BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019B14

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP20126.1|  unnamed protein product                              73.9    1e-11   Coffea canephora [robusta coffee]
ref|XP_009763333.1|  PREDICTED: SCY1-like protein 2                   66.2    3e-09   Nicotiana sylvestris
ref|XP_007019921.1|  Kinase family protein with ARM repeat domain...  64.3    1e-08   
ref|XP_009601552.1|  PREDICTED: SCY1-like protein 2                   64.3    1e-08   Nicotiana tomentosiformis
ref|XP_007019922.1|  Kinase family protein with ARM repeat domain...  64.3    1e-08   
ref|XP_006362717.1|  PREDICTED: SCY1-like protein 2-like              60.5    3e-07   Solanum tuberosum [potatoes]
ref|XP_010063716.1|  PREDICTED: SCY1-like protein 2                   58.9    9e-07   Eucalyptus grandis [rose gum]
ref|XP_007201757.1|  hypothetical protein PRUPE_ppa001052mg           55.8    8e-06   Prunus persica
ref|XP_008237746.1|  PREDICTED: SCY1-like protein 2                   53.5    6e-05   Prunus mume [ume]
ref|XP_002525488.1|  ATP binding protein, putative                    53.1    6e-05   
gb|KDO37207.1|  hypothetical protein CISIN_1g033834mg                 49.3    1e-04   Citrus sinensis [apfelsine]
gb|KDP45586.1|  hypothetical protein JCGZ_17193                       51.2    3e-04   Jatropha curcas
ref|XP_011004854.1|  PREDICTED: SCY1-like protein 2                   51.2    4e-04   Populus euphratica
gb|KDO45467.1|  hypothetical protein CISIN_1g0453202mg                47.8    5e-04   Citrus sinensis [apfelsine]
gb|KJB60121.1|  hypothetical protein B456_009G290500                  50.4    5e-04   Gossypium raimondii
gb|KJB60122.1|  hypothetical protein B456_009G290500                  50.4    5e-04   Gossypium raimondii
gb|KJB60123.1|  hypothetical protein B456_009G290500                  50.1    7e-04   Gossypium raimondii



>emb|CDP20126.1| unnamed protein product [Coffea canephora]
Length=931

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 79/139 (57%), Gaps = 11/139 (8%)
 Frame = -2

Query  677  STVAXKPXNNGTXASPFNMHGSSNSTSNPXPLD----SLSSWXXGXSXFTEPLKPNQGNX  510
            ST A     NG  A   N +GSS   + P  L     S +SW       TEP++PNQGN 
Sbjct  770  STSAFGSSTNGGMALSANKNGSSYGGAAPNGLSFQTGSSTSWAFNTESLTEPMRPNQGNS  829

Query  509  PXNxggxsggGAVNSXNXXGYXKQXQGFFX------KPXDXGSXXSSNKTEQTAPRLAPP  348
              N    +GG  +N+ N  G+ KQ QG         K  D GS  +S+K+E TAPRLAPP
Sbjct  830  SLNTNSLNGG-GLNTQNSLGFMKQNQGVSTYGVSSEKTMDLGSIFASSKSEHTAPRLAPP  888

Query  347  PSTAIgrgrgrgrGNQGQL  291
            P+TA+GRGRGRGRGNQGQL
Sbjct  889  PATAVGRGRGRGRGNQGQL  907



>ref|XP_009763333.1| PREDICTED: SCY1-like protein 2, partial [Nicotiana sylvestris]
Length=723

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 75/139 (54%), Gaps = 12/139 (9%)
 Frame = -2

Query  677  STVAXKPXNNGTXASPFNMHGSSNSTSNPXPLDS----LSSWXXGXSXFTEPLKPNQGNX  510
            S+VA    NNG+ A   N   S+NS +    L+S    L SW       + PLK NQG  
Sbjct  564  SSVASHSLNNGSVAPFANRPVSANSATLLNGLNSQTNGLDSWAFSTPISSRPLKQNQGTA  623

Query  509  PXNxggxsggGAVNSXNXXGYXKQXQG------FFXKPXDXGSXXSSNKTEQTAPRLAPP  348
              +       G  N  N  G+ KQ QG         +  D GS  SSNK EQTAPRLAPP
Sbjct  624  --SHTDSLTSGGFNPQNSLGFMKQSQGPSAMNASSGRANDIGSIFSSNKGEQTAPRLAPP  681

Query  347  PSTAIgrgrgrgrGNQGQL  291
            PSTA+GRGRGRGRGNQGQL
Sbjct  682  PSTAVGRGRGRGRGNQGQL  700



>ref|XP_007019921.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
 gb|EOY17146.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
Length=933

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 77/146 (53%), Gaps = 17/146 (12%)
 Frame = -2

Query  653  NNGTXASPFNMHGSSNSTSNPXPL----DSLSSWXXGXSXFTEPLKPNQGNXPXNxggxs  486
            NNGT     N +GSS+ TS P  L    D+  SW        EPL+PNQG+   N    +
Sbjct  785  NNGTRGPATNNYGSSSITSTPNNLSYQTDNSDSWAFSNQYSGEPLRPNQGSSTLNTSILN  844

Query  485  ggGAVNSXNXXGYXKQXQGFFX---------KPXDXGSXXSSNKTEQTAPRLAPPPSTAI  333
             GG  NS    G+ KQ QG            K  D GS   S+K EQ AP+LAPPPSTA+
Sbjct  845  SGGLQNSL---GFKKQNQGISASVTTSYNNHKSTDLGSIFGSSKNEQAAPKLAPPPSTAV  901

Query  332  grgrgrgrGNQGQLSRPSXAKPWXEQ  255
            GRGRGRGRG     SR S AKP  EQ
Sbjct  902  GRGRGRGRGGSST-SRASHAKPTPEQ  926



>ref|XP_009601552.1| PREDICTED: SCY1-like protein 2 [Nicotiana tomentosiformis]
Length=933

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 74/139 (53%), Gaps = 12/139 (9%)
 Frame = -2

Query  677  STVAXKPXNNGTXASPFNMHGSSNSTSNPXPLDS----LSSWXXGXSXFTEPLKPNQGNX  510
            S+ A    NNG+ A   N   S+NS +    L+S    L SW       ++PLK NQG  
Sbjct  774  SSAASHSLNNGSVAPFANRPVSANSATLLNGLNSQTNGLDSWAFSTPISSQPLKQNQGTA  833

Query  509  PXNxggxsggGAVNSXNXXGYXKQXQG------FFXKPXDXGSXXSSNKTEQTAPRLAPP  348
              +          N  N  G+ KQ QG         +  D GS  SSNK EQTAPRLAPP
Sbjct  834  --SHTDGLTSWGFNPQNSVGFMKQSQGPSAMNASSGRANDIGSIFSSNKGEQTAPRLAPP  891

Query  347  PSTAIgrgrgrgrGNQGQL  291
            PSTA+GRGRGRGRGNQGQL
Sbjct  892  PSTAVGRGRGRGRGNQGQL  910



>ref|XP_007019922.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
 gb|EOY17147.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
Length=934

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 77/146 (53%), Gaps = 17/146 (12%)
 Frame = -2

Query  653  NNGTXASPFNMHGSSNSTSNPXPL----DSLSSWXXGXSXFTEPLKPNQGNXPXNxggxs  486
            NNGT     N +GSS+ TS P  L    D+  SW        EPL+PNQG+   N    +
Sbjct  786  NNGTRGPATNNYGSSSITSTPNNLSYQTDNSDSWAFSNQYSGEPLRPNQGSSTLNTSILN  845

Query  485  ggGAVNSXNXXGYXKQXQGFFX---------KPXDXGSXXSSNKTEQTAPRLAPPPSTAI  333
             GG  NS    G+ KQ QG            K  D GS   S+K EQ AP+LAPPPSTA+
Sbjct  846  SGGLQNSL---GFKKQNQGISASVTTSYNNHKSTDLGSIFGSSKNEQAAPKLAPPPSTAV  902

Query  332  grgrgrgrGNQGQLSRPSXAKPWXEQ  255
            GRGRGRGRG     SR S AKP  EQ
Sbjct  903  GRGRGRGRGGSST-SRASHAKPTPEQ  927



>ref|XP_006362717.1| PREDICTED: SCY1-like protein 2-like [Solanum tuberosum]
Length=935

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 76/140 (54%), Gaps = 12/140 (9%)
 Frame = -2

Query  677  STVAXKPXNNGTXASPFNMHGSSNSTSNPXPLDS----LSSWXXGXSXFTEPLKPNQGNX  510
            S+ A    NNGT A   N   S+NS +    L+S    L SW       ++PLK NQG  
Sbjct  774  SSAASHSLNNGTMAPFANRPVSNNSATLLNGLNSQTNGLDSWAFSTPISSQPLKQNQG-I  832

Query  509  PXNxggxsggGAVNSXNXXGYXKQXQGFFX-------KPXDXGSXXSSNKTEQTAPRLAP  351
                   S GG +NS +  G+ K  QG          +  D GS  SSNK E TAPRLAP
Sbjct  833  TSRTDSISSGGGLNSQSSLGFMKHSQGSSSALGASSGRATDIGSIFSSNKGEPTAPRLAP  892

Query  350  PPSTAIgrgrgrgrGNQGQL  291
            PPSTA+GRGRGRGRGNQGQL
Sbjct  893  PPSTAVGRGRGRGRGNQGQL  912



>ref|XP_010063716.1| PREDICTED: SCY1-like protein 2 [Eucalyptus grandis]
 gb|KCW70965.1| hypothetical protein EUGRSUZ_F04075 [Eucalyptus grandis]
Length=916

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 7/54 (13%)
 Frame = -2

Query  473  VNSXNXXGYXKQXQG-------FFXKPXDXGSXXSSNKTEQTAPRLAPPPSTAI  333
            V+S N  GY KQ QG          KP D GS  SSNK+EQTAPRLAPPPSTA+
Sbjct  833  VSSQNSLGYLKQSQGNMSSSFNLDKKPSDIGSIFSSNKSEQTAPRLAPPPSTAV  886



>ref|XP_007201757.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
 gb|EMJ02956.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
Length=923

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 63/146 (43%), Gaps = 13/146 (9%)
 Frame = -2

Query  659  PXNNGTXASPFNMHG--SSNSTSNPXPLDSLS--SWXXGXSXFTEPLKPNQGNXPXNxgg  492
            P NNG   SP N +G  S +STSN   L S    SW  G     E +  NQGN   N G 
Sbjct  773  PSNNGAIESPRNKYGPNSLSSTSNSMNLYSNDNDSWAFGTQSSVEQIGLNQGNATLNTGS  832

Query  491  xsggGAVNSXNXXGYXKQXQGFFX-------KPXDXGSXXSSNKTEQTAPRLAPPPSTAI  333
                   N  +  G+ KQ Q           K  D GS  +S    QTAPRLAPPPSTA+
Sbjct  833  LGSS-GFNPQSSIGFLKQTQSISASSAYTDKKSADLGSIFASGNNAQTAPRLAPPPSTAV  891

Query  332  grgrgrgrGNQGQLSRPSXAKPWXEQ  255
                         +SR S AK   EQ
Sbjct  892  -GRGRGRGKGASSVSRSSHAKSASEQ  916



>ref|XP_008237746.1| PREDICTED: SCY1-like protein 2 [Prunus mume]
Length=929

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 55/120 (46%), Gaps = 12/120 (10%)
 Frame = -2

Query  659  PXNNGTXASPFNMHG--SSNSTSNPXPLDSLS--SWXXGXSXFTEPLKPNQGNXPXNxgg  492
            P NNG   SP N +G  S +STSN   L S    SW  G     E +  NQGN   N G 
Sbjct  779  PSNNGAIESPRNKYGPNSFSSTSNSMNLYSNDNDSWAFGTQSSVEQIGLNQGNATLNTGS  838

Query  491  xsggGAVNSXNXXGYXKQXQGFFX-------KPXDXGSXXSSNKTEQTAPRLAPPPSTAI  333
                   +  +  G+ KQ Q           K  D GS  +S    QTAPRLAPPPSTA+
Sbjct  839  LGSS-GFDPQSSIGFLKQTQSISASSAYTDKKSADLGSIFASGNNAQTAPRLAPPPSTAV  897



>ref|XP_002525488.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF36846.1| ATP binding protein, putative [Ricinus communis]
Length=916

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 71/144 (49%), Gaps = 17/144 (12%)
 Frame = -2

Query  653  NNGTXASPFNMHGSSNSTSNPXPLDSLS----SWXXGXSXFTEPLKPNQGNXPXNxggxs  486
            NNG+     N + ++ STS P  L+  S    SW        EPLK NQG         S
Sbjct  772  NNGSVGLLANNYVTNLSTSTPSSLNFQSNGNNSWAFNNQSSFEPLKSNQG-----LNAGS  826

Query  485  ggGAVNSXNXXGYXKQXQGFFX-------KPXDXGSXXSSNKTEQTAPRLAPPPSTAIgr  327
                V+S N  G  KQ Q           K  D GS   S+K EQ AP+LAPPPSTA+GR
Sbjct  827  LNSGVSSQNSIGLMKQNQNMSILGSYNDKKSTDLGSIFGSSKNEQLAPKLAPPPSTAVGR  886

Query  326  grgrgrGNQGQLSRPSXAKPWXEQ  255
            GRGRGRG     +R S AKP  EQ
Sbjct  887  GRGRGRGASSS-TRTSHAKPQAEQ  909



>gb|KDO37207.1| hypothetical protein CISIN_1g033834mg [Citrus sinensis]
Length=110

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = -2

Query  473  VNSXNXXGYXKQXQGF--FXKPXDXGSXXSSNKTEQTAPRLAPPPSTAIgrgrgrgrGNQ  300
            +N+ N  G+ KQ Q      K  D GS  SS+KTEQTAP+LAPPPS  I           
Sbjct  30   LNNLNSIGFMKQTQSVNSDKKSNDLGSIFSSSKTEQTAPKLAPPPSN-IVGRGRGRGRGV  88

Query  299  GQLSRPSXAKPWXEQ  255
               SRPS  KP  EQ
Sbjct  89   ITTSRPSHVKPSSEQ  103



>gb|KDP45586.1| hypothetical protein JCGZ_17193 [Jatropha curcas]
Length=929

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 43/86 (50%), Gaps = 9/86 (10%)
 Frame = -2

Query  569  SWXXGXSXFTEPLKPNQGNXPXNxggxsggGAVNSXNXXGYXKQXQGFFX-------KPX  411
            SW        EP+KPNQG    N G  S    VN  N  G+ KQ QG          K  
Sbjct  814  SWAFNGQNSFEPMKPNQGTSTMNTGSLSS--GVNPQNSLGFLKQNQGMSTLGSYNEKKST  871

Query  410  DXGSXXSSNKTEQTAPRLAPPPSTAI  333
            D  S  SS+K +Q AP+LAPPPSTA+
Sbjct  872  DLESIFSSSKNDQPAPKLAPPPSTAV  897



>ref|XP_011004854.1| PREDICTED: SCY1-like protein 2 [Populus euphratica]
Length=928

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 76/144 (53%), Gaps = 14/144 (10%)
 Frame = -2

Query  653  NNGTXASPFNMHGSSNSTSNPXPLDSLS----SWXXGXSXFTEPLKPNQGNXPXNxggxs  486
            NNGT     N + S+  T+ P  ++  +    SW        +PLKPNQG    N G  +
Sbjct  781  NNGTTGLQPNSYSSNLITNTPDIMNFQNKGNISWAFNNQSSLDPLKPNQGTSAVNSGSLN  840

Query  485  ggGAVNSXNXXGYXKQXQ-----GFF--XKPXDXGSXXSSNKTEQTAPRLAPPPSTAIgr  327
             G   N  +  G+ KQ Q     G +   KP D GS   S+K EQTA +LAPPPS+A+GR
Sbjct  841  SGP--NPQSSIGFLKQNQNTSTLGSYNNTKPTDLGSIFGSSKNEQTAVKLAPPPSSAVGR  898

Query  326  grgrgrGNQGQLSRPSXAKPWXEQ  255
            GRGRGRG    L R S AKP  EQ
Sbjct  899  GRGRGRGGTSTL-RSSHAKPQSEQ  921



>gb|KDO45467.1| hypothetical protein CISIN_1g0453202mg, partial [Citrus sinensis]
Length=91

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 38/75 (51%), Gaps = 3/75 (4%)
 Frame = -2

Query  473  VNSXNXXGYXKQXQGF--FXKPXDXGSXXSSNKTEQTAPRLAPPPSTAIgrgrgrgrGNQ  300
            +N+ N  G+ KQ Q      K  D GS  SS+KTEQTAP+LAPPPS              
Sbjct  11   LNNLNSIGFMKQTQSINSDKKSNDLGSIFSSSKTEQTAPKLAPPPSNV-VGRGRGRGRGV  69

Query  299  GQLSRPSXAKPWXEQ  255
               SRPS  KP  EQ
Sbjct  70   ITTSRPSHVKPSSEQ  84



>gb|KJB60121.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=932

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 17/121 (14%)
 Frame = -2

Query  653  NNGTXASP-FNMHGSSNSTSNPXPLD-----SLSSWXXGXSXFTEPLKPNQGNXPXNxgg  492
            NNG    P  N +G S+ TS P  ++     S +SW        E L+PN G+   N G 
Sbjct  783  NNGIMGGPGMNNYGFSSITSTPGTMNHPTESSSNSWGFSNQNSGEILRPNHGSSTSNTGI  842

Query  491  xsggGAVNSXNXXGYXKQXQGFFX--------KPXDXGSXXSSNKTEQTAPRLAPPPSTA  336
             +GG   +S +  G+ KQ +G           K  D GS   S+K EQTAP+LAPPPSTA
Sbjct  843  LNGG---SSQSSIGFLKQNRGISASMSSYNNQKSADLGSIFGSSKNEQTAPKLAPPPSTA  899

Query  335  I  333
            +
Sbjct  900  V  900



>gb|KJB60122.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=545

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 17/121 (14%)
 Frame = -2

Query  653  NNGTXASP-FNMHGSSNSTSNPXPLD-----SLSSWXXGXSXFTEPLKPNQGNXPXNxgg  492
            NNG    P  N +G S+ TS P  ++     S +SW        E L+PN G+   N G 
Sbjct  396  NNGIMGGPGMNNYGFSSITSTPGTMNHPTESSSNSWGFSNQNSGEILRPNHGSSTSNTGI  455

Query  491  xsggGAVNSXNXXGYXKQXQGFFX--------KPXDXGSXXSSNKTEQTAPRLAPPPSTA  336
             +GG   +S +  G+ KQ +G           K  D GS   S+K EQTAP+LAPPPSTA
Sbjct  456  LNGG---SSQSSIGFLKQNRGISASMSSYNNQKSADLGSIFGSSKNEQTAPKLAPPPSTA  512

Query  335  I  333
            +
Sbjct  513  V  513



>gb|KJB60123.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=701

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 17/121 (14%)
 Frame = -2

Query  653  NNGTXASP-FNMHGSSNSTSNPXPLD-----SLSSWXXGXSXFTEPLKPNQGNXPXNxgg  492
            NNG    P  N +G S+ TS P  ++     S +SW        E L+PN G+   N G 
Sbjct  552  NNGIMGGPGMNNYGFSSITSTPGTMNHPTESSSNSWGFSNQNSGEILRPNHGSSTSNTGI  611

Query  491  xsggGAVNSXNXXGYXKQXQGFFX--------KPXDXGSXXSSNKTEQTAPRLAPPPSTA  336
             +GG   +S +  G+ KQ +G           K  D GS   S+K EQTAP+LAPPPSTA
Sbjct  612  LNGG---SSQSSIGFLKQNRGISASMSSYNNQKSADLGSIFGSSKNEQTAPKLAPPPSTA  668

Query  335  I  333
            +
Sbjct  669  V  669



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240