLAHESSEKQPVLGSVELPPIRTTKSSRDFSF  541



>ref|XP_010458517.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=575

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 147/216 (68%), Gaps = 7/216 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  344  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  404  FHESNADVVIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  463

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS-----DD  220
            + + + G+ S ++TPF+SRP TP HG SP+HLL +F + + +S  ASP    S     + 
Sbjct  464  KDQTKHGRHSGSNTPFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPSPRYSGHGHHEH  523

Query  219  QVWANSAAATSA--SPRRNLSSNDDQHEIQIVSNDF  118
            Q W   +    A  S R +LS    + +  + S + 
Sbjct  524  QFWDPESQHQEAETSTRHSLSHESSEKKPALTSVEL  559



>ref|XP_009148458.1| PREDICTED: MLO-like protein 2 [Brassica rapa]
Length=572

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 151/229 (66%), Gaps = 21/229 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  345  RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLRNC  404

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F+ N AD+ IR+ +GV++QILCSYVTLPLYALVTQMGS+M+P +F + VA+AIKTWH  A
Sbjct  405  FYENDADVVIRIVVGVVVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTA  464

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSL--QASPRGPASDD--Q  217
            ++  + G+ +E++TP+TSRP TP HG SP+H+L++    + ++L    SPR     D  Q
Sbjct  465  KKHTKHGKHTESNTPYTSRPTTPTHGSSPLHILNN---RSVETLPSSTSPRYSDHHDHHQ  521

Query  216  VWANSAAATSASPRRNLSSNDDQHEIQIV--------------SNDFSF  112
             W   +    A P  + S   +  E Q V              S DFSF
Sbjct  522  FWDPESQYQEAGPSTHHSLAHESSEKQPVLGSVELPPIRTTKSSRDFSF  570



>ref|XP_010492667.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=577

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 147/216 (68%), Gaps = 7/216 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF +P  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  346  RIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH + AD+ IR+ +GV++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A
Sbjct  406  FHESNADVVIRIVVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTA  465

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS-----DD  220
            + + + G+ S ++TPF+SRP TP HG SP+HLL +F + + +S  ASP    S     + 
Sbjct  466  KDQTKHGRHSGSNTPFSSRPTTPTHGSSPIHLLHNFNNRSVESYPASPSPRYSGHGHHEH  525

Query  219  QVWANSAAATSA--SPRRNLSSNDDQHEIQIVSNDF  118
            Q W   +    A  S R +LS    + +  + S + 
Sbjct  526  QFWDPESQHQEAETSTRHSLSHERSEKKPALTSVEL  561



>ref|XP_009395303.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=584

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGDV+KG PVV P D+LFWF RP LML+ I FVLFQNAFQ+AF  WSW +FG  SC
Sbjct  319  RIMERGDVIKGVPVVHPTDDLFWFRRPRLMLYLIHFVLFQNAFQLAFLAWSWYEFGFPSC  378

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI +RLSMG++IQ+LCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH+ A
Sbjct  379  FHKRVEDIIVRLSMGLLIQVLCSYVTLPLYALVTQMGSNMKPTIFNERVATALRKWHQTA  438

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASP  241
            R+  R  ++S + TP  TSR  TP +  + V+ L   QH  +D L++ P
Sbjct  439  RKNLRENRKSGSVTPLSTSRSTTPKNSFAQVYRL---QHLPSD-LESQP  483



>ref|XP_004487134.1| PREDICTED: MLO-like protein 6-like [Cicer arietinum]
Length=590

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 148/225 (66%), Gaps = 11/225 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++G V+KG PVV+PGD+LFWF++P L+L  I FVLFQNAFQ+AFF W+ ++FGL SC
Sbjct  337  RIQKQGMVVKGEPVVQPGDDLFWFSKPRLILHLINFVLFQNAFQLAFFSWTALQFGLTSC  396

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F+    D+ IR+SMGV +QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  397  FNSRTEDVVIRISMGVFVQILCSYVTLPLYALVTQMGSTMKPAIFNERVATALRNWHNTA  456

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ + S   +P ++R  TP H MSP H+L  + H+  D+   +   P   +    N
Sbjct  457  KKHIKQNRGSGFQSPMSTRSITPAHSMSPAHILRPY-HSETDTHPTT--SPTRLNFETYN  513

Query  204  SAAATSASP------RRNLSSNDDQHEIQI--VSNDFSFVNNKHN  94
               A S SP      R   SS+   HE+++  +++D     NK N
Sbjct  514  PYEAYSPSPSNKVEARATSSSSIYFHEMEMGHLAHDHEQETNKPN  558



>gb|KHN21533.1| MLO-like protein 6 [Glycine soja]
Length=209

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 132/212 (62%), Gaps = 10/212 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KG P+V+PGD+LFWFN+P L+L+ I FVLFQNAFQ+AFF W+ ++F + SC
Sbjct  4    RIQQRGEVVKGVPLVQPGDDLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSC  63

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ IR+SMG+ +Q LCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH  A
Sbjct  64   FHSQKQDVVIRISMGIFVQFLCSYVTLPLYALVTQMGSTMKPTIFNERVARALRKWHHTA  123

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  +          R  TP H  S  + L  + H+   +  +SP     D  +   
Sbjct  124  KRNVKHNR--------GLRLQTPNHTKSNANFLRRY-HSEMATYPSSPIRFDLDAHLPCE  174

Query  204  SAAATSASPRRNLSSNDDQHEIQIV-SNDFSF  112
              A +S+   R +      HEI I    DFSF
Sbjct  175  VNATSSSIHHRQMEMGHQAHEIDIERGKDFSF  206



>ref|XP_007150219.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
 gb|ESW22213.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
Length=551

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 137/234 (59%), Gaps = 26/234 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG P+V+PGD+LFWFN+P L+L+ + FVLFQNAFQ+A+F W+ V+FG+ SC
Sbjct  324  RIQERGEVVKGMPLVQPGDDLFWFNKPRLILYLVNFVLFQNAFQLAYFSWTAVQFGMKSC  383

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ I++SMGV +Q LCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH   
Sbjct  384  FHSQTEDVVIKISMGVFVQFLCSYVTLPLYALVTQMGSTMKPTIFNERVAMALRNWH---  440

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLL-----------SDFQHNAADSLQASPR  238
               A +    + +    SRP TP H  S  HLL           +D + +    +  SP 
Sbjct  441  --HAAKKHVKQQNRRLQSRPTTPNHSTSQAHLLRRCHSEIDIYPTDSEAHHPYEMDLSPS  498

Query  237  GPASDDQVWANSAAATSASPRRNLS--------SNDDQHEIQIV-SNDFSFVNN  103
                D +V           P  +++        S   QHEI I    +FSF N 
Sbjct  499  SKVHDHEV-EMEMGHLDHGPLEDVNELNSALAGSGVTQHEINIEHGKEFSFDNR  551



>ref|XP_008806842.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=611

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +I ERGDV+KG PVV P D+LFWF  P LML+ I FVLFQNAFQ+AFF WSW +FG  SC
Sbjct  340  QIMERGDVVKGVPVVHPTDDLFWFKCPRLMLYLIHFVLFQNAFQLAFFAWSWYEFGFPSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI +R S GV+IQ+LCSYVTLPLYALVTQMGS+M+P IF + VA+A++ WH  A
Sbjct  400  FHQRVEDIVVRFSTGVLIQVLCSYVTLPLYALVTQMGSNMRPTIFSERVATALRKWHHTA  459

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQAS  244
            R+  +  ++S + TP  TS PATP  G S  +LL   Q+   DS Q S
Sbjct  460  RKHLKENRQSGSLTPLSTSMPATPTSGSSQTNLLRHLQN--LDSFQDS  505



>ref|XP_010934812.1| PREDICTED: MLO-like protein 2, partial [Elaeis guineensis]
Length=574

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 120/190 (63%), Gaps = 3/190 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +I ERGDV+KG PVV P D+LFWF  P  ML+ I FVLFQNAFQ+AFF WSW +FG  SC
Sbjct  339  QITERGDVVKGVPVVHPTDDLFWFKCPRFMLYLIHFVLFQNAFQLAFFAWSWYEFGFPSC  398

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   DI IR SMGV+IQ+LCSYVTLPLYALVTQMGS+M+P IF D VA+A++ WH  A
Sbjct  399  FHQRVDDIIIRFSMGVLIQVLCSYVTLPLYALVTQMGSNMRPTIFSDRVATALRKWHHTA  458

Query  384  rqrarrgqRSENSTPF-TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWA  208
            R   +   +   +TP  TS P TP  G S   LL   Q    DS Q  P      D    
Sbjct  459  RNHLKENTQFGRTTPLSTSTPNTPTSGSSRAKLLRHLQ--KLDSFQGMPSRVRLTDADIQ  516

Query  207  NSAAATSASP  178
              AA    +P
Sbjct  517  QHAARKRPTP  526



>emb|CDY19353.1| BnaC05g08620D [Brassica napus]
Length=543

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 138/193 (72%), Gaps = 7/193 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE+GDV++GAPVV+PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +C
Sbjct  316  RIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLRNC  375

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F+ N AD+ IR+ +GV++QILCSYVTLPLYALVTQMGS+M+P +F + VA+AIKTWH  A
Sbjct  376  FYENDADVIIRIVVGVVVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTA  435

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASD----DQ  217
            ++  + G+ +E++TP+TSRP TP HG S +H L++    + ++  +SP    SD     Q
Sbjct  436  KKHTKHGKHTESNTPYTSRPTTPTHGSSTMHTLNN---RSVETFPSSPSPRYSDHHDHHQ  492

Query  216  VWANSAAATSASP  178
             W   +    A P
Sbjct  493  FWDPESQQQEAGP  505



>ref|XP_011469670.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Fragaria 
vesca subsp. vesca]
Length=562

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 134/202 (66%), Gaps = 12/202 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG V+ GAP+V+PGD  FWF RP  +LF I F LFQNAFQ+AFF WS  +FG+ SC
Sbjct  327  RIQDRGGVVMGAPLVQPGDQHFWFGRPRFLLFLIHFALFQNAFQLAFFAWSTWQFGITSC  386

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   D AIRLS+GVI+Q+LCSYVTLPLYALVTQMGS+MKP  F + VA A+K WH   
Sbjct  387  FHQTPQDTAIRLSVGVIVQVLCSYVTLPLYALVTQMGSNMKPNSFEEGVAEAVKNWHHKT  446

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNA----ADSLQASPRGPASDD-  220
            +++A+  Q SE +TPF    +TP HG SP+HLL +  + +     D L   P      D 
Sbjct  447  KKKAKHSQHSERTTPF----STPPHGTSPIHLLQNANNRSEVTDGDDLFPPPDASVVVDM  502

Query  219  QVWANSAAATSASPRRNLSSND  154
            Q W       S SP+ N+ S++
Sbjct  503  QHWDTEG---SRSPKNNVGSSE  521



>ref|XP_009342698.1| PREDICTED: MLO-like protein 6 isoform X2 [Pyrus x bretschneideri]
Length=566

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 143/241 (59%), Gaps = 43/241 (18%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            ++ ERG+V++G P+VEPGD+LFWFN P L+L+ I FVLFQ             +FGL SC
Sbjct  341  QLSERGEVVRGTPLVEPGDHLFWFNNPRLLLYIIHFVLFQ------------YEFGLKSC  388

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ +R+SMGVIIQILCSYVTLPLYALVTQMGS+MKP+IF D VA+A+K WH   
Sbjct  389  FHEKLEDVVLRISMGVIIQILCSYVTLPLYALVTQMGSTMKPIIFNDRVATALKKWH---  445

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNA-ADSLQASPR-------GPA  229
               A++  + +N++P  S P TPLH MSPVHLL ++++    DS++ SPR       G  
Sbjct  446  -ITAKKHLKHKNASP-ASAPGTPLHSMSPVHLLHNYRYEQDIDSIRTSPRISYFDNEGSD  503

Query  228  S-----DDQVWANSAAATSASPRR------NLSSND-------DQHEIQIVSNDFSFVNN  103
            S     D+  W+          +       N  SN         QHEIQI S   +F  +
Sbjct  504  SPFHHQDNLTWSQQGTNMEGQKKEISAHGPNSESNALGAYGSIIQHEIQIHSAALTFEKS  563

Query  102  K  100
            +
Sbjct  564  E  564



>ref|XP_007151753.1| hypothetical protein PHAVU_004G071800g [Phaseolus vulgaris]
 gb|ESW23747.1| hypothetical protein PHAVU_004G071800g [Phaseolus vulgaris]
Length=539

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG V+ GAPVVEPGD+LFWFNRP L+LF I  VLFQNAFQ+A F WS  +F + SC
Sbjct  333  RIQDRGVVM-GAPVVEPGDDLFWFNRPRLLLFIIHLVLFQNAFQLAHFAWSTYEFSIESC  391

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+  A+  +RL+MGV+ Q+LCSYVTLPLYALVTQMGS++KP IF D VA+A+K WH  +
Sbjct  392  FHKTNAENVVRLTMGVVTQVLCSYVTLPLYALVTQMGSTLKPTIFNDRVAAALKKWHHTS  451

Query  384  rqrarrgqRSE--NSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            ++  +  Q SE   S PF+S  ++P+ GMSP+HLL       +DS Q SPR    ++Q
Sbjct  452  KKHLKHSQHSEAKKSIPFSSTSSSPIFGMSPIHLLHRHPVGRSDSAQTSPRTSLYENQ  509



>gb|KHN25050.1| MLO-like protein 6 [Glycine soja]
Length=472

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KG P+V+PGD+LFWFN+P L+L+ I FVLFQNAFQ+AFF W+ ++F + SC
Sbjct  237  RIQQRGEVVKGVPLVQPGDDLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSC  296

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH     + IR+SMG+ +Q LCSYVTLPLYALVTQMGS+MKP IF   VA+A++ WH  A
Sbjct  297  FHSQKQGVVIRISMGIFVQFLCSYVTLPLYALVTQMGSTMKPTIFNKRVATALRKWHHTA  356

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAA  262
            ++  ++ +     TP ++RP TP H  S V+ L  +    A
Sbjct  357  KKNVKQNRGLRLQTPSSTRPTTPNHPKSQVNFLRRYHSEMA  397



>ref|XP_003597192.1| MLO-like protein [Medicago truncatula]
 gb|ABD33062.1| Mlo-related protein [Medicago truncatula]
 gb|AES67443.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=593

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 136/204 (67%), Gaps = 13/204 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ++G V+KG PVV+P D+LFWFN+P L+LF I FVLFQNAFQ+AFF W+ ++FG+ SC
Sbjct  341  RIQKQGMVVKGEPVVQPRDDLFWFNKPRLILFLINFVLFQNAFQLAFFSWTALQFGVTSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            ++     + IR+ MGV +QILCSYVTLPLYALVTQMGS+MKP IF + VA+A++ WH  A
Sbjct  401  YNSRKDGVVIRICMGVFVQILCSYVTLPLYALVTQMGSTMKPTIFNERVATALRNWHHTA  460

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            R+  +  + S + TPF+SR  TP   MSP  +L  ++ N  D+       P   +   ++
Sbjct  461  RKNIKHNRGSGSQTPFSSRSITPARSMSPAQILRHYR-NQMDT-------PTRLNFETSH  512

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
               + S SP     SN   H+++I
Sbjct  513  HYESYSPSP-----SNSHHHKVEI  531



>ref|XP_009333712.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=559

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 138/229 (60%), Gaps = 18/229 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQE G V+KGAP+V+P D+LFWF  P  ML+ + FV+FQNAFQ+AFF WS  +FG+ SC
Sbjct  327  RIQESGHVVKGAPLVQPSDHLFWFGSPHFMLYLLHFVVFQNAFQMAFFAWSTYEFGITSC  386

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FHR+  DI +RLS GVI+Q+LCSYVTLPLYALVTQMGS+MKP +F   VA+A+K WH  A
Sbjct  387  FHRSTEDIVVRLSFGVIVQVLCSYVTLPLYALVTQMGSTMKPTVFNKGVAAALKDWHHKA  446

Query  384  rqrarrgqRSENSTP------FTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR---GP  232
            ++  +  + S ++TP      +  R       +SP     +  H   +    SP    GP
Sbjct  447  KKNTKHSRHSPSTTPVHLLHNYNYRSNDDEFYVSPSRANLEMGHWGTEGSSHSPNNNVGP  506

Query  231  ASDDQVWA-------NSAAATSASPRRNL--SSNDDQHEIQIVSNDFSF  112
            +  D++         +    ++  PR  L       QHE+ I S+DFSF
Sbjct  507  SDGDEIRQMTNVRDLDQEPGSTELPRSPLPVRRTQSQHEVAISSSDFSF  555



>ref|XP_010492678.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=568

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 132/201 (66%), Gaps = 2/201 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            R Q++ D+++GAPVV+PGD+LFWFN P   LF I  VLF NAFQ+AFF WS  +FGL +C
Sbjct  344  RTQQKDDMVRGAPVVQPGDDLFWFNNPRFFLFLIHLVLFTNAFQLAFFAWSTFEFGLKNC  403

Query  564  FHRNAA-DIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHra  388
            FH  +  ++ IRL +G  +QILCSYVTLPLYALVT MGS +KP +F + VA+A++ WH  
Sbjct  404  FHDESIPNVVIRLLVGAFVQILCSYVTLPLYALVTHMGSQLKPTVFNEEVATALEKWHHT  463

Query  387  arqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS-DDQVW  211
            A+ + + G+ SE++TPF SRPATPLH  S  HLL +    +  S  +S     S D +  
Sbjct  464  AKDQTKHGKHSESNTPFASRPATPLHESSSSHLLHNVNKQSVGSHPSSQEHDHSWDPESQ  523

Query  210  ANSAAATSASPRRNLSSNDDQ  148
               A  ++ +P  + SS   +
Sbjct  524  HQEAETSTHNPLAHESSEKKK  544



>ref|XP_003539406.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=575

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 134/204 (66%), Gaps = 10/204 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KG P+V+PGD+LFWFN+P L+L+ I FVLFQNAFQ+AFF W+ ++F + SC
Sbjct  340  RIQQRGEVVKGVPLVQPGDDLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSC  399

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH     + IR+SMG+ +Q LCSYVTLPLYALVTQMGS+MKP IF   VA+A++ WH  A
Sbjct  400  FHSQKQGVVIRISMGIFVQFLCSYVTLPLYALVTQMGSTMKPTIFNKRVATALRKWHHTA  459

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  ++ +     TP ++RP TP H  S V+ L  +    A      P  P   D   AN
Sbjct  460  KKNVKQNRGLRLQTPSSTRPTTPNHPKSQVNFLRRYHSEMA----PYPSSPIRFD-FEAN  514

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
             +   +A+     SS+   HE+++
Sbjct  515  LSYEVNAT-----SSSIHHHEMEM  533



>ref|XP_010107562.1| MLO-like protein 12 [Morus notabilis]
 gb|EXC16244.1| MLO-like protein 12 [Morus notabilis]
Length=696

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 138/216 (64%), Gaps = 19/216 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG P+V+PGD+LFWF +P L+L+ I FVLFQNAFQ+AF  W+  +FG+ SC
Sbjct  487  RIQERGEVVKGTPLVQPGDDLFWFKQPRLILYLINFVLFQNAFQLAFLAWTLYEFGIKSC  546

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N+ D+ IR+SMG        Y+TLPL+ALVTQMGS++KP IF D VA+A++ WH  A
Sbjct  547  FHENSEDVIIRISMG--------YMTLPLHALVTQMGSNIKPTIFNDRVANALRKWHHTA  598

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD---QV  214
            R++ R+ +++ +S      P+TP   MSPVHLL  +      S   SPR    +D   Q 
Sbjct  599  RKQVRQTRQTASS------PSTPRKSMSPVHLLHRYNSELGMSTLTSPRMSNFNDDNAQH  652

Query  213  WANSAAATSASPR--RNLSSNDDQHEIQIVSNDFSF  112
             +     T   PR   N   +  QHEI I S DFSF
Sbjct  653  GSRQDEETIHEPRSVHNPVGHQVQHEINIQSVDFSF  688



>ref|XP_011013684.1| PREDICTED: MLO-like protein 12 [Populus euphratica]
Length=478

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ    V++G PVV+PGD+LFWFN P L+L+ I FVLFQNAFQ AF  W+W +FGL SC
Sbjct  311  RIQG-TQVVQGTPVVQPGDDLFWFNHPRLLLYLINFVLFQNAFQFAFLAWTWYEFGLKSC  369

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   D+ +R++M  IIQ  CSYVTLPLYALVTQMG++M+P IF + +A A++ WH  A
Sbjct  370  FHKYPEDLILRITMWAIIQFFCSYVTLPLYALVTQMGTTMRPTIFNERLAKALRNWHHTA  429

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR  238
            +Q  ++ + S   TP TS P TP H +SPVH L D++   +  +QAS R
Sbjct  430  KQHVKQNRHSGTVTPATSAPGTPSHTISPVHPLHDYR-GESGGIQASLR  477



>ref|XP_011004622.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=478

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ    V++G PVV+PGD+LFWFN P L+L+ I FVLFQNAFQ AF  W+W +FGL SC
Sbjct  311  RIQG-TQVVQGTPVVQPGDDLFWFNHPRLLLYLINFVLFQNAFQFAFLAWTWYEFGLKSC  369

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+   D+ +R++M  IIQ  CSYVTLPLYALVTQMG++M+P IF + +A A++ WH  A
Sbjct  370  FHKYPEDLILRITMWAIIQFFCSYVTLPLYALVTQMGTTMRPTIFNERLAKALRNWHHTA  429

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPR  238
            +Q  ++ + S   TP TS P TP H +SPVH L D++   +  +QAS R
Sbjct  430  KQHVKQNRHSGTVTPATSAPGTPSHTISPVHPLHDYR-GESGGIQASLR  477



>gb|KDP36763.1| hypothetical protein JCGZ_08054 [Jatropha curcas]
Length=502

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 139/224 (62%), Gaps = 11/224 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ R  V++GAPVVEP +  FWFNRP  +LF + + LFQNAFQ+AFF W+W +FGL SC
Sbjct  278  EIQARTTVVRGAPVVEPNNKYFWFNRPQWILFLLHYTLFQNAFQMAFFLWTWYEFGLKSC  337

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N A I +R+ +GV +QI+CSY+T PLYALVTQMGS MK  IF +  A A++ W +AA
Sbjct  338  FHENLAAILVRVGLGVALQIVCSYITFPLYALVTQMGSHMKQSIFEEQTAKALRKWQKAA  397

Query  384  rqrarrgqRSE----NSTP-FTSRPATPLHGMSPVHLLSDFQHNAA----DSLQASPRGP  232
            +QR +  +       NS+P F S   TP  G SP+HLL   ++ ++    +S+ +SP+  
Sbjct  398  KQRKKARKAGTCGGGNSSPGFMSGETTPSQGASPIHLLHGHKYRSSQRDVESVISSPKSY  457

Query  231  ASDDQVWANSAAATSASPRRNLSSNDDQ--HEIQIVSNDFSFVN  106
             SD      S    S+   R     +DQ  ++ +  +NDFSFV 
Sbjct  458  RSDTDFSELSETEGSSHHGRESRKQEDQGKNDQEPQTNDFSFVR  501



>ref|XP_011074078.1| PREDICTED: MLO protein homolog 1-like [Sesamum indicum]
Length=565

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 137/228 (60%), Gaps = 22/228 (10%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+R  V++GAP+VEP +N FWFNRP  +LF I F LFQNA+Q+A+F W W +FG+ +C
Sbjct  343  QIQDRATVVRGAPLVEPTNNFFWFNRPQWILFLIHFTLFQNAYQMAYFLWKWYEFGITTC  402

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH     I IR+ +GV +QILCSY+T PLY LV +MGS MK  IF +  A A+K WH+AA
Sbjct  403  FHEKLFAIMIRVWLGVALQILCSYITFPLYTLVGKMGSHMKKSIFEEQTAKALKKWHQAA  462

Query  384  rqrarrgqRSENS----TPFTSRPATPLHGMSPVHLLSDFQHNAA----DSLQASPRGPA  229
            +QR +  +    +      F S   TP  G SP+HLL  ++H ++    DSL  SPR  A
Sbjct  463  KQRKKMRKAGGGTDTSNAGFMSGETTPTQGSSPLHLLHKYKHRSSAPDTDSLPPSPRSYA  522

Query  228  SDDQVWANSAAATSASPRRNLS------SNDDQHEIQIVSNDFSFVNN  103
            SD ++   S    S   +R  +       +D+ H I     DFSFV +
Sbjct  523  SDTEL---SELDASNHGKRETTFDASQLKDDESHNI-----DFSFVKS  562



>gb|EYU39586.1| hypothetical protein MIMGU_mgv1a020874mg [Erythranthe guttata]
Length=400

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 140/232 (60%), Gaps = 33/232 (14%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI E GDV+KG PVV+PGD+LFWFN P L+LF I FVLF              +FG  SC
Sbjct  170  RILEGGDVIKGTPVVQPGDDLFWFNSPRLLLFLIHFVLFG------------YEFGYPSC  217

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            +H+   D+ IR++MGV+IQ LCSY+TLPLYALVTQMGS MKPVIF + VASA++ WH AA
Sbjct  218  YHQTLEDVIIRIAMGVVIQFLCSYMTLPLYALVTQMGSKMKPVIFSEQVASALRGWHHAA  277

Query  384  rqrarrgqRSENSTPFTSRPATPLHG-MSPVHLLSDFQHNAADSLQ-ASPRGPASDDQVW  211
            ++  + G++S N+TPF+SRP +PLHG  SP++LL  +Q +++   +  +     +     
Sbjct  278  KKNVKEGRQSANTTPFSSRPTSPLHGSTSPLYLLQGYQPSSSSPKRLLNSTNELTTTTGG  337

Query  210  ANSAAATSASPRRNLSSND-------------------DQHEIQIVSNDFSF  112
                 + SASPR +   +D                    QH + I  +DFSF
Sbjct  338  GGGETSPSASPRHHQDVDDFNVNGNTYSGEIVMDVEDSPQHAVNISLSDFSF  389



>emb|CDY66806.1| BnaC08g49800D, partial [Brassica napus]
Length=250

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  696  PGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCFHRNAADIAIRLSMGV  517
            PGD+LFWF RP  +LF I  VLF NAFQ+AFF WS  +F L +CFH + AD+ IR+ +GV
Sbjct  1    PGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLKNCFHESNADVVIRIVVGV  60

Query  516  IIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraarqrarrgqRSENSTPF  337
            ++QILCSYVTLPLYALVTQMG+ MKP +F + VA+A+K WH  A+++ + G+ SE++TP+
Sbjct  61   VVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKKQTKHGRHSESTTPY  120

Query  336  TSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPAS----DDQVWANSAAATSASPRRN  169
            +SRP TP HG SP+HLL +F H + +S   SP    S    D Q W   +    A P  +
Sbjct  121  SSRPTTPTHGSSPIHLLHNFNHRSVESFPNSPSPRYSSHHDDHQFWDPESQRQEAGPSSH  180

Query  168  LSSNDDQHEIQIV  130
             S   +  E + V
Sbjct  181  HSLAHESSEKKPV  193



>ref|XP_007150221.1| hypothetical protein PHAVU_005G136800g [Phaseolus vulgaris]
 gb|ESW22215.1| hypothetical protein PHAVU_005G136800g [Phaseolus vulgaris]
Length=560

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG PVV+PGD+LFWFN+P L+L+ I FVLFQNAFQ+AFF W+ ++F + SC
Sbjct  323  RIQERGEVVKGMPVVQPGDHLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSC  382

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            F     D+ IR+SMG+ +Q LCSYVTLPLYALVTQMGS+MK  IF + VA A++ WH  A
Sbjct  383  FQSQKQDVVIRISMGIFVQFLCSYVTLPLYALVTQMGSTMKATIFNEKVAMALRNWHHTA  442

Query  384  rqrarrgqRSENSTPFTSRPATP  316
            ++  +  +   + +P ++RP+TP
Sbjct  443  KKNVKEKRGVRSQSPLSTRPSTP  465



>emb|CDP07269.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 141/239 (59%), Gaps = 42/239 (18%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ++  V++GAPVVEP ++LFWF+RP  +LF I F LF+NA+Q+A+F WSW +FG+ SC
Sbjct  316  QIQDKTTVVRGAPVVEPTNDLFWFSRPHWILFLIHFTLFENAYQMAYFLWSWYEFGIGSC  375

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
             H N   I +R+ +G+ +Q+LCSY+T PLYALVTQMGS MK  IF +  A+A+K WH+AA
Sbjct  376  MHENLVMILLRVFLGLALQLLCSYITFPLYALVTQMGSHMKKAIFEEQTATALKKWHQAA  435

Query  384  r------qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ--HNAADS---------  256
            +      +       S ++  FTS   TP  G SP+HLL +FQ   NA ++         
Sbjct  436  KNRKKLRKAGAATDTSTSNANFTSGETTPGQGSSPLHLLHNFQCRSNAPETESYPASPTS  495

Query  255  ---------LQASPRGPASDDQVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
                     L+AS RGP  D       AA+ SA+  RN+    D H       DFSFV 
Sbjct  496  YQTDTELSDLEASARGPTHD-------AASGSATDHRNV----DPHR-----EDFSFVK  538



>ref|XP_006595457.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=579

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 128/204 (63%), Gaps = 9/204 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KG P+V+PGD+LFWFN+P L+L+ I FVLFQNAFQ+AFF W+ ++F + SC
Sbjct  277  RIQQRGEVVKGVPLVQPGDDLFWFNKPRLILYLINFVLFQNAFQLAFFSWAALQFMMKSC  336

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D+ IR+SMG+ +Q LCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH  A
Sbjct  337  FHSQKQDVVIRISMGIFVQFLCSYVTLPLYALVTQMGSTMKPTIFNERVARALRKWHHTA  396

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            ++  +  +          R  TP H  S  + L  + H+   +  +SP     D  +   
Sbjct  397  KKNVKHNR--------GLRLQTPNHTKSNANFLRRY-HSEMATYPSSPIRFDLDAHLPCE  447

Query  204  SAAATSASPRRNLSSNDDQHEIQI  133
              A +S+   R +      HEI I
Sbjct  448  VNATSSSIHHRQMEMGHQAHEIDI  471


 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI++RG+V+K  P+V+PGD+LFWFN+P L L+ I FVLFQNAFQ+A+F W+ ++FG+ S 
Sbjct  492  RIEQRGEVVKVVPLVQPGDDLFWFNKPRLTLYLINFVLFQNAFQLAYFSWTALQFGIKSS  551

Query  564  FHRNAADIAIRLSMGV  517
            FH    D  I++SMG+
Sbjct  552  FHSQTEDSVIKVSMGL  567



>ref|XP_010917470.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Elaeis guineensis]
Length=614

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +I ERGDV+KGAPVV P D+LFWF  P  ML+ I FVLFQNAFQ+A F WSW +FG  SC
Sbjct  344  QIMERGDVVKGAPVVHPTDDLFWFKCPRFMLYLIHFVLFQNAFQLALFAWSWYEFGFLSC  403

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
            FH+   DI IR SMGV+IQ+LCSYVTLPLYALVTQMGS+M+P IF   VA+A++ WH
Sbjct  404  FHQRVDDIIIRFSMGVLIQVLCSYVTLPLYALVTQMGSNMRPTIFSKGVATALRKWH  460



>ref|XP_003539407.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=582

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KG P+V+PGD+LFWFN+P L L+ I FVLFQNAFQ+A+F W+ ++FG+ SC
Sbjct  333  RIQQRGEVVKGVPLVQPGDDLFWFNKPRLTLYLINFVLFQNAFQLAYFSWTALQFGIKSC  392

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D  I+++MGV++Q LCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH  A
Sbjct  393  FHSQTEDAVIKVTMGVLVQFLCSYVTLPLYALVTQMGSTMKPTIFNERVARALRNWHHTA  452

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLL  286
            ++  ++ +  +  TP +S P+TP    S  +LL
Sbjct  453  KKHVKQNRGLQLQTP-SSAPSTPNQPKSQANLL  484



>emb|CAN79931.1| hypothetical protein VITISV_007489 [Vitis vinifera]
Length=1417

 Score =   182 bits (461),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 133/238 (56%), Gaps = 45/238 (19%)
 Frame = -3

Query  744   RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             RI ERG V+KG P+VEPGD+LFWFNRPSLMLF I FVLF               +GL SC
Sbjct  1189  RIAERGVVVKGTPIVEPGDHLFWFNRPSLMLFLINFVLF--------------LYGLKSC  1234

Query  564   FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
             +H    D  IR++MGV+ Q+LCSYVTLPLYALVTQMG++M+  +F D VA A++ WH   
Sbjct  1235  YHDTTEDYVIRITMGVMTQVLCSYVTLPLYALVTQMGTTMRSTVFNDKVAVALRDWH-ET  1293

Query  384   rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
              ++  R   S+  +P +SRP+TP +GMSPVHLL  + +N  D    SP     D++ W  
Sbjct  1294  ARKHTRHGHSDGVSPQSSRPSTPSYGMSPVHLLQSYDNNTPD---MSPVASNYDNERWYG  1350

Query  204   SAAAT---------------SASPRRNLSSNDD------------QHEIQIVSNDFSF  112
               + +               S  P R    +              QHE+ I S++FSF
Sbjct  1351  EGSGSLGKKDDDEQRPENFESREPGRGTQDSSSAQLALGPLPIQTQHEVNITSSEFSF  1408



>ref|XP_002301907.2| hypothetical protein POPTR_0002s00830g [Populus trichocarpa]
 gb|EEE81180.2| hypothetical protein POPTR_0002s00830g [Populus trichocarpa]
Length=446

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQ+R  V++G PVV+P +  FWFNRP  +L  I + LFQNAFQ+AFF W+W +FG+ SCF
Sbjct  234  IQDRSHVVRGVPVVQPNNKFFWFNRPHWILLLIHYTLFQNAFQMAFFLWTWYEFGIRSCF  293

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H N A I  R+ +G+++Q +CSY+T PLY+LVTQMGS MK  IF +  A A++ W   A 
Sbjct  294  HENLAVILTRVFLGLVLQFVCSYITFPLYSLVTQMGSHMKKAIFEEQTARALRKWQ-KAA  352

Query  381  qrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAAD--SLQASPRGPASDDQVWA  208
            +  ++ ++S     F S  +TP  G SP+HLL  ++ +  D  S+ +S    ASD ++  
Sbjct  353  KLRKKSRQSGGDQGFMSVGSTPSRGTSPIHLLHKYRPSQPDVESVISSAMSYASDTEL--  410

Query  207  NSAAATSASPRRNLSSNDDQHEIQ--IVSNDFSFVN  106
             S    S    R+ S   DQH+ Q    S DFSFV 
Sbjct  411  -SELDASPDHDRHESRKQDQHQEQSEAHSADFSFVK  445



>emb|CDY03836.1| BnaC01g29530D [Brassica napus]
Length=471

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQE+GD++KG P+V+PGD+LFWF RP  +LF +  VLF NAFQ+AFF W+  +F L +CF
Sbjct  345  IQEKGDIVKGMPLVQPGDHLFWFGRPRFILFLVHLVLFTNAFQLAFFAWTTYEFKLKNCF  404

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
            H+N  D+ IR+S+GVI+Q+LCSYVTLPLYALVTQMGS MKP +F + VA A+K+WH
Sbjct  405  HKNTVDVVIRISVGVIVQVLCSYVTLPLYALVTQMGSKMKPTVFNERVAVALKSWH  460



>gb|KHN33781.1| MLO protein like 1 [Glycine soja]
Length=547

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 129/219 (59%), Gaps = 11/219 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+R  +++G P+VEP +  FWFNRP  ++F I F LF+NAFQ+AFF W+W +F + SC
Sbjct  333  QIQDRATIVRGVPIVEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSC  392

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +G+ +Q++CSY+T PLY+LVTQMGS MK  IF +  A A+K W +AA
Sbjct  393  FHENLPLILTRVVLGIALQVVCSYITFPLYSLVTQMGSHMKKTIFEEQTAKALKKWQKAA  452

Query  384  rqrarrgqRSENSTPFT-SRPATPLHGMSPVHLLSDFQ--HNAADSLQASPRGPASD---  223
            + + +  +   +    T S   TP  G SP+HLL  ++  H   DS+  SPR   SD   
Sbjct  453  KDKRKLRKAGIDIPSGTMSGETTPSQGTSPLHLLHKYKPSHTDTDSVLYSPRSYQSDTDL  512

Query  222  DQVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
             +   +S      +  R  S N + H I     DFSFV 
Sbjct  513  SETEGSSHQLNEITQTRQASRNGETHNI-----DFSFVK  546



>ref|XP_002273002.1| PREDICTED: MLO protein homolog 1-like [Vitis vinifera]
Length=558

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 131/220 (60%), Gaps = 14/220 (6%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  V+KGAP+VEP +  FWFNRP  +L  I F+LFQNAFQ++FF W   ++G+ SC
Sbjct  341  EIQDRTTVVKGAPIVEPNNKFFWFNRPHWVLLLIHFILFQNAFQMSFFLWITYEYGIKSC  400

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N A+I +RL  GV +QILCSY+T PLYALVTQMGS MK  IF +  A A+K W +AA
Sbjct  401  FHENLAEILVRLVCGVALQILCSYITFPLYALVTQMGSHMKKSIFEEQTAQALKKWQKAA  460

Query  384  rqrarrgqRSENSTPFT-SRPATPLHGMSPVHLLSDFQH----NAADSLQASPRGPASD-  223
            ++R +  +   +  P +     TP HG SP+HLL + ++    N  +S   SP+   SD 
Sbjct  461  KERKKLRKAGGDIAPGSLGGENTPSHGASPLHLLRNHKYRSSTNEVESAPTSPKSCQSDT  520

Query  222  ---DQVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSF  112
               D   ++      +    +L  N + H I     DFSF
Sbjct  521  DLSDMEGSSRHGHHQSKENDHLDRNAESHSI-----DFSF  555



>ref|XP_004500844.1| PREDICTED: MLO protein homolog 1-like [Cicer arietinum]
Length=553

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 129/225 (57%), Gaps = 19/225 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  +++G PVVEP +  FWFNRP  ++F I F LFQNAFQ+A+F W+W +F + SC
Sbjct  331  EIQDRTTIVRGVPVVEPNNKYFWFNRPHWIIFLIHFTLFQNAFQIAYFLWTWYEFTITSC  390

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +G+ +Q+LCSY+T PLYALVTQMGS MK  IF +    A+K W ++A
Sbjct  391  FHENLPLIVTRVVLGLALQVLCSYITFPLYALVTQMGSHMKRGIFEEQTTKALKKWQKSA  450

Query  384  rqrarrgqRSENST---PFTSRPATPLHGMSPVHLLSDFQ---HNAADSLQASPRGPASD  223
            R + +  +     +   P  S   TP  G SP+HLL  F+   H   DS+  SPR   SD
Sbjct  451  RDKRKLRKAGGGGSIDVPSVSGETTPSQGTSPMHLLHKFKPSSHTDTDSVLYSPRSYQSD  510

Query  222  DQVWANSAAATS--------ASPRRNLSSNDDQHEIQIVSNDFSF  112
               ++++  +T         + P+ N   N   H I     DFSF
Sbjct  511  QTDFSDTEGSTHRLNLDQIMSQPQHNPPGNQLTHNI-----DFSF  550



>gb|EYU36580.1| hypothetical protein MIMGU_mgv1a020678mg [Erythranthe guttata]
Length=560

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 126/207 (61%), Gaps = 16/207 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+R  V++GAP+VEP +N FWFNRP  +LF I F LFQNA+Q+A+F W W +FG+ +C
Sbjct  333  QIQDRTAVVRGAPLVEPTNNFFWFNRPQWILFLIHFTLFQNAYQMAYFLWKWYEFGITTC  392

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH     + +R+ +GV +QILCSY+T PLYALVTQMGS MK  IF +  A A+K WH   
Sbjct  393  FHEKLHIVLVRVFLGVALQILCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWH---  449

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQVWAN  205
            +   +R +  +    +TS   TP    SP+HLL    HN     + S   PA+D +  A+
Sbjct  450  QAAKQRKKLRKVDASYTSGDTTPSRATSPLHLLH--HHN-----RRSSTAPATDSESLAD  502

Query  204  SAAATSASPRRNLSSNDDQHEIQIVSN  124
                   SP R+  S+ +  E++  SN
Sbjct  503  ------LSPARSYISDTELSELESNSN  523



>ref|XP_010030836.1| PREDICTED: MLO protein homolog 1-like [Eucalyptus grandis]
 gb|KCW56486.1| hypothetical protein EUGRSUZ_I02213 [Eucalyptus grandis]
Length=564

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 139/229 (61%), Gaps = 18/229 (8%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ++  V+KGAP+VEP +  FWFNRP  +LF I   LFQNAFQ+++F W+W +FGL SC
Sbjct  333  QIQDKTTVVKGAPIVEPNNKYFWFNRPDFILFLIHLTLFQNAFQISYFLWTWYEFGLNSC  392

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH+  A+I +R+ +GV +Q +CSY+T PLY+LVTQMGS MK  IF +  A A+K W R A
Sbjct  393  FHKRQAEILVRVLLGVALQFVCSYITFPLYSLVTQMGSHMKKAIFEEQTAKALKNWQRVA  452

Query  384  rqrarrgqR----SENSTPFTSRPATPLHGMSPVHLLSDFQHNAA----DSLQASPRGPA  229
            R+R ++ ++    S + + F S   TP  G SP+HLL   +HN++    +S+  SP    
Sbjct  453  RERKKQRKKEGDQSVSRSGFMSPDNTPSRGSSPLHLLHKHKHNSSTNDLESVINSPSSYI  512

Query  228  SDDQVWANSAAATSASPRRN----------LSSNDDQHEIQIVSNDFSF  112
            S+ ++        +  P  +           ++ND + +   V NDFSF
Sbjct  513  SETELSDYEGPPPAHFPDHHQQIPDQQGGQQNNNDARQKEGDVQNDFSF  561



>ref|XP_002310696.2| hypothetical protein POPTR_0007s08570g [Populus trichocarpa]
 gb|EEE91146.2| hypothetical protein POPTR_0007s08570g [Populus trichocarpa]
Length=546

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 127/216 (59%), Gaps = 13/216 (6%)
 Frame = -3

Query  720  LKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCFHRNAADI  541
            L G PVVEP +  FWFNRP ++LF I F LFQNAFQ A+F W+W +FGL SCFH N  ++
Sbjct  328  LAGVPVVEPSNKYFWFNRPDIILFLIHFTLFQNAFQTAYFLWTWYEFGLKSCFHDNLLEM  387

Query  540  AIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraarqrarrgq  361
              ++ + +I+Q LCSYVT PLYALVTQMGS MK  IF +  + AIK W R+A++R R   
Sbjct  388  LAKVVLAIILQFLCSYVTFPLYALVTQMGSHMKKAIFEEQTSKAIKKWQRSAKERRRLKN  447

Query  360  R-----SENSTPFTS---RPATPLHGMSPVHLLSDFQHNAAD-----SLQASPRGPASDD  220
            +     S N    TS   +  TP  G SP+HLL  F+HN+ D     S   SPR   S+ 
Sbjct  448  KAVADGSSNGFSMTSPDHQSGTPSRGTSPLHLLHKFKHNSTDIEGGLSACTSPRSCFSET  507

Query  219  QVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSF  112
            ++     AA S+        N+ +   +  S DFSF
Sbjct  508  ELSEIEGAAPSSDDYELRRQNNPKRLEESRSADFSF  543



>emb|CBI40746.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 118/182 (65%), Gaps = 5/182 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  V+KGAP+VEP +  FWFNRP  +L  I F+LFQNAFQ++FF W   ++G+ SC
Sbjct  309  EIQDRTTVVKGAPIVEPNNKFFWFNRPHWVLLLIHFILFQNAFQMSFFLWITYEYGIKSC  368

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N A+I +RL  GV +QILCSY+T PLYALVTQMGS MK  IF +  A A+K W +AA
Sbjct  369  FHENLAEILVRLVCGVALQILCSYITFPLYALVTQMGSHMKKSIFEEQTAQALKKWQKAA  428

Query  384  rqrarrgqRSENSTPFT-SRPATPLHGMSPVHLLSDFQH----NAADSLQASPRGPASDD  220
            ++R +  +   +  P +     TP HG SP+HLL + ++    N  +S   SP+   SD 
Sbjct  429  KERKKLRKAGGDIAPGSLGGENTPSHGASPLHLLRNHKYRSSTNEVESAPTSPKSCQSDT  488

Query  219  QV  214
             +
Sbjct  489  DL  490



>ref|XP_010319697.1| PREDICTED: MLO1 protein isoform X1 [Solanum lycopersicum]
Length=410

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RI ERGD++KG PVVE GD+LFWFNRP+L+LF I FVLFQNAFQVAFFFWSW KFG  SC
Sbjct  304  RISERGDIVKGVPVVETGDHLFWFNRPALVLFLINFVLFQNAFQVAFFFWSWWKFGFPSC  363

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQM  457
            FH+NAAD+AIRL+MGVIIQ+ CSYVTLPLYALVTQ+
Sbjct  364  FHKNAADLAIRLTMGVIIQVHCSYVTLPLYALVTQL  399



>gb|KEH36350.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=500

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 109/177 (62%), Gaps = 3/177 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  +++G PVVEP +  FWFNRP  ++F I F LFQNAFQ+A+F W+W +F + SC
Sbjct  281  EIQDRTTIVRGVPVVEPNNKYFWFNRPHWIIFLIHFTLFQNAFQIAYFLWTWYEFTITSC  340

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +Q+LCSY+T PLYALVTQMGS MK  IF +    A+K W +AA
Sbjct  341  FHENLPLIVTRVVLGVALQVLCSYITFPLYALVTQMGSHMKRGIFEEQTTKALKKWQKAA  400

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ---HNAADSLQASPRGPASD  223
            R + +         P  S   TP  G SP+HLL  F+       DS+  SPR   S+
Sbjct  401  RDKRKLRNAGSIEIPSVSGDTTPSQGTSPLHLLHKFKPSNQTDTDSVLYSPRSYQSE  457



>ref|XP_002510708.1| Protein MLO, putative [Ricinus communis]
 gb|EEF52895.1| Protein MLO, putative [Ricinus communis]
Length=556

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 129/230 (56%), Gaps = 23/230 (10%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQER  V++GAPVVEP +  FWFNRP  +L  I + LFQNAFQ+AFF W+W +FGL SC
Sbjct  334  QIQERSTVVRGAPVVEPNNKYFWFNRPQWILLLIHYTLFQNAFQMAFFLWTWYEFGLKSC  393

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N A I  R+ +GV +Q +CSY+T PLY LVTQMGS MK  IF +    A++ W +AA
Sbjct  394  FHENLAAILARVFLGVALQFVCSYITFPLYCLVTQMGSHMKKAIFEEQTTKALRKWQKAA  453

Query  384  rqrarrgqRSENSTP----FTSRPATPLHGMSPVHLLSDFQHNAA----DSLQASPRGPA  229
            ++R +  +            +    TP  G SP+HLL   ++ ++    +S+  SPR   
Sbjct  454  KERKKSRKAGGGGGSSPGFMSVESTTPSQGASPIHLLHGHKYRSSQTDIESVLNSPRSYL  513

Query  228  SDDQVWANSAAATSASPRRNLSS--------NDDQHEIQIVSNDFSFVNN  103
            SD  +  +  + T  S R    S        N++ H     S DFSF   
Sbjct  514  SDTDL--SELSETEGSSRHRYESRLQDVPVKNEEPH-----STDFSFAKT  556



>ref|XP_006473919.1| PREDICTED: MLO protein homolog 1-like [Citrus sinensis]
Length=490

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 131/216 (61%), Gaps = 9/216 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  V++GAPVVEP +  FWFNRP  +LF I + LFQNAFQ+AFF W   +FG+ SC
Sbjct  280  EIQDRTTVVRGAPVVEPNNKFFWFNRPEWILFLIHYTLFQNAFQMAFFLWIVYEFGIHSC  339

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +Q LCSY+T PLYALVTQMGS MK  IF +  A A+K W +AA
Sbjct  340  FHENLPLILTRVIVGVALQFLCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWQKAA  399

Query  384  rqrarrgqRS---ENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQV  214
            ++R R   ++    +   F S   TP  G SP+HLL  +++ +      S R   SD+++
Sbjct  400  KERRRSRNKAAAGADKCRFLSGENTPSQGASPIHLLHHYKYRSNQQDIESVRSYQSDNEL  459

Query  213  WANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
             +    +++    ++   ++D H     ++DFSFV 
Sbjct  460  -SEIEPSSTHHHHQDQGRDEDLH-----NSDFSFVK  489



>gb|KDO85189.1| hypothetical protein CISIN_1g041242mg [Citrus sinensis]
Length=544

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 131/217 (60%), Gaps = 10/217 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  V++GAPVVEP +  FWFNRP  +LF I + LFQNAFQ+AFF W   +FG+ SC
Sbjct  333  EIQDRTTVVRGAPVVEPNNKFFWFNRPEWILFLIHYTLFQNAFQMAFFLWIVYEFGIHSC  392

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +Q LCSY+T PLYALVTQMGS MK  IF +  A A+K W +AA
Sbjct  393  FHENLPLILTRVIVGVALQFLCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWQKAA  452

Query  384  rqra----rrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDDQ  217
            ++R     +    ++  + F S   TP  G SP+HLL  +++ +      S R   SD++
Sbjct  453  KERRRSRNKAAAGADKCSGFLSGENTPSQGASPIHLLHHYKYRSNQQDIESVRSYQSDNE  512

Query  216  VWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
            + +    +++    ++   ++D H     ++DFSFV 
Sbjct  513  L-SEIEPSSTHHHHQDQGRDEDLH-----NSDFSFVK  543



>ref|XP_002519555.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF42969.1| calmodulin binding protein, putative [Ricinus communis]
Length=450

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQERG+V+KG P+VEPGD+LFWFN+P L+L+ I FVLFQNAF +AFF WSW +FGL SC
Sbjct  321  RIQERGEVVKGKPLVEPGDDLFWFNKPRLLLYLIHFVLFQNAFDLAFFAWSWYEFGLKSC  380

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWH  394
             H N  DI IR++MG+ I +LCSYVTLPLYALVTQ      P IF + V  A++ WH
Sbjct  381  LHENPEDIGIRITMGITIHVLCSYVTLPLYALVTQ------PTIFSERVGKALRKWH  431



>ref|XP_003603854.1| MLO protein-like protein [Medicago truncatula]
 gb|AES74105.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=551

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 109/177 (62%), Gaps = 3/177 (2%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  +++G PVVEP +  FWFNRP  ++F I F LFQNAFQ+A+F W+W +F + SC
Sbjct  332  EIQDRTTIVRGVPVVEPNNKYFWFNRPHWIIFLIHFTLFQNAFQIAYFLWTWYEFTITSC  391

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +Q+LCSY+T PLYALVTQMGS MK  IF +    A+K W +AA
Sbjct  392  FHENLPLIVTRVVLGVALQVLCSYITFPLYALVTQMGSHMKRGIFEEQTTKALKKWQKAA  451

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ---HNAADSLQASPRGPASD  223
            R + +         P  S   TP  G SP+HLL  F+       DS+  SPR   S+
Sbjct  452  RDKRKLRNAGSIEIPSVSGDTTPSQGTSPLHLLHKFKPSNQTDTDSVLYSPRSYQSE  508



>gb|KHN20094.1| MLO protein like 1 [Glycine soja]
Length=541

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 127/223 (57%), Gaps = 24/223 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+R  +++G P+VEP +  FWFNRP  ++F I F LF+NAFQ+AFF W+W +F + SC
Sbjct  332  QIQDRATIVRGVPIVEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSC  391

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +   I  R+ +G+ +Q++CSY+T PLY+LV QMGS MK  IF +  A A+K W +AA
Sbjct  392  FHESLPLILTRVVLGIALQVVCSYITFPLYSLVIQMGSHMKKAIFEEQTAKALKKWQKAA  451

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ--HNAADSLQASPRGPASDDQV-  214
            + + +  +   +     S   TP  G SP+HLL  ++  H   DS+  SPR   SD  + 
Sbjct  452  KDKRKLRKAGID----MSGETTPSQGTSPLHLLQKYKPSHTDTDSVLYSPRSYQSDTDLS  507

Query  213  -------WANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
                     N    T  +PR     N + H I     DFSFV 
Sbjct  508  ETEGSSHQLNEITQTHQAPR-----NGETHNI-----DFSFVK  540



>ref|XP_003527634.1| PREDICTED: MLO protein homolog 1-like [Glycine max]
Length=541

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 127/223 (57%), Gaps = 24/223 (11%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            +IQ+R  +++G P+VEP +  FWFNRP  ++F I F LF+NAFQ+AFF W+W +F + SC
Sbjct  332  QIQDRATIVRGVPIVEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSC  391

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH +   I  R+ +G+ +Q++CSY+T PLY+LV QMGS MK  IF +  A A+K W +AA
Sbjct  392  FHESLPLILTRVVLGIALQVVCSYITFPLYSLVIQMGSHMKKAIFEEQTAKALKKWQKAA  451

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLLSDFQ--HNAADSLQASPRGPASDDQV-  214
            + + +  +   +     S   TP  G SP+HLL  ++  H   DS+  SPR   SD  + 
Sbjct  452  KDKRKLRKAGID----MSGETTPSQGTSPLHLLQKYKPSHTDTDSVLYSPRSYQSDTDLS  507

Query  213  -------WANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
                     N    T  +PR     N + H I     DFSFV 
Sbjct  508  ETEGSSHQLNEITQTHQAPR-----NGETHNI-----DFSFVK  540



>ref|XP_011034835.1| PREDICTED: MLO protein homolog 1-like [Populus euphratica]
Length=571

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 134/228 (59%), Gaps = 18/228 (8%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQ+R  V++G PVV+P +  FWFNRP  +L  I + LFQNAFQ+AFF W+W +FG+ SCF
Sbjct  345  IQDRSHVVRGVPVVQPNNKFFWFNRPHWILLLIHYTLFQNAFQMAFFLWTWYEFGIRSCF  404

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H N A I  R+ +G+++Q +CSY+T PLY+LVTQMGS MK  IF +  A A++ W +AA+
Sbjct  405  HENLAVILTRVFLGLVLQFVCSYITFPLYSLVTQMGSHMKKAIFEEQTARALRKWQKAAK  464

Query  381  qrarrgqRSEN---STP-----------FTSRPATPLHGMSPVHLLSDFQHNAAD--SLQ  250
             R +  Q   +   S+P           F S  +TP  G SP+HLL  ++ + +D  S+ 
Sbjct  465  LRKKSRQSGGDQGGSSPGFMSQGGSSPGFMSVASTPSRGTSPIHLLHKYRPSRSDVESVI  524

Query  249  ASPRGPASDDQVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
            +S     SD ++    A+       R    +D Q + +  S DFSFV 
Sbjct  525  SSAMSYTSDTELSELDASPHDGHESRK--QDDHQEQSEAHSADFSFVK  570



>ref|XP_004985865.1| PREDICTED: MLO protein homolog 1-like [Setaria italica]
Length=553

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 130/221 (59%), Gaps = 12/221 (5%)
 Frame = -3

Query  741  IQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSCF  562
            IQ++  V+KGAP+VEP D  FWFNRP  +LF I   LFQNAFQ+A F W+ +  GL +C+
Sbjct  330  IQDKATVIKGAPIVEPSDRFFWFNRPKWVLFLIHLTLFQNAFQMAHFIWTLLTPGLKTCY  389

Query  561  HRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraar  382
            H N     +++S+G+ +Q+LCSY+T PLYALVTQMGS MK  IF +  A A+  W +AA+
Sbjct  390  HENLGLGIMKVSVGLGLQVLCSYITFPLYALVTQMGSHMKKTIFEEQTAKAVMKWRKAAK  449

Query  381  qrarrgq------RSENSTPFTSRPATPLHGMSPVHLLSDFQHNAADSLQASPRGPASDD  220
             + ++ +       S ++TP  SRP +P  G SPVHLL  ++  + D  +++P  P    
Sbjct  450  DKVKQREAGFEGLMSTDTTPSHSRPTSPGGGSSPVHLLQKYRGRSEDP-ESAPTSPGRGQ  508

Query  219  QVW-----ANSAAATSASPRRNLSSNDDQHEIQIVSNDFSF  112
            ++       +        P R  +++    +I I   DFSF
Sbjct  509  ELGDMYPVTDQHRMHRLDPERRRAASSTAVDIDIADADFSF  549



>ref|XP_007135967.1| hypothetical protein PHAVU_009G006800g [Phaseolus vulgaris]
 gb|ESW07961.1| hypothetical protein PHAVU_009G006800g [Phaseolus vulgaris]
Length=551

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 129/225 (57%), Gaps = 21/225 (9%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             IQ+R  V++G P+VEP +  FWFNRP  ++F I F LF+NAFQ+AFF W+W +F + SC
Sbjct  332  EIQDRTTVVRGVPIVEPNNKYFWFNRPQWIIFLIHFTLFENAFQIAFFLWTWYEFKITSC  391

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +G+ +Q++CSY+T PLY+LVTQMGS MK  IF +  A A+K W + A
Sbjct  392  FHENLPLILTRVFLGIALQVVCSYITFPLYSLVTQMGSHMKQAIFEEQTAKALKKWQKVA  451

Query  384  rqrarrgqRSENSTPFT-SRPATPLHGMSPVHLLSDFQHNAADS--LQASPRGPASDDQV  214
            + + +  +   +    T S  ATP  G SP+HLL  ++ +  D+  +  SPR   SD   
Sbjct  452  KDKRKLRKAGVDVPSGTMSGEATPSQGTSPIHLLHKYKPSQTDTDVVLYSPRSYQSDTDF  511

Query  213  --------WANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVNN  103
                      N    T  +PR     N + H I     +FSFV++
Sbjct  512  SDTEGSSHQLNQITQTHQAPR-----NGEAHSI-----EFSFVSH  546



>ref|XP_008237952.1| PREDICTED: MLO protein homolog 1-like [Prunus mume]
Length=569

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 130/221 (59%), Gaps = 9/221 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             + +R  V+KGAPVVEP +  FWFNRP  +L  I F LFQNAFQ+A+F W+  +FG  SC
Sbjct  349  EMHDRTTVVKGAPVVEPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLWTSSEFGFTSC  408

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +QILCSY+T PLYAL+TQMGS MK  IF +  A A+K W +AA
Sbjct  409  FHENLPLILTRVFLGVALQILCSYITFPLYALITQMGSHMKKAIFEEQTAKALKNWQKAA  468

Query  384  rqrarrgqRSE-NSTPFTSRPATPLHGMSPVHLLSDFQHNA----ADSLQASPRGPASDD  220
            +QR +  +  + +S+ F S   TP  G SP+HLL + +H +     +S+  SPR  +   
Sbjct  469  KQRKKLRKAGDASSSGFVSGENTPSQGSSPLHLLHNQKHRSNQSDLESVLNSPRSVSYQS  528

Query  219  QVWANSAAATSASPRRNLSSNDDQHEIQIV---SNDFSFVN  106
            +    S    SA     + S D    ++     S DFSFV 
Sbjct  529  ET-DLSEREGSAHDGNGIRSEDQPAALRREGSHSVDFSFVK  568



>ref|XP_008228898.1| PREDICTED: MLO protein homolog 1-like [Prunus mume]
Length=558

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 127/207 (61%), Gaps = 11/207 (5%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             + +R  V+KG PVVEP +  FWFNRP  +L  I F LFQNAFQ+A+F W+ ++FGL SC
Sbjct  349  EMHDRTTVVKGTPVVEPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLWTSLEFGLTSC  408

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +QILCSY+T PLYAL+TQMGS MK  IF +  A A+K W +AA
Sbjct  409  FHENLPLILTRVFLGVALQILCSYITFPLYALITQMGSHMKKAIFEEQTAKALKNWQKAA  468

Query  384  rqrarrgqRSEN--STPFTSRPATPLHGMSPVHLLSDFQHNA----ADSLQASPRGPA--  229
            +QR +  + + +  S+ F S   TP  G SP+HLL + +H +     +S+  SPR  +  
Sbjct  469  KQRKKLRKATGDASSSGFVSGENTPSQGSSPLHLLHNQKHRSNQSDLESVLNSPRSVSYQ  528

Query  228  SDDQVWANSAAATSASPRRNLSSNDDQ  148
            SD  +   S    SA     +  ++DQ
Sbjct  529  SDTDL---SEMEGSAHDGNGIRRSEDQ  552



>ref|XP_007210822.1| hypothetical protein PRUPE_ppa020311mg [Prunus persica]
 gb|EMJ12021.1| hypothetical protein PRUPE_ppa020311mg [Prunus persica]
Length=566

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 129/220 (59%), Gaps = 7/220 (3%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
             + +R  V+KGAPVVEP +  FWFNRP  +L  I F LFQNAFQ+A+F W+  +FG  SC
Sbjct  346  EMHDRTTVVKGAPVVEPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLWTSSEFGFTSC  405

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH N   I  R+ +GV +QILCSY+T PLYAL+TQMGS MK  IF +  A A+K W +AA
Sbjct  406  FHENLPLILTRVFLGVALQILCSYITFPLYALITQMGSHMKKAIFEEQTAKALKNWQKAA  465

Query  384  rqrarrgqRSE-NSTPFTSRPATPLHGMSPVHLLSDFQHNA----ADSLQASPRGPA--S  226
            +QR +  +  + +S+ F S   TP  G SP+HLL + +H +     +S+  SPR  +  S
Sbjct  466  KQRKKLRKAGDASSSGFVSGENTPSQGSSPLHLLHNQKHRSNQSDLESVLNSPRSVSYQS  525

Query  225  DDQVWANSAAATSASPRRNLSSNDDQHEIQIVSNDFSFVN  106
            D  +     +A   +  R+             S DFSFV 
Sbjct  526  DTDLSEREGSAHDGNGIRSEDQPAALRREGSHSVDFSFVK  565



>gb|KHN25048.1| MLO-like protein 6 [Glycine soja]
Length=577

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 111/153 (73%), Gaps = 6/153 (4%)
 Frame = -3

Query  744  RIQERGDVLKGAPVVEPGDNLFWFNRPSLMLFFIRFVLFQNAFQVAFFFWSWVKFGLFSC  565
            RIQ+RG+V+KG P+V+PGD+LFWFN+P L L+ I F     AFQ+A+F W+ ++FG+ SC
Sbjct  333  RIQQRGEVVKGVPLVQPGDDLFWFNKPRLTLYLINF-----AFQLAYFSWTALQFGIKSC  387

Query  564  FHRNAADIAIRLSMGVIIQILCSYVTLPLYALVTQMGSSMKPVIFGDNVASAIKTWHraa  385
            FH    D  I+++MGV++Q LCSYVTLPLYALVTQMGS+MKP IF + VA A++ WH  A
Sbjct  388  FHSQTEDAVIKVTMGVLVQFLCSYVTLPLYALVTQMGSTMKPTIFNERVARALRNWHHTA  447

Query  384  rqrarrgqRSENSTPFTSRPATPLHGMSPVHLL  286
            ++  ++ +  +  TP +S P+TP    S  +LL
Sbjct  448  KKHVKQNRGLQLQTP-SSAPSTPNQPKSQANLL  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420