BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019A07

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...    117   2e-25   Nicotiana tomentosiformis
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...    116   2e-25   Nicotiana tomentosiformis
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...    114   2e-24   Nicotiana sylvestris
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...    114   2e-24   Nicotiana sylvestris
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...    113   2e-24   Nicotiana sylvestris
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...    107   3e-22   Solanum tuberosum [potatoes]
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...    107   3e-22   Solanum tuberosum [potatoes]
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...    107   3e-22   Solanum tuberosum [potatoes]
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...    104   4e-21   Solanum lycopersicum
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...    104   4e-21   Solanum lycopersicum
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...    103   4e-21   Solanum lycopersicum
emb|CDP09782.1|  unnamed protein product                              80.5    1e-13   Coffea canephora [robusta coffee]
gb|KDO55600.1|  hypothetical protein CISIN_1g0013391mg                76.6    2e-12   Citrus sinensis [apfelsine]
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg           76.6    3e-12   Citrus clementina [clementine]
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg           76.6    3e-12   Citrus clementina [clementine]
gb|KDO55596.1|  hypothetical protein CISIN_1g0013391mg                76.3    3e-12   Citrus sinensis [apfelsine]
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg           76.6    3e-12   
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266  76.3    3e-12   
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188  72.4    5e-11   Cucumis sativus [cucumbers]
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  71.6    8e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  71.6    8e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010255469.1|  PREDICTED: uncharacterized protein LOC104596...  71.6    8e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...  70.9    1e-10   Vitis vinifera
ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.5    1e-10   Vitis vinifera
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.9    1e-10   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.5    2e-10   Vitis vinifera
ref|XP_010661030.1|  PREDICTED: uncharacterized protein LOC104881692  68.9    3e-10   Vitis vinifera
emb|CBI34715.3|  unnamed protein product                              70.1    3e-10   Vitis vinifera
ref|XP_002509754.1|  hypothetical protein RCOM_1685990                69.7    4e-10   
ref|XP_010089149.1|  hypothetical protein L484_024324                 68.6    9e-10   
emb|CBI34714.3|  unnamed protein product                              68.2    1e-09   Vitis vinifera
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    8e-09   Nelumbo nucifera [Indian lotus]
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...  65.5    9e-09   Fragaria vesca subsp. vesca
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...  65.5    1e-08   Fragaria vesca subsp. vesca
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       64.3    3e-08   Glycine soja [wild soybean]
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  64.3    3e-08   Glycine max [soybeans]
gb|KDP25474.1|  hypothetical protein JCGZ_20630                       63.9    3e-08   Jatropha curcas
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357  62.0    2e-07   Cicer arietinum [garbanzo]
ref|XP_007211158.1|  hypothetical protein PRUPE_ppa027142mg           61.6    2e-07   
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           61.6    2e-07   Phaseolus vulgaris [French bean]
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  61.6    2e-07   Glycine max [soybeans]
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       61.6    2e-07   Glycine soja [wild soybean]
gb|KEH21030.1|  methyl-CpG-binding domain protein                     60.5    5e-07   Medicago truncatula
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798  60.1    7e-07   
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...  60.1    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  59.7    8e-07   
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  59.7    8e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...  59.7    8e-07   
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  59.7    8e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008367419.1|  PREDICTED: uncharacterized protein LOC103431052  59.3    1e-06   
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  58.9    1e-06   Phoenix dactylifera
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...  58.9    1e-06   Phoenix dactylifera
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...  58.9    1e-06   Phoenix dactylifera
ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  58.9    1e-06   Phoenix dactylifera
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...  58.9    2e-06   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...  58.9    2e-06   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...  58.5    2e-06   Phoenix dactylifera
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...  58.5    2e-06   Phoenix dactylifera
ref|XP_010918515.1|  PREDICTED: uncharacterized protein LOC105042867  57.0    2e-06   
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513  58.2    3e-06   
ref|XP_011041594.1|  PREDICTED: uncharacterized protein LOC105137...  57.4    5e-06   Populus euphratica
ref|XP_011041592.1|  PREDICTED: uncharacterized protein LOC105137...  57.4    5e-06   Populus euphratica
ref|XP_010035118.1|  PREDICTED: methyl-CpG-binding domain-contain...  57.0    6e-06   Eucalyptus grandis [rose gum]
ref|XP_011041590.1|  PREDICTED: uncharacterized protein LOC105137...  57.0    6e-06   Populus euphratica
ref|XP_011041593.1|  PREDICTED: uncharacterized protein LOC105137...  57.0    6e-06   Populus euphratica
ref|XP_010035117.1|  PREDICTED: uncharacterized protein LOC104424...  57.0    6e-06   Eucalyptus grandis [rose gum]
ref|XP_009401689.1|  PREDICTED: uncharacterized protein LOC103985...  57.0    6e-06   
ref|XP_011041591.1|  PREDICTED: uncharacterized protein LOC105137...  57.0    6e-06   Populus euphratica
ref|XP_011041595.1|  PREDICTED: uncharacterized protein LOC105137...  57.0    6e-06   Populus euphratica
ref|XP_007038660.1|  Methyl-CPG-binding domain protein 13, putati...  56.6    8e-06   
gb|EYU38370.1|  hypothetical protein MIMGU_mgv1a007205mg              56.2    8e-06   Erythranthe guttata [common monkey flower]
ref|XP_009401688.1|  PREDICTED: uncharacterized protein LOC103985...  56.2    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007038659.1|  Methyl-CPG-binding domain protein 13, putati...  56.2    1e-05   
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...  56.2    1e-05   
ref|XP_002318826.1|  hypothetical protein POPTR_0012s13490g           55.8    2e-05   
ref|XP_011048656.1|  PREDICTED: uncharacterized protein LOC105142...  55.1    3e-05   Populus euphratica
ref|XP_011048654.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.1    3e-05   Populus euphratica
gb|KJB52812.1|  hypothetical protein B456_008G278300                  54.7    3e-05   Gossypium raimondii
ref|XP_011048657.1|  PREDICTED: uncharacterized protein LOC105142...  55.1    3e-05   Populus euphratica
ref|XP_011048652.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.1    3e-05   Populus euphratica
ref|XP_011048653.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.1    3e-05   Populus euphratica
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...  54.7    3e-05   Cucumis melo [Oriental melon]
gb|EMT07793.1|  hypothetical protein F775_13908                       55.1    3e-05   
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...  54.7    4e-05   Cucumis melo [Oriental melon]
ref|XP_007040167.1|  Uncharacterized protein TCM_016211               54.7    4e-05   
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...  54.7    4e-05   Cucumis melo [Oriental melon]
ref|XP_002321896.2|  hypothetical protein POPTR_0015s13470g           54.7    4e-05   Populus trichocarpa [western balsam poplar]
gb|KJB52811.1|  hypothetical protein B456_008G278300                  54.3    5e-05   Gossypium raimondii
gb|KHG28622.1|  Methyl-CpG-binding domain-containing 13 -like pro...  54.3    5e-05   Gossypium arboreum [tree cotton]
ref|XP_006421894.1|  hypothetical protein CICLE_v10004647mg           53.9    5e-05   
gb|KDO60034.1|  hypothetical protein CISIN_1g008463mg                 53.9    6e-05   Citrus sinensis [apfelsine]
gb|KDO60032.1|  hypothetical protein CISIN_1g008463mg                 53.9    6e-05   Citrus sinensis [apfelsine]
gb|KDO60033.1|  hypothetical protein CISIN_1g008463mg                 53.9    6e-05   Citrus sinensis [apfelsine]
ref|XP_006490367.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    6e-05   Citrus sinensis [apfelsine]
ref|XP_006421896.1|  hypothetical protein CICLE_v10004647mg           53.9    6e-05   Citrus clementina [clementine]
ref|XP_011012359.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    7e-05   Populus euphratica
ref|XP_006421895.1|  hypothetical protein CICLE_v10004647mg           53.5    7e-05   
ref|XP_011030071.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    7e-05   Populus euphratica
ref|XP_011012358.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    7e-05   Populus euphratica
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g           53.9    7e-05   Phaseolus vulgaris [French bean]
ref|XP_011012360.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    7e-05   Populus euphratica
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g           53.9    7e-05   Phaseolus vulgaris [French bean]
ref|XP_011030072.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    7e-05   Populus euphratica
ref|XP_011030070.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.9    7e-05   Populus euphratica
ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g           53.9    8e-05   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g           53.9    8e-05   Phaseolus vulgaris [French bean]
gb|KDP22300.1|  hypothetical protein JCGZ_26131                       52.8    1e-04   Jatropha curcas
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...  52.8    1e-04   Sesamum indicum [beniseed]
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...  52.8    2e-04   Sesamum indicum [beniseed]
ref|XP_008238901.1|  PREDICTED: uncharacterized protein LOC103337519  50.8    3e-04   Prunus mume [ume]
ref|XP_006659212.1|  PREDICTED: uncharacterized protein LOC102718198  52.0    4e-04   Oryza brachyantha
ref|XP_010934850.1|  PREDICTED: uncharacterized protein LOC105054...  51.2    4e-04   
gb|EMS57086.1|  Methyl-CpG-binding domain-containing protein 13       51.6    4e-04   Triticum urartu
ref|XP_010934849.1|  PREDICTED: uncharacterized protein LOC105054...  51.2    5e-04   
ref|XP_008678194.1|  PREDICTED: uncharacterized protein LOC103652994  51.2    5e-04   Zea mays [maize]
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  51.2    5e-04   
ref|XP_010934848.1|  PREDICTED: uncharacterized protein LOC105054...  51.2    5e-04   Elaeis guineensis
gb|AFW61002.1|  hypothetical protein ZEAMMB73_269384                  51.2    5e-04   
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...  51.2    6e-04   Elaeis guineensis
ref|XP_004308099.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.4    6e-04   Fragaria vesca subsp. vesca
ref|XP_004972592.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    7e-04   Setaria italica
gb|AFW56991.1|  hypothetical protein ZEAMMB73_310321                  50.8    7e-04   
ref|XP_008662741.1|  PREDICTED: uncharacterized protein LOC103641...  50.8    8e-04   Zea mays [maize]
ref|XP_008662742.1|  PREDICTED: uncharacterized protein LOC103641...  50.8    8e-04   Zea mays [maize]
dbj|BAK01530.1|  predicted protein                                    50.8    8e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE68228.1|  hypothetical protein OsJ_26412                        50.4    9e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 101/155 (65%), Gaps = 8/155 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  +  +L+     YPFGD WSDPCLEFAFKTLTGAIPVED 
Sbjct  1838  VENQPVREKQTGELVTENQDEQSRRLQAQLASYPFGDYWSDPCLEFAFKTLTGAIPVEDT  1897

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFPSSNSGQLDKHASQDlppstpp  342
             LA++ + Q +FN SY Q+ DG F+LP+F++ + + ND P S+    ++H  Q+ PP T  
Sbjct  1898  LAFQGSSQQEFNTSYTQADDGCFELPLFNTSSFYMNDVP-SHCAPSEEHVPQEQPPITQT  1956

Query  341   llspgnnglpSCSGVASQ-PHLEPR-KDFPAKAKS  243
              L  G+N +P CS V SQ P L+ + KD+ +K KS
Sbjct  1957  FLPTGSNSMPGCSSVVSQSPGLDTQAKDYQSKVKS  1991



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 101/155 (65%), Gaps = 8/155 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  +  +L+     YPFGD WSDPCLEFAFKTLTGAIPVED 
Sbjct  1567  VENQPVREKQTGELVTENQDEQSRRLQAQLASYPFGDYWSDPCLEFAFKTLTGAIPVEDT  1626

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFPSSNSGQLDKHASQDlppstpp  342
             LA++ + Q +FN SY Q+ DG F+LP+F++ + + ND P S+    ++H  Q+ PP T  
Sbjct  1627  LAFQGSSQQEFNTSYTQADDGCFELPLFNTSSFYMNDVP-SHCAPSEEHVPQEQPPITQT  1685

Query  341   llspgnnglpSCSGVASQ-PHLEPR-KDFPAKAKS  243
              L  G+N +P CS V SQ P L+ + KD+ +K KS
Sbjct  1686  FLPTGSNSMPGCSSVVSQSPGLDTQAKDYQSKVKS  1720



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  +  +L+     YPFGD WSDPC+EFAFKTLTGAIPVED 
Sbjct  1709  VENQPVREKQTGELVTENQDEQSRRLQAQLASYPFGDYWSDPCMEFAFKTLTGAIPVEDT  1768

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFPS  402
             LA++ + Q +FN SY Q+ DG F+LP+F++ + + ND PS
Sbjct  1769  LAFQGSSQQEFNTSYTQADDGCFELPLFNTSSFYMNDVPS  1808



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  +  +L+     YPFGD WSDPC+EFAFKTLTGAIPVED 
Sbjct  1712  VENQPVREKQTGELVTENQDEQSRRLQAQLASYPFGDYWSDPCMEFAFKTLTGAIPVEDT  1771

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFPS  402
             LA++ + Q +FN SY Q+ DG F+LP+F++ + + ND PS
Sbjct  1772  LAFQGSSQQEFNTSYTQADDGCFELPLFNTSSFYMNDVPS  1811



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  +  +L+     YPFGD WSDPC+EFAFKTLTGAIPVED 
Sbjct  1441  VENQPVREKQTGELVTENQDEQSRRLQAQLASYPFGDYWSDPCMEFAFKTLTGAIPVEDT  1500

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFPS  402
             LA++ + Q +FN SY Q+ DG F+LP+F++ + + ND PS
Sbjct  1501  LAFQGSSQQEFNTSYTQADDGCFELPLFNTSSFYMNDVPS  1540



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  ++ +L      YPFGD WSDPC+EFAFKTLTGA+PVED 
Sbjct  1667  VESQPVKEKQTGELVTENQDEQNRRLHAQLASYPFGDYWSDPCMEFAFKTLTGALPVEDT  1726

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP  405
             LA++ +   ++N SY Q+ DG F+LP+F++ + + ND P
Sbjct  1727  LAFQGSTHQEYNTSYTQADDGCFELPLFNTSSFYLNDAP  1765



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  ++ +L      YPFGD WSDPC+EFAFKTLTGA+PVED 
Sbjct  1623  VESQPVKEKQTGELVTENQDEQNRRLHAQLASYPFGDYWSDPCMEFAFKTLTGALPVEDT  1682

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP  405
             LA++ +   ++N SY Q+ DG F+LP+F++ + + ND P
Sbjct  1683  LAFQGSTHQEYNTSYTQADDGCFELPLFNTSSFYLNDAP  1721



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             VE + V E    E VTENQ  ++ +L      YPFGD WSDPC+EFAFKTLTGA+PVED 
Sbjct  1627  VESQPVKEKQTGELVTENQDEQNRRLHAQLASYPFGDYWSDPCMEFAFKTLTGALPVEDT  1686

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP  405
             LA++ +   ++N SY Q+ DG F+LP+F++ + + ND P
Sbjct  1687  LAFQGSTHQEYNTSYTQADDGCFELPLFNTSSFYLNDAP  1725



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score =   104 bits (259),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             V+ + V E    E VTENQ  ++ +L      YPFGD WSDPC+EFAFKTLTGA+PVED 
Sbjct  1674  VDSQPVKEKQTGELVTENQDEQNRRLHAQLASYPFGDYWSDPCMEFAFKTLTGALPVEDT  1733

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP  405
             L ++ +   ++N SY Q+ DG F+LP+F++ + + ND P
Sbjct  1734  LTFQGSTHQEYNTSYTQADDGCFELPLFNTSSFYLNDAP  1772



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score =   104 bits (259),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             V+ + V E    E VTENQ  ++ +L      YPFGD WSDPC+EFAFKTLTGA+PVED 
Sbjct  1708  VDSQPVKEKQTGELVTENQDEQNRRLHAQLASYPFGDYWSDPCMEFAFKTLTGALPVEDT  1767

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP  405
             L ++ +   ++N SY Q+ DG F+LP+F++ + + ND P
Sbjct  1768  LTFQGSTHQEYNTSYTQADDGCFELPLFNTSSFYLNDAP  1806



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = -3

Query  686   VEKEAVSENPIPEPVTENQTLEDSQLR-----YPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
             V+ + V E    E VTENQ  ++ +L      YPFGD WSDPC+EFAFKTLTGA+PVED 
Sbjct  1668  VDSQPVKEKQTGELVTENQDEQNRRLHAQLASYPFGDYWSDPCMEFAFKTLTGALPVEDT  1727

Query  521   LAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP  405
             L ++ +   ++N SY Q+ DG F+LP+F++ + + ND P
Sbjct  1728  LTFQGSTHQEYNTSYTQADDGCFELPLFNTSSFYLNDAP  1766



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  638  ENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDG  459
            ENQ  +DSQ  YPFGD +SDPC EFAFKTLTG IP+ED LA+    Q Q   S+ +  + 
Sbjct  689  ENQRSQDSQFWYPFGDSFSDPCYEFAFKTLTGEIPLEDTLAFPGCFQQQIETSFTE-GNA  747

Query  458  YFDLPIFDSYNLFPNDFPS  402
             F L   D   LF ND PS
Sbjct  748  SFGLSEIDKPALFQNDVPS  766



>gb|KDO55600.1| hypothetical protein CISIN_1g0013391mg, partial [Citrus sinensis]
Length=670

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPI  441
            DSQ+  P+GD WSDPCLEFAFKTLTGAIPV++ LA +   Q Q +PS  Q  D    +P 
Sbjct  557  DSQVLLPYGDSWSDPCLEFAFKTLTGAIPVDENLAIQDYFQHQLDPSDTQ-KDNSLAMPE  615

Query  440  FDSYNLFPNDFP  405
            F     F  D P
Sbjct  616  FGPIKSFQTDVP  627



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  620   DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPI  441
             DSQ+  P+GD WSDPCLEFAFKTLTGAIPV++ LA +   Q Q +PS  Q  D    +P 
Sbjct  981   DSQVLLPYGDSWSDPCLEFAFKTLTGAIPVDENLAIQDYFQHQLDPSDTQ-KDNSLAMPE  1039

Query  440   FDSYNLFPNDFP  405
             F     F  D P
Sbjct  1040  FGPIKSFQTDVP  1051



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  620   DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPI  441
             DSQ+  P+GD WSDPCLEFAFKTLTGAIPV++ LA +   Q Q +PS  Q  D    +P 
Sbjct  952   DSQVLLPYGDSWSDPCLEFAFKTLTGAIPVDENLAIQDYFQHQLDPSDTQ-KDNSLAMPE  1010

Query  440   FDSYNLFPNDFP  405
             F     F  D P
Sbjct  1011  FGPIKSFQTDVP  1022



>gb|KDO55596.1| hypothetical protein CISIN_1g0013391mg, partial [Citrus sinensis]
 gb|KDO55597.1| hypothetical protein CISIN_1g0013391mg, partial [Citrus sinensis]
 gb|KDO55598.1| hypothetical protein CISIN_1g0013391mg, partial [Citrus sinensis]
 gb|KDO55599.1| hypothetical protein CISIN_1g0013391mg, partial [Citrus sinensis]
Length=800

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPI  441
            DSQ+  P+GD WSDPCLEFAFKTLTGAIPV++ LA +   Q Q +PS  Q  D    +P 
Sbjct  687  DSQVLLPYGDSWSDPCLEFAFKTLTGAIPVDENLAIQDYFQHQLDPSDTQ-KDNSLAMPE  745

Query  440  FDSYNLFPNDFP  405
            F     F  D P
Sbjct  746  FGPIKSFQTDVP  757



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  620   DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPI  441
             DSQ+  P+GD WSDPCLEFAFKTLTGAIPV++ LA +   Q Q +PS  Q  D    +P 
Sbjct  952   DSQVLLPYGDSWSDPCLEFAFKTLTGAIPVDENLAIQDYFQHQLDPSDTQ-KDNSLAMPE  1010

Query  440   FDSYNLFPNDFP  405
             F     F  D P
Sbjct  1011  FGPIKSFQTDVP  1022



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  620   DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPI  441
             DSQ+  P+GD WSDPCLEFAFKTLTGAIPV++ LA +   Q Q +PS  Q  D    +P 
Sbjct  983   DSQVLLPYGDSWSDPCLEFAFKTLTGAIPVDENLAIQDYFQHQLDPSDTQ-KDNSLAMPE  1041

Query  440   FDSYNLFPNDFP  405
             F     F  D P
Sbjct  1042  FGPIKSFQTDVP  1053



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDS  432
            L +PFGD W+DPCL+FAFKTLTGAIP++D L  +   + +   S +Q  D    LP F S
Sbjct  735  LSFPFGDSWADPCLDFAFKTLTGAIPIDDSLEIQSFFEERLESSRSQ-KDSSPALPDFGS  793

Query  431  YNLFPNDFPSSNSG  390
             NLF ND  S   G
Sbjct  794  PNLFQNDISSHFDG  807


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAY-EQAPQPQFNPSYAQSS  465
            ++QL  P  D WSDPCLEFA KTLTGA+PVE+     E    P  N    QSS
Sbjct  545  EAQLNVPIADFWSDPCLEFAIKTLTGALPVENATTTNEPVSNPTVNFLQGQSS  597



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 3/103 (3%)
 Frame = -3

Query  710  EPTKATESVEKEAVSENPIPEPVTENQTLE--DSQLRYPFGDCWSDPCLEFAFKTLTGAI  537
            EP+K +E    +   E+   +  T  Q  E  +S L  PFGD W DPCLEFAFKTLTG I
Sbjct  422  EPSKESERPVGDVFLEDITGKLETGKQAEEKPESPLVLPFGDSWPDPCLEFAFKTLTGEI  481

Query  536  PVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDF  408
            PVED LA E   Q QF+    QS+ G F LP     +    DF
Sbjct  482  PVEDTLAIEGYFQQQFSARQNQSNRG-FVLPDLGLESFCKTDF  523



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 3/103 (3%)
 Frame = -3

Query  710  EPTKATESVEKEAVSENPIPEPVTENQTLE--DSQLRYPFGDCWSDPCLEFAFKTLTGAI  537
            EP+K +E    +   E+   +  T  Q  E  +S L  PFGD W DPCLEFAFKTLTG I
Sbjct  427  EPSKESERPVGDVFLEDITGKLETGKQAEEKPESPLVLPFGDSWPDPCLEFAFKTLTGEI  486

Query  536  PVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDF  408
            PVED LA E   Q QF+    QS+ G F LP     +    DF
Sbjct  487  PVEDTLAIEGYFQQQFSARQNQSNRG-FVLPDLGLESFCKTDF  528



>ref|XP_010255469.1| PREDICTED: uncharacterized protein LOC104596134 isoform X3 [Nelumbo 
nucifera]
Length=543

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 3/103 (3%)
 Frame = -3

Query  710  EPTKATESVEKEAVSENPIPEPVTENQTLE--DSQLRYPFGDCWSDPCLEFAFKTLTGAI  537
            EP+K +E    +   E+   +  T  Q  E  +S L  PFGD W DPCLEFAFKTLTG I
Sbjct  393  EPSKESERPVGDVFLEDITGKLETGKQAEEKPESPLVLPFGDSWPDPCLEFAFKTLTGEI  452

Query  536  PVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDF  408
            PVED LA E   Q QF+    QS+ G F LP     +    DF
Sbjct  453  PVEDTLAIEGYFQQQFSARQNQSNRG-FVLPDLGLESFCKTDF  494



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLEFA
Sbjct  334  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEFA  393

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S     LP F
Sbjct  394  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNSS--LTLPDF  432



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLEFA
Sbjct  354  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEFA  413

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S     LP F
Sbjct  414  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNSS--LTLPDF  452



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLEFA
Sbjct  416  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEFA  475

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S     LP F
Sbjct  476  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNSS--LTLPDF  514



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLEFA
Sbjct  368  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEFA  427

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S     LP F
Sbjct  428  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNSS--LTLPDF  466



>ref|XP_010661030.1| PREDICTED: uncharacterized protein LOC104881692 [Vitis vinifera]
Length=299

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLE A
Sbjct  171  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEVA  230

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S     LP F
Sbjct  231  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNSS--LTLPDF  269



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLEFA
Sbjct  368  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEFA  427

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSS  465
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S
Sbjct  428  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNS  459



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -3

Query  605  YPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYF  453
            + FGDCWSDPC EFAFKTLTGAIPVED L  +   Q Q + S  Q  +GYF
Sbjct  841  FSFGDCWSDPCFEFAFKTLTGAIPVEDNLPVQSYFQQQIDTSQTQ-REGYF  890


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            +S+L  PFG+  SDPCLEFAFKTLTG IPVE
Sbjct  672  ESKLVPPFGEFLSDPCLEFAFKTLTGEIPVE  702



>ref|XP_010089149.1| hypothetical protein L484_024324 [Morus notabilis]
 gb|EXB37396.1| hypothetical protein L484_024324 [Morus notabilis]
Length=676

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 63/127 (50%), Gaps = 13/127 (10%)
 Frame = -3

Query  605  YPFGDCWSDPCLEFAFKTLTGAIPVEDCLA----YEQAPQPQFNPSYAQSSDGYFDLPIF  438
            +   D WSDPCL+FAFKTLTG IP+ED LA     EQ   P          +G   LP F
Sbjct  557  FSIADYWSDPCLDFAFKTLTGVIPIEDTLAQGCFQEQVDVPD------NCKNGNGALPDF  610

Query  437  DSYNLFPNDFPSSNSGQLDKHASQDlppstppllspgnnglpSCSGVAS--QPHLEPRKD  264
             S +LF  D  SS    L+K +S      T   L P N    SC+G+ S  QP LE  KD
Sbjct  611  GSSSLFETDI-SSQFDTLEKSSSSQQFAGTSASLPPQNLSFSSCNGIHSQQQPPLEANKD  669

Query  263  FPAKAKS  243
               K KS
Sbjct  670  LHQKVKS  676



>emb|CBI34714.3| unnamed protein product [Vitis vinifera]
Length=936

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQL---RYPFGDCWSDPCLEFA  561
            E P   ++  K    +E EAV E    +  T  +T ++ +L    +PF D WSDPCLE A
Sbjct  268  EAPSDVEQSKKDNRHLEDEAVQEEEAGKLETGKKTGDEPELPPMDFPFMDVWSDPCLEVA  327

Query  560  FKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSS  465
            FKTLTGAIP+ED L  E   Q Q + S+ Q+S
Sbjct  328  FKTLTGAIPIEDNLEIEGYFQQQIDSSHTQNS  359



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PFGD W DPCLEFAFKTLTGAIPVED LA E   Q Q + +  Q S+G F LP
Sbjct  436  LILPFGDTWPDPCLEFAFKTLTGAIPVEDTLAIEDYFQ-QLSTAQNQ-SNGDFTLP  489



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 66/129 (51%), Gaps = 27/129 (21%)
 Frame = -3

Query  749  NNLSDQEMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCL  570
             +L DQ +P   +E  +  E +EK AV ENP+            SQ  +PF D WSDPCL
Sbjct  830  RSLKDQAVP---EEKPRQLE-IEKAAV-ENPV------------SQFSFPFLDTWSDPCL  872

Query  569  EFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP-----  405
            +FAFKTLTG IP++D L ++   +     S+ Q       LP F S N FP+D       
Sbjct  873  DFAFKTLTGEIPIDDDL-FQGYFEENLVTSHNQRDS--MALPDFGSPNFFPSDISPQFNA  929

Query  404  --SSNSGQL  384
               S SGQL
Sbjct  930  PEQSTSGQL  938



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 66/129 (51%), Gaps = 27/129 (21%)
 Frame = -3

Query  749  NNLSDQEMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCL  570
             +L DQ +P   +E  +  E +EK AV ENP+            SQ  +PF D WSDPCL
Sbjct  809  RSLKDQAVP---EEKPRQLE-IEKAAV-ENPV------------SQFSFPFLDTWSDPCL  851

Query  569  EFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFP-----  405
            +FAFKTLTG IP++D L ++   +     S+ Q       LP F S N FP+D       
Sbjct  852  DFAFKTLTGEIPIDDDL-FQGYFEENLVTSHNQRDS--MALPDFGSPNFFPSDISPQFNA  908

Query  404  --SSNSGQL  384
               S SGQL
Sbjct  909  PEQSTSGQL  917



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = -3

Query  716   HDEPTKATESVEKEA--VSENPIPEPVTENQTLEDSQLRY--PFGDCWSDPCLEFAFKTL  549
             H+EP K    V +     +E  + E  T N   ++S+L+Y  PF + WSDPCLEFAFKTL
Sbjct  968   HEEPLKQNGQVVEGGFVTTEQQLFETGTVNH--DNSELQYCAPFMNSWSDPCLEFAFKTL  1025

Query  548   TGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDF  408
             TG IPVE+ L  +   Q   N  Y +  DG   LP   S     +DF
Sbjct  1026  TGVIPVEENLTLQGCFQEPVN--YHERRDGGSMLPDLGSSCFSQSDF  1070


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  614  QLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            QL  PFG+ WSDPCLEFA KTLTGA+PV+
Sbjct  833  QLPLPFGNSWSDPCLEFAIKTLTGALPVD  861



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = -3

Query  716   HDEPTKATESVEKEA--VSENPIPEPVTENQTLEDSQLRY--PFGDCWSDPCLEFAFKTL  549
             H+EP K    V +     +E  + E  T N   ++S+L+Y  PF + WSDPCLEFAFKTL
Sbjct  968   HEEPLKQNGQVVEGGFVTTEQQLFETGTVNH--DNSELQYCAPFMNSWSDPCLEFAFKTL  1025

Query  548   TGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDF  408
             TG IPVE+ L  +   Q   N  Y +  DG   LP   S     +DF
Sbjct  1026  TGVIPVEENLTLQGCFQEPVN--YHERRDGGSMLPDLGSSCFSQSDF  1070


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  614  QLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            QL  PFG+ WSDPCLEFA KTLTGA+PV+
Sbjct  833  QLPLPFGNSWSDPCLEFAIKTLTGALPVD  861



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -3

Query  605  YPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYF  453
            + F D WSDPC EFAFKTLTGAIP+ED L  +   Q Q + S  Q  DGYF
Sbjct  907  FSFADYWSDPCFEFAFKTLTGAIPIEDNLPVQNYLQQQVDTSQTQ-RDGYF  956


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  614  QLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            QL  PFG+  SDPCLEFAFKTLTG IPVE
Sbjct  714  QLIPPFGEFLSDPCLEFAFKTLTGEIPVE  742



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = -3

Query  716   HDEPTKATESVEKEAVSENPIPEPV-TENQTLEDSQLRY--PFGDCWSDPCLEFAFKTLT  546
             H+EP K    V +        P P+ TE    ++++L++   F + WSDPCLEFAFKTLT
Sbjct  1110  HEEPIKNNGQVAEGEFRTTEPPSPLQTETLNHDNAELQFCESFMNSWSDPCLEFAFKTLT  1169

Query  545   GAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
             G IPVE+ LA + + +   N  + +  DG   LP
Sbjct  1170  GVIPVEENLAIQGSIEEPAN--FHEGRDGGLALP  1201


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  641  TENQTLEDSQLRYP--FGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFN  486
             E +++ D + ++P  FG+ WSDPCLEFAFKTLTGA+PV+      +   P  N
Sbjct  784  VEAKSIGDDRSKHPLPFGESWSDPCLEFAFKTLTGALPVDSAAQIFKVTTPDVN  837



>ref|XP_007211158.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
 gb|EMJ12357.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
Length=747

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 60/114 (53%), Gaps = 20/114 (18%)
 Frame = -3

Query  749  NNLSDQEMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCL  570
            N L DQ +P++  +  +     EK A+ ENP            ++Q  +PF D WSDPCL
Sbjct  495  NFLEDQAIPQEKSQKFE----TEKAAI-ENP------------EAQFSFPFMDSWSDPCL  537

Query  569  EFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDF  408
            +FAFKTLTGAIP+ED L ++   Q +   S+         LP F S + F +D 
Sbjct  538  DFAFKTLTGAIPIEDDL-FQGYFQEKIETSHNHRDS--LALPDFGSPSFFQSDI  588



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 21/93 (23%)
 Frame = -3

Query  692   ESVEKEAVSENPIPEPVTENQTLE-------DSQLRY--PFGDCWSDPCLEFAFKTLTGA  540
             ++VE E V+        TE Q +E       +S+L+Y  PF + WSDPCLEFAFKTLTG 
Sbjct  1080  QAVEGETVT--------TEQQLIETGAVNHDNSELQYCAPFMNSWSDPCLEFAFKTLTGV  1131

Query  539   IPVEDCLAYEQA-PQPQFNPSYAQSSDGYFDLP  444
             IPVE+ L  +   P+P    +Y +  DG   LP
Sbjct  1132  IPVEENLTLQGCFPEP---ANYHERRDGVSLLP  1161


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = -3

Query  614  QLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQF-NPSYAQ  471
            QL  PFGD WSDPCLEFA KTLTGA PV+       A  P F NP Y Q
Sbjct  938  QLPLPFGDSWSDPCLEFAIKTLTGAFPVDAGGDIMPALPPGFDNPPYKQ  986



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -3

Query  650   EPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
             E  T N    +SQ   PF + WSDPCLEFAFKTLTG IPVE+ L  +   Q   N  Y +
Sbjct  1079  ETGTVNHDNSESQYSAPFMNSWSDPCLEFAFKTLTGVIPVEENLTLQGCFQEPVN--YHE  1136

Query  470   SSDGYFDLP  444
               DG   LP
Sbjct  1137  RRDGGSMLP  1145


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 7/56 (13%)
 Frame = -3

Query  614  QLRYPFGDCWSDPCLEFAFKTLTGAIPVE--DCL-----AYEQAPQPQFNPSYAQS  468
            QL   FGD WSDPCLEFA KTLTGA+PV+  D +      ++  P  Q + S A S
Sbjct  920  QLPLLFGDSWSDPCLEFAIKTLTGALPVDAGDIMPALPPGFDNPPYKQLHGSLATS  975



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -3

Query  650   EPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
             E  T N    +SQ   PF + WSDPCLEFAFKTLTG IPVE+ L  +   Q   N  Y +
Sbjct  1058  ETGTVNHDNSESQYSAPFMNSWSDPCLEFAFKTLTGVIPVEENLTLQGCFQEPVN--YHE  1115

Query  470   SSDGYFDLP  444
               DG   LP
Sbjct  1116  RRDGGSMLP  1124


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 7/56 (13%)
 Frame = -3

Query  614  QLRYPFGDCWSDPCLEFAFKTLTGAIPVE--DCL-----AYEQAPQPQFNPSYAQS  468
            QL   FGD WSDPCLEFA KTLTGA+PV+  D +      ++  P  Q + S A S
Sbjct  899  QLPLLFGDSWSDPCLEFAIKTLTGALPVDAGDIMPALPPGFDNPPYKQLHGSLATS  954



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = -3

Query  716   HDEPTKATESV-EKE-AVSENPIP-EPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLT  546
             H+EP K  + V E E   SE P P + V  N    + Q    F + WSDPCLEFAFKTLT
Sbjct  1173  HEEPVKKNDQVAEGEFGTSEQPPPFQTVMLNHDNTELQFCESFMNSWSDPCLEFAFKTLT  1232

Query  545   GAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
             G IPVE+ LA +   Q   N    +  DG   LP
Sbjct  1233  GVIPVEENLAVQGGVQEPVNCHDGR--DGVSALP  1264


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  695  TESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            T++V KE   E    + ++ +++   S+L  PFG+ WSDPCLEFAFKTLTGA+PV+
Sbjct  754  TQTVHKEQQLERAEAKNISNDRS--KSELTLPFGESWSDPCLEFAFKTLTGALPVD  807



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 19/108 (18%)
 Frame = -3

Query  719   QHDEPTKATESVEKEAVSENPIPEPVTENQTLEDS--QLRYPFGDCWSDPCLEFAFKTLT  546
             Q +   K  +++E+ AV +    +  TE   +E+   Q  +PF D WSDPCL+FAFKTLT
Sbjct  929   QEETSYKRAKALEEHAVPQEKPQKFETEKAYVENPEPQFPFPFTDSWSDPCLDFAFKTLT  988

Query  545   GAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPNDFPS  402
             GAIP+ED               Y Q   GYF   +  S+N+  +DF S
Sbjct  989   GAIPLED--------------DYYQ---GYFQEKLDTSHNMALSDFGS  1019



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 17/71 (24%)
 Frame = -3

Query  614   QLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFD  435
             Q  +PF D WSDPCL+FAFKTLTGAIP+ED               Y Q   GYF   +  
Sbjct  962   QFPFPFTDSWSDPCLDFAFKTLTGAIPLED--------------DYYQ---GYFQEKLDT  1004

Query  434   SYNLFPNDFPS  402
             S+N+  +DF S
Sbjct  1005  SHNMALSDFGS  1015



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 7/91 (8%)
 Frame = -3

Query  707  PTKATESVEKEAVSENPIPEPVTENQT------LEDSQLRYPFGD-CWSDPCLEFAFKTL  549
            P  +T+++ +  V    +  P+ E Q        E+ Q  + F    WSDPCLEFAFKTL
Sbjct  815  PEYSTDTMLRGKVVNTSVGRPILEKQVASIEKKTEEPQSEFCFSSPLWSDPCLEFAFKTL  874

Query  548  TGAIPVEDCLAYEQAPQPQFNPSYAQSSDGY  456
            TGAIP +D LA +   Q Q   S  ++ D Y
Sbjct  875  TGAIPFDDNLAIQDYIQHQLRTSEERNDDQY  905



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 7/91 (8%)
 Frame = -3

Query  707  PTKATESVEKEAVSENPIPEPVTENQT------LEDSQLRYPFGD-CWSDPCLEFAFKTL  549
            P  +T+++ +  V    +  P+ E Q        E+ Q  + F    WSDPCLEFAFKTL
Sbjct  894  PEYSTDTMLRGKVVNTSVGRPILEKQVASIEKKTEEPQSEFCFSSPLWSDPCLEFAFKTL  953

Query  548  TGAIPVEDCLAYEQAPQPQFNPSYAQSSDGY  456
            TGAIP +D LA +   Q Q   S  ++ D Y
Sbjct  954  TGAIPFDDNLAIQDYIQHQLRTSEERNDDQY  984



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 17/71 (24%)
 Frame = -3

Query  614   QLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFD  435
             Q  +PF D WSDPCL+FAFKTLTGAIP+ED               Y Q   GYF   +  
Sbjct  962   QFPFPFTDSWSDPCLDFAFKTLTGAIPLED--------------DYYQ---GYFQEKLDT  1004

Query  434   SYNLFPNDFPS  402
             S+N+  +DF S
Sbjct  1005  SHNMALSDFGS  1015



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 7/91 (8%)
 Frame = -3

Query  707  PTKATESVEKEAVSENPIPEPVTENQT------LEDSQLRYPFGD-CWSDPCLEFAFKTL  549
            P  +T+++ +  V    +  P+ E Q        E+ Q  + F    WSDPCLEFAFKTL
Sbjct  895  PEYSTDTMLRGKVVNTSVGRPILEKQVASIEKKTEEPQSEFCFSSPLWSDPCLEFAFKTL  954

Query  548  TGAIPVEDCLAYEQAPQPQFNPSYAQSSDGY  456
            TGAIP +D LA +   Q Q   S  ++ D Y
Sbjct  955  TGAIPFDDNLAIQDYIQHQLRTSEERNDDQY  985



>ref|XP_008367419.1| PREDICTED: uncharacterized protein LOC103431052 [Malus domestica]
Length=1123

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (53%), Gaps = 11/121 (9%)
 Frame = -3

Query  764  PVPAPNNLSDQEMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLE--DSQLRYPFGD  591
            P  A NN   +E+        K+ +++E+ AV +    +  TE   +E  + Q  +PF D
Sbjct  853  PCTAINNSMQEELS------NKSVKALEEPAVPQEKPQKFETEKAHVEHPEPQFSFPFTD  906

Query  590  CWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPND  411
             WSDPCL+FAFKTLTGAIP+ED   Y    Q + + S+         LP F + +LF +D
Sbjct  907  SWSDPCLDFAFKTLTGAIPLEDDY-YHGYFQEKLDTSHNHRDS--LALPDFGTPSLFQSD  963

Query  410  F  408
             
Sbjct  964  I  964



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  462  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  513

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  514  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  557



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  513  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  564

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  565  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  608



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  514  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  565

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  566  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  609



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  506  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  557

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  558  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  601



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  556  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  607

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  608  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  651



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  555  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  606

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  607  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  650



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  554  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  605

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  606  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  649



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -3

Query  731  EMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWSDPCLEFAFKT  552
            E PK  + P +    V++  + E      + EN++   S LR PFGD W DPC+EFAFKT
Sbjct  557  EEPKSRERPGEQAAPVKQVYLGE------LNENKS--GSPLRLPFGDSWPDPCIEFAFKT  608

Query  551  LTGAIPV-EDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLF  420
            LTG IPV ED  A E+        S +    G   L  F ++  F
Sbjct  609  LTGDIPVLEDTAAIEEYFHRHLGTSKSPGQQGSASL-TFSNHKSF  652



>ref|XP_010918515.1| PREDICTED: uncharacterized protein LOC105042867 [Elaeis guineensis]
Length=213

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPV-EDCLAYEQ  507
            LR PFGD W DPC+EFAFKTLTG IPV ED  A E+
Sbjct  96   LRLPFGDSWPDPCIEFAFKTLTGDIPVLEDTAAIEE  131



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 11/121 (9%)
 Frame = -3

Query  764   PVPAPNNLSDQEMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLE--DSQLRYPFGD  591
             P  A NN   +E+        K+ +++E+ AV +       TE   +E  +    +PF D
Sbjct  935   PCTAINNSMQEELS------NKSVKALEEHAVPQEKPQNFETEKAHVEHPEPHFSFPFMD  988

Query  590   CWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIFDSYNLFPND  411
              WSDPCL+FAFKTLTGAIP+ED   Y    Q + + S+         LP F + +LF +D
Sbjct  989   SWSDPCLDFAFKTLTGAIPLEDDY-YHGYFQEKLDTSHNHRDS--LALPDFGTPSLFQSD  1045

Query  410   F  408
              
Sbjct  1046  I  1046



>ref|XP_011041594.1| PREDICTED: uncharacterized protein LOC105137520 isoform X5 [Populus 
euphratica]
Length=806

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 37/66 (56%), Gaps = 12/66 (18%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCLAYEQAPQPQFNPSYAQSSDGYFDL  447
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL     PQ Q   S  Q S G F L
Sbjct  691  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL-----PQ-QAGSSQEQQSSG-FTL  743

Query  446  PIFDSY  429
            P    +
Sbjct  744  PKVGEF  749



>ref|XP_011041592.1| PREDICTED: uncharacterized protein LOC105137520 isoform X3 [Populus 
euphratica]
Length=830

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 36/61 (59%), Gaps = 12/61 (20%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCLAYEQAPQPQFNPSYAQSSDGYFDL  447
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL     PQ Q   S  Q S G F L
Sbjct  742  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL-----PQ-QAGSSQEQQSSG-FTL  794

Query  446  P  444
            P
Sbjct  795  P  795



>ref|XP_010035118.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Eucalyptus grandis]
Length=812

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            S L  PFGD W+DPC+EFA KTLTGAIPVE
Sbjct  691  SSLNLPFGDSWADPCIEFAIKTLTGAIPVE  720



>ref|XP_011041590.1| PREDICTED: uncharacterized protein LOC105137520 isoform X1 [Populus 
euphratica]
Length=857

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 36/61 (59%), Gaps = 12/61 (20%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCLAYEQAPQPQFNPSYAQSSDGYFDL  447
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL     PQ Q   S  Q S G F L
Sbjct  742  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL-----PQ-QAGSSQEQQSSG-FTL  794

Query  446  P  444
            P
Sbjct  795  P  795



>ref|XP_011041593.1| PREDICTED: uncharacterized protein LOC105137520 isoform X4 [Populus 
euphratica]
Length=807

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 36/61 (59%), Gaps = 12/61 (20%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCLAYEQAPQPQFNPSYAQSSDGYFDL  447
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL     PQ Q   S  Q S G F L
Sbjct  742  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL-----PQ-QAGSSQEQQSSG-FTL  794

Query  446  P  444
            P
Sbjct  795  P  795



>ref|XP_010035117.1| PREDICTED: uncharacterized protein LOC104424406 isoform X1 [Eucalyptus 
grandis]
 gb|KCW46411.1| hypothetical protein EUGRSUZ_K00243 [Eucalyptus grandis]
Length=818

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            S L  PFGD W+DPC+EFA KTLTGAIPVE
Sbjct  697  SSLNLPFGDSWADPCIEFAIKTLTGAIPVE  726



>ref|XP_009401689.1| PREDICTED: uncharacterized protein LOC103985652 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=504

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVED-CLAYEQAPQPQ  492
            SQL  PFGD W DPC+EFAF+TL G IPV D  + ++  PQ Q
Sbjct  387  SQLTSPFGDSWPDPCIEFAFRTLIGDIPVSDNTVVFQDYPQQQ  429



>ref|XP_011041591.1| PREDICTED: uncharacterized protein LOC105137520 isoform X2 [Populus 
euphratica]
Length=846

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 36/61 (59%), Gaps = 12/61 (20%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCLAYEQAPQPQFNPSYAQSSDGYFDL  447
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL     PQ Q   S  Q S G F L
Sbjct  731  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL-----PQ-QAGSSQEQQSSG-FTL  783

Query  446  P  444
            P
Sbjct  784  P  784



>ref|XP_011041595.1| PREDICTED: uncharacterized protein LOC105137520 isoform X6 [Populus 
euphratica]
Length=802

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 36/61 (59%), Gaps = 12/61 (20%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCLAYEQAPQPQFNPSYAQSSDGYFDL  447
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL     PQ Q   S  Q S G F L
Sbjct  687  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL-----PQ-QAGSSQEQQSSG-FTL  739

Query  446  P  444
            P
Sbjct  740  P  740



>ref|XP_007038660.1| Methyl-CPG-binding domain protein 13, putative isoform 3, partial 
[Theobroma cacao]
 gb|EOY23161.1| Methyl-CPG-binding domain protein 13, putative isoform 3, partial 
[Theobroma cacao]
Length=544

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            S L  P  D W+DPC+EFA KTLTGAIPVE  L  +   + Q + S  QSS+ +  LP  
Sbjct  442  SSLDTPLADIWADPCIEFAIKTLTGAIPVEYDLENQDYFRRQPSSSLTQSSN-HLTLPDV  500

Query  437  DSYNLFPNDF  408
               N    DF
Sbjct  501  GIDNFSQTDF  510



>gb|EYU38370.1| hypothetical protein MIMGU_mgv1a007205mg [Erythranthe guttata]
Length=415

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -3

Query  635  NQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAY  513
            N   ++SQL Y FGD WSDP LEFA KTL G IP+ED LA+
Sbjct  290  NNKSQESQLLYDFGDSWSDP-LEFALKTLRGDIPIEDTLAF  329



>ref|XP_009401688.1| PREDICTED: uncharacterized protein LOC103985652 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVED-CLAYEQAPQPQ  492
            SQL  PFGD W DPC+EFAF+TL G IPV D  + ++  PQ Q
Sbjct  456  SQLTSPFGDSWPDPCIEFAFRTLIGDIPVSDNTVVFQDYPQQQ  498



>ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
Length=621

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            S L  P  D W+DPC+EFA KTLTGAIPVE  L  +   + Q + S  QSS+ +  LP  
Sbjct  519  SSLDTPLADIWADPCIEFAIKTLTGAIPVEYDLENQDYFRRQPSSSLTQSSN-HLTLPDV  577

Query  437  DSYNLFPNDF  408
               N    DF
Sbjct  578  GIDNFSQTDF  587



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLPIF  438
            S L  P  D W+DPC+EFA KTLTGAIPVE  L  +   + Q + S  QSS+ +  LP  
Sbjct  523  SSLDTPLADIWADPCIEFAIKTLTGAIPVEYDLENQDYFRRQPSSSLTQSSN-HLTLPDV  581

Query  437  DSYNLFPNDF  408
               N    DF
Sbjct  582  GIDNFSQTDF  591



>ref|XP_002318826.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
 gb|EEE97046.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
Length=762

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ   S  Q S G F LP
Sbjct  645  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVRSSQPQESRG-FTLP  698



>ref|XP_011048656.1| PREDICTED: uncharacterized protein LOC105142633 isoform X4 [Populus 
euphratica]
Length=806

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 5/36 (14%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCL  519
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL
Sbjct  691  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL  726



>ref|XP_011048654.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Populus euphratica]
Length=828

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 5/36 (14%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCL  519
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL
Sbjct  740  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL  775



>gb|KJB52812.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=435

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  644  VTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            V +   + +S L  P  D W+DPC+EFA KTLTGAIPVE
Sbjct  322  VEKGHDMPESSLEMPLADIWADPCIEFAIKTLTGAIPVE  360



>ref|XP_011048657.1| PREDICTED: uncharacterized protein LOC105142633 isoform X5 [Populus 
euphratica]
Length=800

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 5/36 (14%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCL  519
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL
Sbjct  685  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL  720



>ref|XP_011048652.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Populus euphratica]
Length=855

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 5/36 (14%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCL  519
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL
Sbjct  740  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL  775



>ref|XP_011048653.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Populus euphratica]
Length=844

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 5/36 (14%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCL  519
            L  PF D WSDPC+EFA KTLTGAIP     V+DCL
Sbjct  729  LNLPFADVWSDPCIEFAIKTLTGAIPLDFDVVQDCL  764



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
            ++QL  P  D WSDPCLEFA KTLTGA+PVE+ 
Sbjct  558  EAQLDVPIADFWSDPCLEFAIKTLTGALPVENA  590



>gb|EMT07793.1| hypothetical protein F775_13908 [Aegilops tauschii]
Length=1078

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 32/51 (63%), Gaps = 6/51 (12%)
 Frame = -3

Query  659   PIPEPVTENQTLED-----SQLRYP-FGDCWSDPCLEFAFKTLTGAIPVED  525
             P PEPV   QT E      S    P FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  968   PTPEPVLPTQTAEPGGADPSGFALPSFGNSWSDPCIEFAFKTLTGDIPVLD  1018



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
            ++QL  P  D WSDPCLEFA KTLTGA+PVE+ 
Sbjct  565  EAQLDVPIADFWSDPCLEFAIKTLTGALPVENA  597



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = -3

Query  602  PFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            PFG+ WSD   EFAFKT+TG+ P ED  A++     QF  S +Q  DG F LP
Sbjct  910  PFGNSWSDSRFEFAFKTVTGSSPAEDSFAFQSNFHQQFGSSGSQ-IDGNFALP  961



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDC  522
            ++QL  P  D WSDPCLEFA KTLTGA+PVE+ 
Sbjct  564  EAQLDVPIADFWSDPCLEFAIKTLTGALPVENA  596



>ref|XP_002321896.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
 gb|EEF06023.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
Length=774

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 5/36 (14%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIP-----VEDCL  519
            L  PF D WSDPC+EFA KTLTGAIP     ++DCL
Sbjct  659  LNLPFADAWSDPCIEFAIKTLTGAIPLDFDVIQDCL  694



>gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=600

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  644  VTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            V +   + +S L  P  D W+DPC+EFA KTLTGAIPVE
Sbjct  487  VEKGHDMPESSLEMPLADIWADPCIEFAIKTLTGAIPVE  525



>gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium 
arboreum]
Length=598

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -3

Query  644  VTENQTLEDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYA-QS  468
            V +   + +S L  P  D W+DPC+EFA KTLTGAIPVE  L  +   Q Q  PS A   
Sbjct  486  VEKGHDMPESSLEMPLADIWADPCIEFAIKTLTGAIPVEYGLDNQHCFQQQ--PSSAPNQ  543

Query  467  SDGYFDLP  444
            S  +  LP
Sbjct  544  SVNHLTLP  551



>ref|XP_006421894.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
 gb|ESR35134.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
Length=490

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q
Sbjct  390  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQ  436



>gb|KDO60034.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=490

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q
Sbjct  390  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQ  436



>gb|KDO60032.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=549

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q
Sbjct  449  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQ  495



>gb|KDO60033.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=537

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q
Sbjct  437  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQ  483



>ref|XP_006490367.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Citrus sinensis]
 gb|KDO60031.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=564

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q
Sbjct  464  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQ  510



>ref|XP_006421896.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
 gb|ESR35136.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
Length=564

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQ  471
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q
Sbjct  464  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQ  510



>ref|XP_011012359.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ +    Q S G F LP
Sbjct  656  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVSSLQQQESRG-FTLP  709



>ref|XP_006421895.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
 gb|ESR35135.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
Length=403

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGY  456
            L  PF D W DPC+EFA KTLTGAIPV +    +   Q Q N S  Q ++ +
Sbjct  303  LDLPFADIWRDPCIEFAIKTLTGAIPVGNDWDVQDYFQQQINSSQTQPNNNF  354



>ref|XP_011030071.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ +    Q S G F LP
Sbjct  656  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVSSLQQQESRG-FTLP  709



>ref|XP_011012358.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ +    Q S G F LP
Sbjct  658  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVSSLQQQESRG-FTLP  711



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            SQ   PFGD WSDPCLEFA KTL+GA+PV+
Sbjct  678  SQFPTPFGDSWSDPCLEFAIKTLSGALPVD  707



>ref|XP_011012360.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ +    Q S G F LP
Sbjct  647  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVSSLQQQESRG-FTLP  700



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            SQ   PFGD WSDPCLEFA KTL+GA+PV+
Sbjct  646  SQFPTPFGDSWSDPCLEFAIKTLSGALPVD  675



>ref|XP_011030072.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ +    Q S G F LP
Sbjct  647  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVSSLQQQESRG-FTLP  700



>ref|XP_011030070.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            L  PF D WSDPC+EFA KTLTGA+P++  +  +  P PQ +    Q S G F LP
Sbjct  658  LVLPFADAWSDPCIEFAIKTLTGALPLDFDMVQDYLP-PQVSSLQQQESRG-FTLP  711



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            SQ   PFGD WSDPCLEFA KTL+GA+PV+
Sbjct  723  SQFPTPFGDSWSDPCLEFAIKTLSGALPVD  752



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  617  SQLRYPFGDCWSDPCLEFAFKTLTGAIPVE  528
            SQ   PFGD WSDPCLEFA KTL+GA+PV+
Sbjct  691  SQFPTPFGDSWSDPCLEFAIKTLSGALPVD  720



>gb|KDP22300.1| hypothetical protein JCGZ_26131 [Jatropha curcas]
Length=447

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 6/37 (16%)
 Frame = -3

Query  611  LRYPFGDCWSDPCLEFAFKTLTGAIPV------EDCL  519
            L  PFG  W+DPC+EFA KTLTGAIP+      +DCL
Sbjct  334  LNLPFGGAWADPCIEFAIKTLTGAIPLDSDMVMQDCL  370



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  623  EDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            ++SQL Y FGD WSDP LEFA KTL G IP++D L++      Q    Y + +DG     
Sbjct  520  QESQLCYDFGDSWSDP-LEFALKTLRGEIPIDDTLSFAGCFGEQVGIPYNK-ADGCLKAS  577

Query  443  IFDSYNLFPNDF  408
              D   +F N F
Sbjct  578  QCDEPIIFQNAF  589



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  623  EDSQLRYPFGDCWSDPCLEFAFKTLTGAIPVEDCLAYEQAPQPQFNPSYAQSSDGYFDLP  444
            ++SQL Y FGD WSDP LEFA KTL G IP++D L++      Q    Y + +DG     
Sbjct  519  QESQLCYDFGDSWSDP-LEFALKTLRGEIPIDDTLSFAGCFGEQVGIPYNK-ADGCLKAS  576

Query  443  IFDSYNLFPNDF  408
              D   +F N F
Sbjct  577  QCDEPIIFQNAF  588



>ref|XP_008238901.1| PREDICTED: uncharacterized protein LOC103337519 [Prunus mume]
Length=219

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  593  DCWSDPCLEFAFKTLTGAIPVEDCL  519
            D WSDPCL+FAFKTLTGAIP+ED L
Sbjct  2    DSWSDPCLDFAFKTLTGAIPIEDDL  26



>ref|XP_006659212.1| PREDICTED: uncharacterized protein LOC102718198 [Oryza brachyantha]
Length=1007

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  916  FGNSWSDPCIEFAFKTLTGDIPVLD  940



>ref|XP_010934850.1| PREDICTED: uncharacterized protein LOC105054908 isoform X5 [Elaeis 
guineensis]
Length=561

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPV  531
            +S L  PFG+ W DPCLEFAFKTLTG IPV
Sbjct  444  ESPLTSPFGNSWPDPCLEFAFKTLTGDIPV  473



>gb|EMS57086.1| Methyl-CpG-binding domain-containing protein 13 [Triticum urartu]
Length=946

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  862  FGNSWSDPCIEFAFKTLTGDIPVLD  886



>ref|XP_010934849.1| PREDICTED: uncharacterized protein LOC105054908 isoform X4 [Elaeis 
guineensis]
Length=605

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPV  531
            +S L  PFG+ W DPCLEFAFKTLTG IPV
Sbjct  488  ESPLTSPFGNSWPDPCLEFAFKTLTGDIPV  517



>ref|XP_008678194.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
 ref|XP_008678195.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
Length=912

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  831  FGNIWSDPCIEFAFKTLTGDIPVLD  855



>ref|XP_010934847.1| PREDICTED: uncharacterized protein LOC105054908 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPV  531
            +S L  PFG+ W DPCLEFAFKTLTG IPV
Sbjct  537  ESPLTSPFGNSWPDPCLEFAFKTLTGDIPV  566



>ref|XP_010934848.1| PREDICTED: uncharacterized protein LOC105054908 isoform X3 [Elaeis 
guineensis]
Length=638

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPV  531
            +S L  PFG+ W DPCLEFAFKTLTG IPV
Sbjct  521  ESPLTSPFGNSWPDPCLEFAFKTLTGDIPV  550



>gb|AFW61002.1| hypothetical protein ZEAMMB73_269384 [Zea mays]
Length=921

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  840  FGNIWSDPCIEFAFKTLTGDIPVLD  864



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  620  DSQLRYPFGDCWSDPCLEFAFKTLTGAIPV  531
            +S L  PFG+ W DPCLEFAFKTLTG IPV
Sbjct  570  ESPLTSPFGNSWPDPCLEFAFKTLTGDIPV  599



>ref|XP_004308099.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Fragaria 
vesca subsp. vesca]
Length=326

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 38/78 (49%), Gaps = 23/78 (29%)
 Frame = -3

Query  761  VPAPNNLSDQEMPKQHDEPTKATESVEKEAVSENPIPEPVTENQTLEDSQLRYPFGDCWS  582
            +P P+NL  QE   +HD      E       S + I EP              PFG  W 
Sbjct  243  LPPPDNLVKQE---KHDGIVGTGEK------SGSSITEP--------------PFGSSWP  279

Query  581  DPCLEFAFKTLTGAIPVE  528
            DPC+EFA KTLTGAIP+E
Sbjct  280  DPCIEFAIKTLTGAIPLE  297



>ref|XP_004972592.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004972593.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
Length=954

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  871  FGNAWSDPCIEFAFKTLTGDIPVLD  895



>gb|AFW56991.1| hypothetical protein ZEAMMB73_310321 [Zea mays]
Length=680

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  598  FGNIWSDPCIEFAFKTLTGDIPVLD  622



>ref|XP_008662741.1| PREDICTED: uncharacterized protein LOC103641148 isoform X1 [Zea 
mays]
Length=942

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  860  FGNIWSDPCIEFAFKTLTGDIPVLD  884



>ref|XP_008662742.1| PREDICTED: uncharacterized protein LOC103641148 isoform X2 [Zea 
mays]
Length=934

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPVED  525
            FG+ WSDPC+EFAFKTLTG IPV D
Sbjct  852  FGNIWSDPCIEFAFKTLTGDIPVLD  876



>dbj|BAK01530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1091

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -3

Query  599   FGDCWSDPCLEFAFKTLTGAIPV  531
             FG+ WSDPC+EFAFKTLTG IPV
Sbjct  1008  FGNSWSDPCIEFAFKTLTGDIPV  1030



>gb|EEE68228.1| hypothetical protein OsJ_26412 [Oryza sativa Japonica Group]
Length=899

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = -3

Query  599  FGDCWSDPCLEFAFKTLTGAIPV-EDCLAYEQ  507
            FG+ WSDPC+EFAFKTL G IPV +D  A EQ
Sbjct  810  FGNSWSDPCIEFAFKTLRGDIPVLDDTSAVEQ  841



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940