BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018O08

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618515.1|  PREDICTED: uncharacterized protein LOC104110...    345   2e-109   
emb|CAN68801.1|  hypothetical protein VITISV_008808                     327   1e-108   Vitis vinifera
ref|XP_009629701.1|  PREDICTED: uncharacterized protein LOC104119814    346   5e-108   Nicotiana tomentosiformis
ref|XP_009765848.1|  PREDICTED: uncharacterized protein LOC104217...    340   9e-108   Nicotiana sylvestris
ref|XP_009618505.1|  PREDICTED: uncharacterized protein LOC104110...    345   1e-107   Nicotiana tomentosiformis
gb|KDO84264.1|  hypothetical protein CISIN_1g0017372mg                  328   3e-107   Citrus sinensis [apfelsine]
gb|KDO84265.1|  hypothetical protein CISIN_1g0017372mg                  328   4e-107   Citrus sinensis [apfelsine]
gb|KDO84266.1|  hypothetical protein CISIN_1g0017372mg                  329   4e-107   Citrus sinensis [apfelsine]
ref|XP_009765845.1|  PREDICTED: uncharacterized protein LOC104217...    341   5e-106   Nicotiana sylvestris
ref|XP_009761575.1|  PREDICTED: uncharacterized protein LOC104213728    341   5e-106   Nicotiana sylvestris
ref|XP_004252774.1|  PREDICTED: uncharacterized protein LOC101266203    340   9e-106   Solanum lycopersicum
ref|XP_006342611.1|  PREDICTED: uncharacterized protein LOC102601564    335   6e-104   Solanum tuberosum [potatoes]
gb|EYU25397.1|  hypothetical protein MIMGU_mgv1a000678mg                333   3e-103   Erythranthe guttata [common monkey flower]
ref|XP_011083822.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    333   3e-103   
ref|XP_010664590.1|  PREDICTED: uncharacterized protein LOC100267...    324   4e-102   
ref|XP_011074457.1|  PREDICTED: uncharacterized protein LOC105159184    330   4e-102   Sesamum indicum [beniseed]
gb|KDP38386.1|  hypothetical protein JCGZ_04311                         324   1e-101   Jatropha curcas
gb|KHG22709.1|  putative HTH-type transcriptional regulator ybfP        306   2e-101   Gossypium arboreum [tree cotton]
ref|XP_006473361.1|  PREDICTED: uncharacterized protein LOC102621...    328   3e-101   Citrus sinensis [apfelsine]
ref|XP_010098704.1|  hypothetical protein L484_026083                   325   4e-101   
ref|XP_011030451.1|  PREDICTED: uncharacterized protein LOC105129897    327   6e-101   Populus euphratica
ref|XP_010664589.1|  PREDICTED: uncharacterized protein LOC100267...    324   1e-100   Vitis vinifera
ref|XP_006374985.1|  hypothetical protein POPTR_0014s03370g             327   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_006434822.1|  hypothetical protein CICLE_v10000140mg             326   1e-100   
ref|XP_007017323.1|  Calcineurin-like metallo-phosphoesterase sup...    326   1e-100   Theobroma cacao [chocolate]
ref|XP_004238179.1|  PREDICTED: uncharacterized protein LOC101261408    325   2e-100   Solanum lycopersicum
ref|XP_010664588.1|  PREDICTED: uncharacterized protein LOC100267...    324   6e-100   Vitis vinifera
emb|CBI19565.3|  unnamed protein product                                324   7e-100   Vitis vinifera
gb|KJB58436.1|  hypothetical protein B456_009G209900                    324   9e-100   Gossypium raimondii
ref|XP_008383912.1|  PREDICTED: uncharacterized protein LOC103446557    323   2e-99    
ref|XP_008393833.1|  PREDICTED: uncharacterized protein LOC103455...    320   3e-99    
ref|XP_008220172.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    322   4e-99    Prunus mume [ume]
ref|XP_009367394.1|  PREDICTED: uncharacterized protein LOC103957048    322   4e-99    
ref|XP_009370173.1|  PREDICTED: uncharacterized protein LOC103959542    322   7e-99    Pyrus x bretschneideri [bai li]
ref|XP_011458951.1|  PREDICTED: uncharacterized protein LOC101313...    322   7e-99    Fragaria vesca subsp. vesca
ref|XP_007227027.1|  hypothetical protein PRUPE_ppa000724mg             322   7e-99    Prunus persica
ref|XP_011458950.1|  PREDICTED: uncharacterized protein LOC101313...    322   7e-99    Fragaria vesca subsp. vesca
ref|XP_004291134.1|  PREDICTED: uncharacterized protein LOC101313...    322   8e-99    Fragaria vesca subsp. vesca
gb|KCW86234.1|  hypothetical protein EUGRSUZ_B02922                     315   1e-98    Eucalyptus grandis [rose gum]
ref|XP_002510264.1|  hydrolase, putative                                320   2e-98    Ricinus communis
ref|XP_008393832.1|  PREDICTED: uncharacterized protein LOC103455...    320   2e-98    
ref|XP_004499083.1|  PREDICTED: uncharacterized protein LOC101514142    320   4e-98    Cicer arietinum [garbanzo]
ref|XP_008775262.1|  PREDICTED: uncharacterized protein LOC103695663    296   4e-98    Phoenix dactylifera
emb|CDP01374.1|  unnamed protein product                                319   7e-98    Coffea canephora [robusta coffee]
ref|XP_006595961.1|  PREDICTED: uncharacterized protein LOC100820...    315   3e-97    
ref|XP_007160825.1|  hypothetical protein PHAVU_001G019800g             317   5e-97    Phaseolus vulgaris [French bean]
ref|XP_010044196.1|  PREDICTED: uncharacterized protein LOC104433...    314   9e-97    
ref|XP_003544449.1|  PREDICTED: uncharacterized protein LOC100820...    315   2e-96    Glycine max [soybeans]
ref|XP_010044195.1|  PREDICTED: uncharacterized protein LOC104433...    315   3e-96    Eucalyptus grandis [rose gum]
ref|XP_006601298.1|  PREDICTED: uncharacterized protein LOC100819...    313   5e-96    Glycine max [soybeans]
gb|KHN12760.1|  hypothetical protein glysoja_008723                     313   8e-96    Glycine soja [wild soybean]
ref|XP_003550348.1|  PREDICTED: uncharacterized protein LOC100819...    313   8e-96    Glycine max [soybeans]
ref|XP_010275607.1|  PREDICTED: uncharacterized protein LOC104610601    313   8e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010936846.1|  PREDICTED: uncharacterized protein LOC105056370    313   1e-95    Elaeis guineensis
gb|KJB63807.1|  hypothetical protein B456_010G017500                    313   1e-95    Gossypium raimondii
gb|KHG27255.1|  aat                                                     312   2e-95    Gossypium arboreum [tree cotton]
emb|CDX94143.1|  BnaC07g37770D                                          312   3e-95    
gb|KEH40051.1|  calcineurin-like metallo-phosphoesterase superfam...    311   4e-95    Medicago truncatula
ref|NP_192917.3|  calcineurin-like phosphoesterase domain-contain...    311   4e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CAB44318.1|  putative protein                                       311   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268877.1|  PREDICTED: uncharacterized protein LOC104605707    311   5e-95    Nelumbo nucifera [Indian lotus]
gb|KEH40052.1|  calcineurin-like metallo-phosphoesterase superfam...    312   5e-95    Medicago truncatula
ref|XP_010062120.1|  PREDICTED: uncharacterized protein LOC104449...    311   6e-95    
gb|KCW69186.1|  hypothetical protein EUGRSUZ_F02708                     310   7e-95    Eucalyptus grandis [rose gum]
ref|XP_010455595.1|  PREDICTED: uncharacterized protein LOC104737182    311   7e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010062121.1|  PREDICTED: uncharacterized protein LOC104449...    311   7e-95    Eucalyptus grandis [rose gum]
gb|KGN62541.1|  hypothetical protein Csa_2G360580                       311   9e-95    Cucumis sativus [cucumbers]
ref|XP_004152730.1|  PREDICTED: uncharacterized protein LOC101204257    310   1e-94    
ref|XP_010422134.1|  PREDICTED: uncharacterized protein LOC104707474    310   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006396852.1|  hypothetical protein EUTSA_v10028387mg             310   1e-94    Eutrema salsugineum [saltwater cress]
ref|XP_009137306.1|  PREDICTED: uncharacterized protein LOC103861350    310   2e-94    
emb|CDX98782.1|  BnaA03g45670D                                          310   2e-94    
ref|XP_010062116.1|  PREDICTED: uncharacterized protein LOC104449...    311   2e-94    
ref|XP_002874725.1|  predicted protein                                  309   3e-94    
ref|XP_010434128.1|  PREDICTED: uncharacterized protein LOC104718144    309   3e-94    Camelina sativa [gold-of-pleasure]
emb|CDX86745.1|  BnaA09g21350D                                          307   9e-94    
dbj|BAK04122.1|  predicted protein                                      290   1e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008444644.1|  PREDICTED: uncharacterized protein LOC103487913    308   1e-93    Cucumis melo [Oriental melon]
emb|CDY47423.1|  BnaA02g21590D                                          306   2e-93    Brassica napus [oilseed rape]
ref|XP_006413590.1|  hypothetical protein EUTSA_v10024304mg             306   2e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010540555.1|  PREDICTED: uncharacterized protein LOC104814...    306   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_009128650.1|  PREDICTED: uncharacterized protein LOC103853501    306   3e-93    Brassica rapa
emb|CDY52938.1|  BnaCnng23820D                                          306   4e-93    Brassica napus [oilseed rape]
ref|XP_010540547.1|  PREDICTED: uncharacterized protein LOC104814...    306   4e-93    Tarenaya hassleriana [spider flower]
ref|XP_009102715.1|  PREDICTED: uncharacterized protein LOC103828821    305   7e-93    Brassica rapa
ref|XP_006286984.1|  hypothetical protein CARUB_v10000128mg             305   8e-93    Capsella rubella
ref|XP_010684140.1|  PREDICTED: uncharacterized protein LOC104898734    305   1e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010433955.1|  PREDICTED: uncharacterized protein LOC104718...    303   2e-92    Camelina sativa [gold-of-pleasure]
ref|NP_194031.5|  calcineurin-like metallo-phosphoesterase family...    304   2e-92    
dbj|BAC81182.1|  unknown protein                                        290   3e-92    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ98692.1|  predicted protein                                      292   5e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY13280.1|  BnaC09g23760D                                          303   5e-92    Brassica napus [oilseed rape]
ref|XP_009392959.1|  PREDICTED: uncharacterized protein LOC103978...    303   6e-92    
ref|XP_002869795.1|  hypothetical protein ARALYDRAFT_914305             303   6e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_010433954.1|  PREDICTED: uncharacterized protein LOC104718...    303   7e-92    Camelina sativa [gold-of-pleasure]
ref|NP_001058842.1|  Os07g0134500                                       292   7e-92    
ref|XP_010529533.1|  PREDICTED: uncharacterized protein LOC104806367    302   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_009392951.1|  PREDICTED: uncharacterized protein LOC103978...    302   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010448789.1|  PREDICTED: uncharacterized protein LOC104731...    300   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008799898.1|  PREDICTED: uncharacterized protein LOC103714...    300   8e-91    Phoenix dactylifera
ref|XP_010448786.1|  PREDICTED: uncharacterized protein LOC104731...    300   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008799897.1|  PREDICTED: uncharacterized protein LOC103714...    299   1e-90    Phoenix dactylifera
ref|XP_010932753.1|  PREDICTED: uncharacterized protein LOC105053...    298   1e-90    
gb|KFK28866.1|  hypothetical protein AALP_AA7G058700                    299   2e-90    Arabis alpina [alpine rockcress]
tpg|DAA39654.1|  TPA: hypothetical protein ZEAMMB73_888857              294   2e-90    
dbj|BAJ98325.1|  predicted protein                                      288   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006285736.1|  hypothetical protein CARUB_v10007209mg             298   3e-90    Capsella rubella
ref|XP_009393277.1|  PREDICTED: uncharacterized protein LOC103979011    298   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932752.1|  PREDICTED: uncharacterized protein LOC105053...    297   8e-90    Elaeis guineensis
gb|EMT04291.1|  hypothetical protein F775_31134                         293   1e-89    
ref|XP_004987255.1|  PREDICTED: uncharacterized protein LOC101783...    291   1e-89    
ref|XP_008811244.1|  PREDICTED: uncharacterized protein LOC103722...    295   2e-89    
gb|EEE66522.1|  hypothetical protein OsJ_22999                          293   3e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657430.1|  PREDICTED: uncharacterized protein LOC102702861    296   3e-89    Oryza brachyantha
ref|XP_008651926.1|  PREDICTED: uncharacterized protein LOC103631...    291   3e-89    
ref|XP_010538790.1|  PREDICTED: uncharacterized protein LOC104813013    295   3e-89    Tarenaya hassleriana [spider flower]
ref|XP_004987258.1|  PREDICTED: uncharacterized protein LOC101786...    290   5e-89    
gb|EPS68439.1|  hypothetical protein M569_06328                         295   6e-89    Genlisea aurea
ref|XP_008811243.1|  PREDICTED: uncharacterized protein LOC103722...    295   7e-89    Phoenix dactylifera
ref|XP_002461307.1|  hypothetical protein SORBIDRAFT_02g000620          295   7e-89    Sorghum bicolor [broomcorn]
gb|EEC81473.1|  hypothetical protein OsI_24798                          293   1e-88    Oryza sativa Indica Group [Indian rice]
gb|EMS63037.1|  hypothetical protein TRIUR3_32981                       293   1e-88    Triticum urartu
ref|XP_008670049.1|  PREDICTED: uncharacterized protein LOC103647275    294   1e-88    Zea mays [maize]
ref|XP_008651925.1|  PREDICTED: uncharacterized protein LOC103631...    292   2e-88    Zea mays [maize]
ref|XP_010238514.1|  PREDICTED: uncharacterized protein LOC100842...    288   4e-88    
ref|XP_002461963.1|  hypothetical protein SORBIDRAFT_02g011280          290   9e-88    
ref|XP_003557697.1|  PREDICTED: uncharacterized protein LOC100823404    291   9e-88    
ref|XP_008651921.1|  PREDICTED: uncharacterized protein LOC103631...    291   1e-87    
ref|XP_006856661.1|  hypothetical protein AMTR_s00054p00046250          292   1e-87    
ref|XP_004987257.1|  PREDICTED: uncharacterized protein LOC101786...    290   2e-87    Setaria italica
ref|NP_001058702.1|  Os07g0106000                                       290   5e-87    
ref|XP_010238513.1|  PREDICTED: uncharacterized protein LOC100842...    288   1e-86    Brachypodium distachyon [annual false brome]
ref|XP_010238512.1|  PREDICTED: uncharacterized protein LOC100842...    288   1e-86    Brachypodium distachyon [annual false brome]
emb|CDX86747.1|  BnaA09g21370D                                          266   2e-86    
ref|XP_004956163.1|  PREDICTED: uncharacterized protein LOC101776542    287   3e-86    Setaria italica
gb|KCW86241.1|  hypothetical protein EUGRSUZ_B02927                     281   8e-84    Eucalyptus grandis [rose gum]
ref|XP_010044199.1|  PREDICTED: uncharacterized protein LOC104433215    282   8e-84    Eucalyptus grandis [rose gum]
ref|XP_004987249.1|  PREDICTED: uncharacterized protein LOC101783...    262   9e-79    
ref|XP_001765009.1|  predicted protein                                  267   1e-78    
ref|XP_002974647.1|  hypothetical protein SELMODRAFT_102099             265   3e-78    
ref|XP_002963358.1|  hypothetical protein SELMODRAFT_80477              265   3e-78    
gb|KDO84270.1|  hypothetical protein CISIN_1g0017372mg                  242   1e-73    Citrus sinensis [apfelsine]
gb|EMT21375.1|  hypothetical protein F775_01280                         241   4e-71    
gb|KJB58438.1|  hypothetical protein B456_009G209900                    240   3e-69    Gossypium raimondii
gb|KHG27254.1|  aat                                                     239   5e-69    Gossypium arboreum [tree cotton]
gb|KCW44765.1|  hypothetical protein EUGRSUZ_L01670                     236   5e-69    Eucalyptus grandis [rose gum]
gb|KEH40050.1|  calcineurin-like metallo-phosphoesterase superfam...    238   1e-68    Medicago truncatula
ref|XP_010040937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    233   2e-66    
ref|XP_010062117.1|  PREDICTED: uncharacterized protein LOC104449...    229   2e-65    
ref|XP_008651923.1|  PREDICTED: uncharacterized protein LOC103631...    226   3e-64    
ref|XP_001772190.1|  predicted protein                                  215   1e-60    
gb|KDD72728.1|  hypothetical protein H632_c2969p0                       184   1e-51    Helicosporidium sp. ATCC 50920
gb|EMS47321.1|  hypothetical protein TRIUR3_13192                       170   7e-45    Triticum urartu
ref|XP_011397366.1|  hypothetical protein F751_3196                     161   9e-42    Auxenochlorella protothecoides
ref|XP_008877911.1|  hypothetical protein, variant 4                    162   3e-41    Aphanomyces invadans
ref|XP_008877896.1|  hypothetical protein H310_12570                    162   3e-41    Aphanomyces invadans
ref|XP_008877913.1|  hypothetical protein, variant 3                    161   3e-41    Aphanomyces invadans
ref|XP_002954875.1|  hypothetical protein VOLCADRAFT_65342              157   9e-41    Volvox carteri f. nagariensis
ref|XP_001695554.1|  predicted protein                                  150   1e-38    Chlamydomonas reinhardtii
ref|XP_009843915.1|  hypothetical protein H257_16986                    154   2e-38    Aphanomyces astaci
gb|KDO31855.1|  hypothetical protein SPRG_03775                         149   9e-37    Saprolegnia parasitica CBS 223.65
ref|XP_008611391.1|  hypothetical protein SDRG_07341                    148   2e-36    Saprolegnia diclina VS20
ref|XP_008877903.1|  hypothetical protein, variant 18                   147   2e-36    Aphanomyces invadans
ref|XP_008877892.1|  hypothetical protein, variant 8                    147   3e-36    Aphanomyces invadans
ref|XP_008877893.1|  hypothetical protein, variant 9                    147   3e-36    Aphanomyces invadans
gb|ETL46182.1|  hypothetical protein, variant 1                         142   1e-34    Phytophthora parasitica
gb|ETL99327.1|  hypothetical protein, variant 1                         142   1e-34    Phytophthora parasitica
gb|ETI52906.1|  hypothetical protein, variant 1                         142   1e-34    Phytophthora parasitica P1569
gb|ETP50692.1|  hypothetical protein, variant 1                         142   1e-34    Phytophthora parasitica P10297
gb|ETL99329.1|  hypothetical protein, variant 3                         142   1e-34    Phytophthora parasitica
ref|XP_002909241.1|  conserved hypothetical protein                     142   1e-34    Phytophthora infestans T30-4
gb|ETP50694.1|  hypothetical protein, variant 3                         142   1e-34    Phytophthora parasitica P10297
gb|ETI52908.1|  hypothetical protein, variant 3                         142   1e-34    Phytophthora parasitica P1569
gb|ETL46184.1|  hypothetical protein, variant 3                         142   2e-34    Phytophthora parasitica
gb|ETL99326.1|  hypothetical protein L917_03802                         142   2e-34    Phytophthora parasitica
gb|ETI52905.1|  hypothetical protein F443_04062                         142   2e-34    Phytophthora parasitica P1569
gb|ETP50691.1|  hypothetical protein F442_04046                         142   2e-34    Phytophthora parasitica P10297
gb|ETL46181.1|  hypothetical protein L916_03887                         142   2e-34    Phytophthora parasitica
ref|XP_008901274.1|  hypothetical protein, variant 1                    142   2e-34    Phytophthora parasitica INRA-310
ref|XP_008901276.1|  hypothetical protein, variant 3                    142   2e-34    Phytophthora parasitica INRA-310
ref|XP_008901271.1|  hypothetical protein PPTG_08104                    142   2e-34    Phytophthora parasitica INRA-310
emb|CCA25522.1|  conserved hypothetical protein                         139   1e-33    Albugo laibachii Nc14
gb|ETM52471.1|  hypothetical protein, variant 1                         139   2e-33    Phytophthora parasitica
ref|XP_009529340.1|  hypothetical protein PHYSODRAFT_315827             139   2e-33    Phytophthora sojae
gb|ETM52473.1|  hypothetical protein, variant 3                         139   2e-33    Phytophthora parasitica
gb|ETM52470.1|  hypothetical protein L914_03906                         139   2e-33    Phytophthora parasitica
gb|ETP50693.1|  hypothetical protein, variant 2                         136   2e-32    Phytophthora parasitica P10297
gb|ETL99328.1|  hypothetical protein, variant 2                         136   2e-32    Phytophthora parasitica
gb|ETL46183.1|  hypothetical protein, variant 2                         136   2e-32    Phytophthora parasitica
gb|ETI52907.1|  hypothetical protein, variant 2                         136   2e-32    Phytophthora parasitica P1569
ref|XP_008901275.1|  hypothetical protein, variant 2                    135   3e-32    Phytophthora parasitica INRA-310
gb|ETM52472.1|  hypothetical protein, variant 2                         132   3e-31    Phytophthora parasitica
ref|XP_005651351.1|  hypothetical protein COCSUDRAFT_12255              132   3e-31    Coccomyxa subellipsoidea C-169
gb|KHG25783.1|  hypothetical protein F383_07510                         104   2e-23    Gossypium arboreum [tree cotton]
gb|KJB58439.1|  hypothetical protein B456_009G209900                    105   7e-22    Gossypium raimondii
gb|EJK61150.1|  hypothetical protein THAOC_18408                      99.8    2e-20    Thalassiosira oceanica
emb|CAB45564.1|  hypothetical protein                                   100   2e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002288749.1|  hypothetical protein THAPSDRAFT_261726           99.8    5e-20    Thalassiosira pseudonana CCMP1335
ref|XP_002783413.1|  hypothetical protein Pmar_PMAR006939             96.3    7e-20    Perkinsus marinus ATCC 50983
gb|ETO31334.1|  hypothetical protein RFI_05786                        94.4    3e-18    Reticulomyxa filosa
gb|KHG18087.1|  hypothetical protein F383_21533                       85.9    8e-18    Gossypium arboreum [tree cotton]
ref|XP_002778054.1|  hypothetical protein Pmar_PMAR018491             88.2    2e-17    Perkinsus marinus ATCC 50983
ref|XP_002778051.1|  hypothetical protein Pmar_PMAR018488             87.0    3e-17    Perkinsus marinus ATCC 50983
emb|CCC89292.1|  unnamed protein product                              89.4    1e-16    Trypanosoma congolense IL3000
ref|XP_002783415.1|  hypothetical protein Pmar_PMAR006941             87.8    1e-16    Perkinsus marinus ATCC 50983
ref|XP_002765607.1|  hypothetical protein Pmar_PMAR013671             89.0    3e-16    Perkinsus marinus ATCC 50983
ref|XP_007017324.1|  Calcineurin-like metallo-phosphoesterase sup...  65.9    4e-16    
ref|XP_002781370.1|  hypothetical protein Pmar_PMAR020755             87.0    1e-15    Perkinsus marinus ATCC 50983
pir||T05132  hypothetical protein F7H19.190 - Arabidopsis thaliana    80.9    4e-14 
ref|XP_003875104.1|  conserved hypothetical protein                   82.0    4e-14    Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_010698662.1|  hypothetical protein LPMP_204610                 81.6    5e-14    Leishmania panamensis
ref|XP_003723012.1|  conserved hypothetical protein                   81.6    5e-14    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_001682794.1|  conserved hypothetical protein                   81.6    6e-14    Leishmania major strain Friedlin
emb|CCC46388.1|  conserved hypothetical protein, fragment             81.3    6e-14    Trypanosoma vivax Y486
ref|XP_001465175.1|  conserved hypothetical protein                   80.1    2e-13    Leishmania infantum JPCM5
emb|CBH08850.1|  hypothetical protein, conserved                      77.8    1e-12    Trypanosoma brucei gambiense DAL972
ref|XP_001218808.1|  hypothetical protein                             77.8    1e-12    Trypanosoma brucei brucei TREU927
gb|KHG23677.1|  Phosphoenolpyruvate carboxylase                       72.0    2e-12    Gossypium arboreum [tree cotton]
ref|XP_005846358.1|  hypothetical protein CHLNCDRAFT_135803           71.2    2e-11    Chlorella variabilis
ref|XP_009313637.1|  hypothetical protein DQ04_07941000               72.4    6e-11    Trypanosoma grayi
ref|XP_010698663.1|  hypothetical protein LPMP_204620                 70.5    2e-10    Leishmania panamensis
ref|XP_003723013.1|  conserved hypothetical protein                   70.5    2e-10    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_008877881.1|  hypothetical protein, variant 26                 69.7    4e-10    Aphanomyces invadans
ref|XP_008877889.1|  hypothetical protein, variant 34                 69.3    4e-10    Aphanomyces invadans
ref|XP_008877905.1|  hypothetical protein, variant 21                 69.3    4e-10    Aphanomyces invadans
emb|CCW59812.1|  unnamed protein product                              68.9    7e-10    Phytomonas sp. isolate EM1
ref|WP_015353193.1|  hypothetical protein                             66.6    3e-09    Myxococcus stipitatus
ref|XP_003875105.1|  conserved hypothetical protein                   65.9    6e-09    Leishmania mexicana MHOM/GT/2001/U1103
gb|KDO84271.1|  hypothetical protein CISIN_1g0017372mg                65.1    6e-09    Citrus sinensis [apfelsine]
ref|XP_001682795.1|  conserved hypothetical protein                   65.9    7e-09    Leishmania major strain Friedlin
ref|XP_001465174.1|  conserved hypothetical protein                   63.9    2e-08    Leishmania infantum JPCM5
gb|KJB58440.1|  hypothetical protein B456_009G209900                  63.5    3e-08    Gossypium raimondii
gb|KCW86237.1|  hypothetical protein EUGRSUZ_B02922                   63.2    4e-08    Eucalyptus grandis [rose gum]
gb|KFE61079.1|  hypothetical protein DB31_4514                        63.2    4e-08    Hyalangium minutum
ref|WP_044198433.1|  hypothetical protein                             63.2    4e-08    Hyalangium minutum
ref|WP_012235264.1|  calcineurin-like phosphoesterase                 62.8    5e-08    Sorangium cellulosum
ref|WP_044198580.1|  hypothetical protein                             62.8    6e-08    Hyalangium minutum
ref|WP_043410718.1|  hypothetical protein                             62.0    1e-07    Archangium violaceum
ref|WP_020735096.1|  hypothetical protein                             61.6    1e-07    Sorangium cellulosum
ref|WP_028446622.1|  hypothetical protein                             61.6    1e-07    Chitinimonas koreensis
gb|AFE05765.1|  hypothetical protein COCOR_04316                      60.8    3e-07    Corallococcus coralloides DSM 2259
ref|WP_043323473.1|  hypothetical protein                             60.5    3e-07    
ref|WP_006609975.1|  hypothetical protein                             58.5    1e-06    Bradyrhizobium sp. ORS 285
ref|WP_009027423.1|  hypothetical protein                             58.5    2e-06    Bradyrhizobium sp. ORS 375
gb|AHG91819.1|  hypothetical protein J421_4282                        57.8    3e-06    Gemmatirosa kalamazoonesis
ref|WP_002615021.1|  hypothetical protein                             57.8    3e-06    Stigmatella aurantiaca
gb|EPX59759.1|  hypothetical protein D187_002503                      57.4    4e-06    Cystobacter fuscus DSM 2262
ref|WP_043431616.1|  hypothetical protein                             57.0    5e-06    Cystobacter fuscus
ref|WP_035319266.1|  hypothetical protein                             57.0    5e-06    
emb|CCF16816.1|  calcineurin-like phosphoesterase family protein      57.0    5e-06    Brevibacillus laterosporus GI-9
ref|WP_011556989.1|  hypothetical protein                             56.2    8e-06    Myxococcus xanthus
ref|WP_002610851.1|  hypothetical protein                             55.5    2e-05    Stigmatella aurantiaca
gb|ADO74394.1|  conserved uncharacterized protein                     55.1    2e-05    Stigmatella aurantiaca DW4/3-1
ref|WP_002633837.1|  hypothetical protein                             55.1    2e-05    Myxococcus hansupus
ref|WP_013937276.1|  hypothetical protein                             55.1    2e-05    Myxococcus macrosporus
gb|AFE03418.1|  hypothetical protein COCOR_00329                      54.7    3e-05    Corallococcus coralloides DSM 2259
ref|WP_043322535.1|  hypothetical protein                             54.3    3e-05    
ref|WP_011927548.1|  hypothetical protein                             54.3    3e-05    Bradyrhizobium sp. ORS 278
ref|WP_043405695.1|  hypothetical protein                             53.5    6e-05    
ref|WP_011554921.1|  hypothetical protein                             53.1    9e-05    Myxococcus xanthus
ref|WP_027033117.1|  hypothetical protein                             51.2    5e-04    
emb|CAD31267.1|  HYPOTHETICAL PROTEIN                                 50.8    5e-04    Mesorhizobium japonicum R7A
ref|WP_028373661.1|  hypothetical protein                             50.8    6e-04    Legionella lansingensis



>ref|XP_009618515.1| PREDICTED: uncharacterized protein LOC104110671 isoform X2 [Nicotiana 
tomentosiformis]
Length=797

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 175/193 (91%), Gaps = 3/193 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GMD LSRGGAVIYY+SVFL
Sbjct  605  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKKGMDFLSRGGAVIYYSSVFL  664

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN KGDLEVFTL
Sbjct  665  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINNKGDLEVFTL  724

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEWKLD NW+ E   PQ+PSY++KFPSKWRA SL QDP+NTVR++D FVIEQTE
Sbjct  725  AVDKVPKEWKLDPNWDGEPKQPQEPSYLQKFPSKWRAASLNQDPVNTVRIIDQFVIEQTE  784

Query  211  KSDSESMNGSKTQ  173
            + DSE  NG+  Q
Sbjct  785  QHDSELTNGTVNQ  797



>emb|CAN68801.1| hypothetical protein VITISV_008808 [Vitis vinifera]
Length=289

 Score =   327 bits (838),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  99   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGVLSLSRGGAAIYYASVFL  158

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  159  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  218

Query  382  AVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKS  206
            AVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+ TVR+VDHFVI+QT K 
Sbjct  219  AVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPLATVRIVDHFVIQQTGKP  278

Query  205  DSESMNGSKTQ  173
            D E+  G  T 
Sbjct  279  DLETRTGPVTH  289



>ref|XP_009629701.1| PREDICTED: uncharacterized protein LOC104119814 [Nicotiana tomentosiformis]
Length=1020

 Score =   346 bits (888),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMS FDVPEVMAVTR NICKNGMDSLSRGGAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSGFDVPEVMAVTRSNICKNGMDSLSRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+ GSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN KGDLEVFTL
Sbjct  888   YFWVLSTPVVSLILGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINKKGDLEVFTL  947

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD  W+ E   PQ+PSY++KFPSKWRA  LQQDP+NTVR++DHFVIEQ E
Sbjct  948   AVDKVPKEWKLDPKWDGESKQPQEPSYLQKFPSKWRAKLLQQDPVNTVRIIDHFVIEQKE  1007

Query  211   KSDSESMNGSKTQ  173
             K DSE  NGS  Q
Sbjct  1008  KPDSELSNGSLNQ  1020



>ref|XP_009765848.1| PREDICTED: uncharacterized protein LOC104217330 isoform X2 [Nicotiana 
sylvestris]
Length=797

 Score =   340 bits (873),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 173/193 (90%), Gaps = 3/193 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGM  LSRGGAVIYY+SVFL
Sbjct  605  GLRTRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGMGFLSRGGAVIYYSSVFL  664

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN KG+LEVFTL
Sbjct  665  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINNKGNLEVFTL  724

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEWKLD NW+ E   PQ+PSY+RKFPSKWRA SL QDP+ TVR++D FVIE+TE
Sbjct  725  AVDKVPKEWKLDPNWDGEQKQPQEPSYLRKFPSKWRAASLNQDPVTTVRIIDQFVIERTE  784

Query  211  KSDSESMNGSKTQ  173
            K DSE  NG+  Q
Sbjct  785  KHDSELTNGTVNQ  797



>ref|XP_009618505.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618510.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
Length=1019

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 175/193 (91%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GMD LSRGGAVIYY+SVFL
Sbjct  827   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKKGMDFLSRGGAVIYYSSVFL  886

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN KGDLEVFTL
Sbjct  887   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINNKGDLEVFTL  946

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD NW+ E   PQ+PSY++KFPSKWRA SL QDP+NTVR++D FVIEQTE
Sbjct  947   AVDKVPKEWKLDPNWDGEPKQPQEPSYLQKFPSKWRAASLNQDPVNTVRIIDQFVIEQTE  1006

Query  211   KSDSESMNGSKTQ  173
             + DSE  NG+  Q
Sbjct  1007  QHDSELTNGTVNQ  1019



>gb|KDO84264.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=422

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM SLSRGGAVIYY SVFL
Sbjct  230  GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGMQSLSRGGAVIYYASVFL  289

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEV+TL
Sbjct  290  YFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKAFTRFHINHDGDLEVYTL  349

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QDP+NTV+++DHFVI+QTE
Sbjct  350  AVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQDPLNTVKIIDHFVIQQTE  409

Query  211  KSDSESMNGSKT  176
            K D  + N S T
Sbjct  410  KPDLGASNRSVT  421



>gb|KDO84265.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=424

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM SLSRGGAVIYY SVFL
Sbjct  232  GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGMQSLSRGGAVIYYASVFL  291

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEV+TL
Sbjct  292  YFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKAFTRFHINHDGDLEVYTL  351

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QDP+NTV+++DHFVI+QTE
Sbjct  352  AVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQDPLNTVKIIDHFVIQQTE  411

Query  211  KSDSESMNGSKT  176
            K D  + N S T
Sbjct  412  KPDLGASNRSVT  423



>gb|KDO84266.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
 gb|KDO84267.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
 gb|KDO84268.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
 gb|KDO84269.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=458

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM SLSRGGAVIYY SVFL
Sbjct  266  GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGMQSLSRGGAVIYYASVFL  325

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEV+TL
Sbjct  326  YFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKAFTRFHINHDGDLEVYTL  385

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QDP+NTV+++DHFVI+QTE
Sbjct  386  AVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQDPLNTVKIIDHFVIQQTE  445

Query  211  KSDSESMNGSKT  176
            K D  + N S T
Sbjct  446  KPDLGASNRSVT  457



>ref|XP_009765845.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765846.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
Length=1019

 Score =   341 bits (874),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 173/193 (90%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGM  LSRGGAVIYY+SVFL
Sbjct  827   GLRTRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGMGFLSRGGAVIYYSSVFL  886

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN KG+LEVFTL
Sbjct  887   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINNKGNLEVFTL  946

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD NW+ E   PQ+PSY+RKFPSKWRA SL QDP+ TVR++D FVIE+TE
Sbjct  947   AVDKVPKEWKLDPNWDGEQKQPQEPSYLRKFPSKWRAASLNQDPVTTVRIIDQFVIERTE  1006

Query  211   KSDSESMNGSKTQ  173
             K DSE  NG+  Q
Sbjct  1007  KHDSELTNGTVNQ  1019



>ref|XP_009761575.1| PREDICTED: uncharacterized protein LOC104213728 [Nicotiana sylvestris]
Length=1019

 Score =   341 bits (874),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMS FDVPEVMAVTR NICKNGMDSLSRGGAVIYY SVFL
Sbjct  828   GLRPRIEQWTFGLYPACIKYLMSGFDVPEVMAVTRSNICKNGMDSLSRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+ GSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN KGDLEVFTL
Sbjct  888   YFWVLSTPVVSLILGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINIKGDLEVFTL  947

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD  W+ E   PQ+PSY++KFPSKWRA +LQQDP+ TVR++DHFVIEQ E
Sbjct  948   AVDKVPKEWKLDPKWDGESKQPQEPSYLQKFPSKWRAKTLQQDPVKTVRIIDHFVIEQKE  1007

Query  211   KSDSESMNGS  182
             K DSE  NGS
Sbjct  1008  KPDSELSNGS  1017



>ref|XP_004252774.1| PREDICTED: uncharacterized protein LOC101266203 [Solanum lycopersicum]
Length=1020

 Score =   340 bits (872),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 172/193 (89%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GL+ RIE WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGMDSLSRGGAVIYY SVFL
Sbjct  828   GLKERIEHWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGMDSLSRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN KGDLEVFTL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINNKGDLEVFTL  947

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD  W+ E   PQ PSY++KFPSKWRA+S  QDP++TVR++D FVIE+TE
Sbjct  948   AVDKVPKEWKLDPKWDGESKHPQDPSYLQKFPSKWRASSPNQDPVDTVRIIDQFVIEKTE  1007

Query  211   KSDSESMNGSKTQ  173
             K DSE  NGS  Q
Sbjct  1008  KHDSELANGSVNQ  1020



>ref|XP_006342611.1| PREDICTED: uncharacterized protein LOC102601564 [Solanum tuberosum]
Length=1020

 Score =   335 bits (859),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  739   LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLY  560
             L+ RIE WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNGMDSLSRGGAVIYY SVFLY
Sbjct  829   LKKRIEHWTFGLYPACIKYLMSAFDVPEVMAVTRNTICKNGMDSLSRGGAVIYYASVFLY  888

Query  559   FWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLA  380
             FWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN KGDLEVFTLA
Sbjct  889   FWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINNKGDLEVFTLA  948

Query  379   VDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
             VDKVPKEWKLD  W+ E   PQ PSY++KFPSKWRA+S  QDP++TVR++D FVIE+T K
Sbjct  949   VDKVPKEWKLDPKWDGESKHPQDPSYLQKFPSKWRASSPNQDPVDTVRIIDQFVIEKTAK  1008

Query  208   SDSESMNGSKTQ  173
              DSE  NGS  Q
Sbjct  1009  HDSELANGSVNQ  1020



>gb|EYU25397.1| hypothetical protein MIMGU_mgv1a000678mg [Erythranthe guttata]
Length=1021

 Score =   333 bits (855),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 172/191 (90%), Gaps = 4/191 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNGMDSLSRGGA IYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGMDSLSRGGAAIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTP+VSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN KGDLEV+TL
Sbjct  888   YFWVFSTPIVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINPKGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +WE E   PQ  S+ RKFPSKWR+ S QQDP+NTVR+VDHFVIEQT 
Sbjct  948   AVDKVPKEWKLDPSWEVESKLPQNQSHFRKFPSKWRSVSSQQDPVNTVRIVDHFVIEQTV  1007

Query  211   KSD-SESMNGS  182
             K +   S+NGS
Sbjct  1008  KPEFVASVNGS  1018



>ref|XP_011083822.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105166233 
[Sesamum indicum]
Length=1005

 Score =   333 bits (854),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 172/193 (89%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAV+R NICKNGMDSLSRGGA IYY SVFL
Sbjct  813   GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVSRNNICKNGMDSLSRGGAAIYYASVFL  872

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTP+VSLVFGSYLY+CINWLH+HFDEAFSSLRIANYKSFTRFHIN KGDLEVFTL
Sbjct  873   YFWVFSTPIVSLVFGSYLYVCINWLHIHFDEAFSSLRIANYKSFTRFHINLKGDLEVFTL  932

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +WE E   PQ  S+ RKFPSKWR+ S QQDP+NTVR+VD FVIE+T 
Sbjct  933   AVDKVPKEWKLDPSWEGESKLPQNLSHRRKFPSKWRSASSQQDPLNTVRIVDQFVIEKTV  992

Query  211   KSDSESMNGSKTQ  173
             + +  S+NGS T 
Sbjct  993   EPEFSSVNGSVTH  1005



>ref|XP_010664590.1| PREDICTED: uncharacterized protein LOC100267859 isoform X3 [Vitis 
vinifera]
Length=722

 Score =   324 bits (830),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  532  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGVLSLSRGGAAIYYASVFL  591

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  592  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  651

Query  382  AVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKS  206
            AVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+ TVR+VDHFVI+QT K 
Sbjct  652  AVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPLATVRIVDHFVIQQTGKP  711

Query  205  DSESMNGSKTQ  173
            D E+  G  T 
Sbjct  712  DLETRTGPVTH  722



>ref|XP_011074457.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
 ref|XP_011074458.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
Length=1007

 Score =   330 bits (846),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNGMDSLSRGGAVIYY SVFL
Sbjct  815   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKNGMDSLSRGGAVIYYASVFL  874

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTP+VSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI +KGDLEVFTL
Sbjct  875   YFWVFSTPIVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHITSKGDLEVFTL  934

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK WKLD +W+ E + P   SY RKFPSKWR+ S QQDP++TVR+VDHFV+E T 
Sbjct  935   AVDKVPKAWKLDPSWDCESKLPHSLSYRRKFPSKWRSVSPQQDPVSTVRIVDHFVVEHTA  994

Query  211   KSDSESMNGSKT  176
             K +  S+NG  T
Sbjct  995   KPEGASVNGPVT  1006



>gb|KDP38386.1| hypothetical protein JCGZ_04311 [Jatropha curcas]
Length=795

 Score =   324 bits (831),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 3/187 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG++SLSRGGA+IYY +VFL
Sbjct  606  GLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGIESLSRGGAIIYYAAVFL  665

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEV+TL
Sbjct  666  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINKNGDLEVYTL  725

Query  382  AVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDK+PKEWKLDSNW+ EP   QQ S+ R+FPSKWRA + Q DP+NTV++VDHFVI QTE
Sbjct  726  AVDKIPKEWKLDSNWDAEPKQLQQLSHHRQFPSKWRAATSQLDPLNTVKIVDHFVIPQTE  785

Query  211  KSDSESM  191
               SE +
Sbjct  786  NQISEQV  792



>gb|KHG22709.1| putative HTH-type transcriptional regulator ybfP [Gossypium arboreum]
Length=237

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 165/196 (84%), Gaps = 6/196 (3%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPE---VMAVTRQNICKNGMDSLSRGGAVIYYTS  572
            GLRAR+E+W FGLYPACIKY MSAFDVPE   VMAVTR NICKNG+ +LSRGGAVIYY S
Sbjct  42   GLRARMEQWIFGLYPACIKYFMSAFDVPEHYQVMAVTRSNICKNGIQALSRGGAVIYYAS  101

Query  571  VFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEV  392
            VFLYFWVFS PVVSLVFGSYLYICINW H+HFDEAFS LRIANYKSFTRFHIN  G+LEV
Sbjct  102  VFLYFWVFSNPVVSLVFGSYLYICINWFHLHFDEAFSYLRIANYKSFTRFHINRDGNLEV  161

Query  391  FTLAVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
            FTLAVDKVP++W LD +W+ E   PQQ S+ RK+PSKW A + QQDP+NTVRVVDHFVI 
Sbjct  162  FTLAVDKVPRDWMLDPDWDMEQKQPQQLSHRRKYPSKWSAAAGQQDPVNTVRVVDHFVIR  221

Query  220  QTEKSDSESMNGSKTQ  173
            Q ++ D  S NGS ++
Sbjct  222  QNQEPDFVSSNGSVSR  237



>ref|XP_006473361.1| PREDICTED: uncharacterized protein LOC102621653 isoform X1 [Citrus 
sinensis]
 ref|XP_006473362.1| PREDICTED: uncharacterized protein LOC102621653 isoform X2 [Citrus 
sinensis]
Length=1019

 Score =   328 bits (840),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM SLSRGGAVIYY SVFL
Sbjct  827   GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGMQSLSRGGAVIYYASVFL  886

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEV+TL
Sbjct  887   YFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKAFTRFHINHDGDLEVYTL  946

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QDP+NTV+++DHFVI+QTE
Sbjct  947   AVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQDPLNTVKIIDHFVIQQTE  1006

Query  211   KSDSESMNGSKT  176
             K D  + N S T
Sbjct  1007  KPDLGASNRSVT  1018



>ref|XP_010098704.1| hypothetical protein L484_026083 [Morus notabilis]
 gb|EXB75607.1| hypothetical protein L484_026083 [Morus notabilis]
Length=865

 Score =   325 bits (832),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 3/189 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSRGGA IYY SVFL
Sbjct  671  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKAGMESLSRGGAAIYYASVFL  730

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHI T GDLEVFTL
Sbjct  731  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHITTDGDLEVFTL  790

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEWKLD +W+ EP+QP   ++ RK+PSKW A S QQDPI+TV++VDHFVI+QT+
Sbjct  791  AVDKVPKEWKLDPDWDGEPKQPQQLNHNRKYPSKWSAASPQQDPIHTVKIVDHFVIKQTD  850

Query  211  KSDSESMNG  185
            + D+ + NG
Sbjct  851  EFDTGASNG  859



>ref|XP_011030451.1| PREDICTED: uncharacterized protein LOC105129897 [Populus euphratica]
Length=1021

 Score =   327 bits (839),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNGM+SLSRGGA+IYY SVF+
Sbjct  829   GLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICKNGMESLSRGGAIIYYASVFI  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSLVFGSYLYICINWLHMHFDEAFSSLRIANYKSFTRFHINKDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A   QQ+P+NTV++VDHFV+ QTE
Sbjct  949   AVDKVPKEWKLDPHWDAEPKQPQQLSHHRKFPSKWSAAVAQQEPLNTVKIVDHFVVRQTE  1008

Query  211   KSDSESMNGS  182
             K D  + +GS
Sbjct  1009  KPDFGTSSGS  1018



>ref|XP_010664589.1| PREDICTED: uncharacterized protein LOC100267859 isoform X2 [Vitis 
vinifera]
Length=901

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  711  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGVLSLSRGGAAIYYASVFL  770

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  771  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  830

Query  382  AVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKS  206
            AVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+ TVR+VDHFVI+QT K 
Sbjct  831  AVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPLATVRIVDHFVIQQTGKP  890

Query  205  DSESMNGSKTQ  173
            D E+  G  T 
Sbjct  891  DLETRTGPVTH  901



>ref|XP_006374985.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 ref|XP_006374986.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52782.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52783.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
Length=1021

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNGM+SLSRGGA+IYY SVF+
Sbjct  829   GLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICKNGMESLSRGGAIIYYASVFI  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSLVFGSYLYICINWLHMHFDEAFSSLRIANYKAFTRFHINKDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A   QQ+P+NTV++VDHFV+ QTE
Sbjct  949   AVDKVPKEWKLDPHWDAEPKQPQQLSHHRKFPSKWSAAVAQQEPLNTVKIVDHFVVRQTE  1008

Query  211   KSDSESMNGS  182
             K D  + +GS
Sbjct  1009  KPDFGTSSGS  1018



>ref|XP_006434822.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
 gb|ESR48062.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
Length=1004

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM SLSRGGAVIYY SVFL
Sbjct  812   GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGMQSLSRGGAVIYYASVFL  871

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEV+TL
Sbjct  872   YFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKAFTRFHINHDGDLEVYTL  931

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEW+LD +W+ E   PQQ S++R+FPSKWRA S  QDP+NTV+++DHFVI+QT+
Sbjct  932   AVDKVPKEWELDPDWDGELKQPQQLSHLRRFPSKWRAASAHQDPLNTVKIIDHFVIQQTD  991

Query  211   KSDSESMNGSKT  176
             K D  + N S T
Sbjct  992   KPDLGASNRSVT  1003



>ref|XP_007017323.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY14548.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
Length=1019

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICKNG+ SLSRGGAVIYY SVFL
Sbjct  829   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSYICKNGLQSLSRGGAVIYYASVFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFG YLY+CINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSLVFGCYLYVCINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+Q    S+ RK+PSKW A+S QQDP+NTVRVVD FVI QT+
Sbjct  949   AVDKVPKEWKLDPDWDGEPKQSPQLSHRRKYPSKWSASSSQQDPVNTVRVVDQFVIRQTD  1008

Query  211   KSDSESMNGS  182
             K DS S NGS
Sbjct  1009  KPDSISSNGS  1018



>ref|XP_004238179.1| PREDICTED: uncharacterized protein LOC101261408 [Solanum lycopersicum]
Length=1010

 Score =   325 bits (834),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 3/182 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMS FDVPEVMAVTR NICKNG+DSLSRGGAVIYY SVFL
Sbjct  829   GLRERIEQWTFGLYPACIKYLMSGFDVPEVMAVTRSNICKNGIDSLSRGGAVIYYASVFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+ GSYLYI INWLH+HFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL
Sbjct  889   YFWVLSTPVVSLILGSYLYISINWLHIHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD  W+ E   PQ+PSY++KFPSKWRA + QQDP+NTVR++DHFVIE  E
Sbjct  949   AVDKVPKEWKLDPKWDGESKQPQEPSYLQKFPSKWRAKASQQDPVNTVRIIDHFVIEHRE  1008

Query  211   KS  206
             K+
Sbjct  1009  KN  1010



>ref|XP_010664588.1| PREDICTED: uncharacterized protein LOC100267859 isoform X1 [Vitis 
vinifera]
Length=1004

 Score =   324 bits (831),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  814   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGVLSLSRGGAAIYYASVFL  873

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  874   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  933

Query  382   AVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKS  206
             AVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+ TVR+VDHFVI+QT K 
Sbjct  934   AVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPLATVRIVDHFVIQQTGKP  993

Query  205   DSESMNGSKTQ  173
             D E+  G  T 
Sbjct  994   DLETRTGPVTH  1004



>emb|CBI19565.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   324 bits (831),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  827   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGVLSLSRGGAAIYYASVFL  886

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  887   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  946

Query  382   AVDKVPKEWKLDSNWETE-PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKS  206
             AVDKVPKEWKLD +W+ E P+Q S++RKFPSKW A + QQDP+ TVR+VDHFVI+QT K 
Sbjct  947   AVDKVPKEWKLDPDWDGEQPKQLSHLRKFPSKWSAATPQQDPLATVRIVDHFVIQQTGKP  1006

Query  205   DSESMNGSKTQ  173
             D E+  G  T 
Sbjct  1007  DLETRTGPVTH  1017



>gb|KJB58436.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=1021

 Score =   324 bits (830),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 169/193 (88%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG+ +LSRGGAVIYY S+FL
Sbjct  829   GLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGIQALSRGGAVIYYASIFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVP+EW LD +W+ E   PQQ S+ RK+PSKW A + QQDP+NTVRVVDHFVI Q E
Sbjct  949   AVDKVPREWMLDPDWDMEQKQPQQLSHRRKYPSKWSAAAGQQDPVNTVRVVDHFVIRQNE  1008

Query  211   KSDSESMNGSKTQ  173
             K D  S NGS ++
Sbjct  1009  KPDFVSSNGSVSR  1021



>ref|XP_008383912.1| PREDICTED: uncharacterized protein LOC103446557 [Malus domestica]
Length=1020

 Score =   323 bits (828),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRAGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVD+VPK WKLD  W+ EP+QP   S++RKFPSKW A + QQDP++TV++VD FVI QT+
Sbjct  948   AVDRVPKAWKLDPEWDREPKQPEQMSHLRKFPSKWSAAAGQQDPLHTVKIVDQFVIRQTD  1007

Query  211   KSDSESMNGS  182
             K+D  + +GS
Sbjct  1008  KTDVGASDGS  1017



>ref|XP_008393833.1| PREDICTED: uncharacterized protein LOC103455994 isoform X2 [Malus 
domestica]
Length=903

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICK GM+SLSR G VIYY SVFL
Sbjct  710  GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKTGMESLSRAGGVIYYASVFL  769

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  770  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  829

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  W+ EP+QP   S++RKFPSKW A++ QQDP+NTV++VD FVI QT+
Sbjct  830  AVDKVPKKWKLDPEWDREPKQPEQMSHLRKFPSKWSASAGQQDPLNTVKIVDQFVIRQTD  889

Query  211  KSDSESMNGS  182
            K D  + + S
Sbjct  890  KXDVGASDAS  899



>ref|XP_008220172.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103320287 
[Prunus mume]
Length=1020

 Score =   322 bits (826),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR +ICKNGM+SLSR GA+IYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRXHICKNGMESLSRAGAIIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFW+FSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI + GDLEV+TL
Sbjct  888   YFWMFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD  W++E   PQQ S++RKFPSKW A + QQDP+NTV++VDHFVI QT+
Sbjct  948   AVDKVPKEWKLDPEWDSELRQPQQMSHLRKFPSKWNAAAAQQDPLNTVKIVDHFVIRQTD  1007

Query  211   KSDSESMNGS  182
             K+ + + +GS
Sbjct  1008  KTVNGASDGS  1017



>ref|XP_009367394.1| PREDICTED: uncharacterized protein LOC103957048 [Pyrus x bretschneideri]
Length=1020

 Score =   322 bits (826),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR G VIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRAGGVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  W+ EP+QP   S++R+FPSKW A++ QQDP+NTV++VD FVI QT+
Sbjct  948   AVDKVPKKWKLDPEWDREPKQPEQMSHLREFPSKWSASAGQQDPLNTVKIVDQFVIRQTD  1007

Query  211   KSDSESMNGS  182
             K+D  + + S
Sbjct  1008  KTDVGASDAS  1017



>ref|XP_009370173.1| PREDICTED: uncharacterized protein LOC103959542 [Pyrus x bretschneideri]
Length=1020

 Score =   322 bits (824),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRVGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVD+VPK WKLD  W+ EP+QP   S++RKFPSKW A + QQDP++TV++VD FVI QT+
Sbjct  948   AVDRVPKAWKLDPEWDREPKQPEQMSHLRKFPSKWSAAAGQQDPLHTVKIVDQFVIRQTD  1007

Query  211   KSDSESMNGS  182
             K+D  + +GS
Sbjct  1008  KTDVGASDGS  1017



>ref|XP_011458951.1| PREDICTED: uncharacterized protein LOC101313275 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1024

 Score =   322 bits (824),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 167/190 (88%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR GA IYY SVFL
Sbjct  832   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRLGACIYYASVFL  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYKSFTRFHINT GDLEV+TL
Sbjct  892   YFWVFSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKSFTRFHINTDGDLEVYTL  951

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A + QQDP++ V++VDHFVI QT+
Sbjct  952   AVDKVPKEWKLDPDWDAEPKQPQQMSHRRKFPSKWSAKAAQQDPLHNVKIVDHFVIRQTD  1011

Query  211   KSDSESMNGS  182
              +D    +GS
Sbjct  1012  NTDIAGSDGS  1021



>ref|XP_007227027.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
 gb|EMJ28226.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
Length=1021

 Score =   322 bits (824),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 6/193 (3%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR GA+IYY SVFL
Sbjct  826   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRAGAIIYYASVFL  885

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI + GDL+V+TL
Sbjct  886   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIGSNGDLDVYTL  945

Query  382   AVDKVPKEWKLDSNWETE------PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
             AVDKVPKEWKLD  W++E      PQQ S+ RKFPSKW A + QQDP+NTV++VDHFVI 
Sbjct  946   AVDKVPKEWKLDPEWDSEDRKPRQPQQMSHHRKFPSKWSAAAAQQDPLNTVKIVDHFVIR  1005

Query  220   QTEKSDSESMNGS  182
             QT+K+ + + +GS
Sbjct  1006  QTDKTVNGASDGS  1018



>ref|XP_011458950.1| PREDICTED: uncharacterized protein LOC101313275 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1027

 Score =   322 bits (824),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 167/190 (88%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR GA IYY SVFL
Sbjct  835   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRLGACIYYASVFL  894

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYKSFTRFHINT GDLEV+TL
Sbjct  895   YFWVFSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKSFTRFHINTDGDLEVYTL  954

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A + QQDP++ V++VDHFVI QT+
Sbjct  955   AVDKVPKEWKLDPDWDAEPKQPQQMSHRRKFPSKWSAKAAQQDPLHNVKIVDHFVIRQTD  1014

Query  211   KSDSESMNGS  182
              +D    +GS
Sbjct  1015  NTDIAGSDGS  1024



>ref|XP_004291134.1| PREDICTED: uncharacterized protein LOC101313275 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=1022

 Score =   322 bits (824),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 167/190 (88%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICKNGM+SLSR GA IYY SVFL
Sbjct  830   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKNGMESLSRLGACIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYKSFTRFHINT GDLEV+TL
Sbjct  890   YFWVFSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKSFTRFHINTDGDLEVYTL  949

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+ RKFPSKW A + QQDP++ V++VDHFVI QT+
Sbjct  950   AVDKVPKEWKLDPDWDAEPKQPQQMSHRRKFPSKWSAKAAQQDPLHNVKIVDHFVIRQTD  1009

Query  211   KSDSESMNGS  182
              +D    +GS
Sbjct  1010  NTDIAGSDGS  1019



>gb|KCW86234.1| hypothetical protein EUGRSUZ_B02922 [Eucalyptus grandis]
Length=706

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR+RIE+WT GLYPACIKYLMSAFDVPEVMAV+R NIC+ GM+SLSRGGA IYY SVFL
Sbjct  513  GLRSRIEQWTLGLYPACIKYLMSAFDVPEVMAVSRTNICRRGMESLSRGGAAIYYASVFL  572

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK FTRFHIN+ GDLEV+TL
Sbjct  573  YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKGFTRFHINSGGDLEVYTL  632

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             VDKVPKEWKLD +W+ EP+QP   S++R+FPSKW + +  QDP+ TVR+VDHFVI +  
Sbjct  633  VVDKVPKEWKLDPDWDEEPKQPEQLSHLRRFPSKWSSAAPLQDPVKTVRIVDHFVINRMV  692

Query  211  KSDSESMNG  185
            K+ SE+ NG
Sbjct  693  KTQSEASNG  701



>ref|XP_002510264.1| hydrolase, putative [Ricinus communis]
 gb|EEF52451.1| hydrolase, putative [Ricinus communis]
Length=1006

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR+RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G++SLSRGGAVIYY SVFL
Sbjct  814   GLRSRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGIESLSRGGAVIYYASVFL  873

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  874   YFWVFSTPVVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKSFTRFHINKDGDLEVFTL  933

Query  382   AVDKVPKEWKLDSNW---ETEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDK+PK+WKLDS W   E +PQQ S+ R++PSKWRA + QQDP+NTV++VD FVI +TE
Sbjct  934   AVDKIPKDWKLDSKWDGEEKQPQQLSHQRRYPSKWRAATSQQDPLNTVKIVDSFVIRRTE  993

Query  211   KSDSESMNGS  182
               ++ + NGS
Sbjct  994   NPNTGASNGS  1003



>ref|XP_008393832.1| PREDICTED: uncharacterized protein LOC103455994 isoform X1 [Malus 
domestica]
Length=1021

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKY MSAFDVPEVMAVTR NICK GM+SLSR G VIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYFMSAFDVPEVMAVTRNNICKTGMESLSRAGGVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  W+ EP+QP   S++RKFPSKW A++ QQDP+NTV++VD FVI QT+
Sbjct  948   AVDKVPKKWKLDPEWDREPKQPEQMSHLRKFPSKWSASAGQQDPLNTVKIVDQFVIRQTD  1007

Query  211   KSDSESMNGS  182
             K D  + + S
Sbjct  1008  KXDVGASDAS  1017



>ref|XP_004499083.1| PREDICTED: uncharacterized protein LOC101514142 [Cicer arietinum]
Length=1017

 Score =   320 bits (819),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 173/194 (89%), Gaps = 4/194 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG++SLSRGGAVIYY SVFL
Sbjct  824   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGLESLSRGGAVIYYASVFL  883

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  884   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  943

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT-  215
             AVDKVPKEWKLDS W+ E   PQ  S++R+FPSKWRA    QDP++TV++VDHF+IE+T 
Sbjct  944   AVDKVPKEWKLDSEWDGETKNPQMLSHLRRFPSKWRAVIANQDPVHTVKIVDHFIIERTN  1003

Query  214   EKSDSESMNGSKTQ  173
             +K++ ++ +    Q
Sbjct  1004  DKNECDTASNGLDQ  1017



>ref|XP_008775262.1| PREDICTED: uncharacterized protein LOC103695663 [Phoenix dactylifera]
Length=195

 Score =   296 bits (759),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK GM+SL R  A+IYY SVFL
Sbjct  11   GLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVSRSKICKKGMESLPRSSAIIYYASVFL  70

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSL+FGSYLY+CINWLH+HFDEAFSSLRIANYK+FTRFHI + GDLEVFTL
Sbjct  71   YFWVFSTPVVSLIFGSYLYLCINWLHIHFDEAFSSLRIANYKAFTRFHITSTGDLEVFTL  130

Query  382  AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVPKEWKLD  W+ EP+   Q S++RKFPSKWR  S   DP+N++R+VDHF+I++++
Sbjct  131  ALDKVPKEWKLDPEWDAEPKPQPQLSHLRKFPSKWRTAS-GPDPVNSMRIVDHFIIQKSQ  189

Query  211  KSD  203
             ++
Sbjct  190  DAN  192



>emb|CDP01374.1| unnamed protein product [Coffea canephora]
Length=1010

 Score =   319 bits (817),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK G++SLSR GA IYY SVFL
Sbjct  830   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNYICKKGIESLSRQGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI+ KGDLEVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHIDRKGDLEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQQP-SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKS  206
             AVDKVPKEWKLD NW+ EP+Q  S+ RKFPSKWRATS QQDP++ VR++DHFVI+QT+K 
Sbjct  950   AVDKVPKEWKLDPNWDAEPKQHLSHQRKFPSKWRATSSQQDPVSAVRIIDHFVIQQTQKE  1009

Query  205   D  203
             +
Sbjct  1010  N  1010



>ref|XP_006595961.1| PREDICTED: uncharacterized protein LOC100820584 isoform X3 [Glycine 
max]
Length=910

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 167/186 (90%), Gaps = 3/186 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC NG++S+SRGGAVIYY SVFL
Sbjct  717  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICNNGLESISRGGAVIYYASVFL  776

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  777  YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  836

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA    QDP+ TV++VDHFVI +T+
Sbjct  837  AVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHQDPVRTVKIVDHFVIGRTD  896

Query  211  KSDSES  194
            K+D  +
Sbjct  897  KNDCAT  902



>ref|XP_007160825.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
 gb|ESW32819.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
Length=1010

 Score =   317 bits (811),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 167/183 (91%), Gaps = 3/183 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG++SLSRGGAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICKNGLESLSRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEV+T+
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINYDGDLEVYTM  947

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ E   PQ+ S+ R+FPSKWRA +  QDP++TV++VDHFVI +TE
Sbjct  948   AVDKVPKEWKLDPDWDGEAKHPQELSHFRRFPSKWRAVTAHQDPVHTVKIVDHFVISRTE  1007

Query  211   KSD  203
              ++
Sbjct  1008  NNE  1010



>ref|XP_010044196.1| PREDICTED: uncharacterized protein LOC104433212 isoform X2 [Eucalyptus 
grandis]
Length=926

 Score =   314 bits (805),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR+RIE+WT GLYPACIKYLMSAFDVPEVMAV+R NIC+ GM+SLSRGGA IYY SVFL
Sbjct  733  GLRSRIEQWTLGLYPACIKYLMSAFDVPEVMAVSRTNICRRGMESLSRGGAAIYYASVFL  792

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK FTRFHIN+ GDLEV+TL
Sbjct  793  YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKGFTRFHINSGGDLEVYTL  852

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             VDKVPKEWKLD +W+ EP+QP   S++R+FPSKW + +  QDP+ TVR+VDHFVI +  
Sbjct  853  VVDKVPKEWKLDPDWDEEPKQPEQLSHLRRFPSKWSSAAPLQDPVKTVRIVDHFVINRMV  912

Query  211  KSDSESMNG  185
            K+ SE+ NG
Sbjct  913  KTQSEASNG  921



>ref|XP_003544449.1| PREDICTED: uncharacterized protein LOC100820584 isoform X1 [Glycine 
max]
 ref|XP_006595960.1| PREDICTED: uncharacterized protein LOC100820584 isoform X2 [Glycine 
max]
 gb|KHN46303.1| hypothetical protein glysoja_045314 [Glycine soja]
Length=1021

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 167/186 (90%), Gaps = 3/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC NG++S+SRGGAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSNICNNGLESISRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA    QDP+ TV++VDHFVI +T+
Sbjct  948   AVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHQDPVRTVKIVDHFVIGRTD  1007

Query  211   KSDSES  194
             K+D  +
Sbjct  1008  KNDCAT  1013



>ref|XP_010044195.1| PREDICTED: uncharacterized protein LOC104433212 isoform X1 [Eucalyptus 
grandis]
Length=1012

 Score =   315 bits (806),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 166/189 (88%), Gaps = 3/189 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR+RIE+WT GLYPACIKYLMSAFDVPEVMAV+R NIC+ GM+SLSRGGA IYY SVFL
Sbjct  819   GLRSRIEQWTLGLYPACIKYLMSAFDVPEVMAVSRTNICRRGMESLSRGGAAIYYASVFL  878

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK FTRFHIN+ GDLEV+TL
Sbjct  879   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKGFTRFHINSGGDLEVYTL  938

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W+ EP+QP   S++R+FPSKW + +  QDP+ TVR+VDHFVI +  
Sbjct  939   VVDKVPKEWKLDPDWDEEPKQPEQLSHLRRFPSKWSSAAPLQDPVKTVRIVDHFVINRMV  998

Query  211   KSDSESMNG  185
             K+ SE+ NG
Sbjct  999   KTQSEASNG  1007



>ref|XP_006601298.1| PREDICTED: uncharacterized protein LOC100819940 isoform X4 [Glycine 
max]
Length=987

 Score =   313 bits (803),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 168/186 (90%), Gaps = 3/186 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC+NG++S+SRGGAVIYY SVFL
Sbjct  794  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICQNGLESISRGGAVIYYASVFL  853

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  854  YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  913

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA     DP++TV++VDHFVI +T+
Sbjct  914  AVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHLDPVHTVKIVDHFVIGRTD  973

Query  211  KSDSES  194
            K+D  +
Sbjct  974  KNDCAT  979



>gb|KHN12760.1| hypothetical protein glysoja_008723 [Glycine soja]
Length=1021

 Score =   313 bits (803),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 168/186 (90%), Gaps = 3/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC+NG++S+SRGGAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICQNGLESISRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA     DP++TV++VDHFVI +T+
Sbjct  948   AVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHLDPVHTVKIVDHFVIGRTD  1007

Query  211   KSDSES  194
             K+D  +
Sbjct  1008  KNDCAT  1013



>ref|XP_003550348.1| PREDICTED: uncharacterized protein LOC100819940 isoform X1 [Glycine 
max]
 ref|XP_006601296.1| PREDICTED: uncharacterized protein LOC100819940 isoform X2 [Glycine 
max]
 ref|XP_006601297.1| PREDICTED: uncharacterized protein LOC100819940 isoform X3 [Glycine 
max]
Length=1021

 Score =   313 bits (803),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 168/186 (90%), Gaps = 3/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NIC+NG++S+SRGGAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICQNGLESISRGGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN+ GDLEV+TL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHINSDGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ E + P   S++R+FPSKWRA     DP++TV++VDHFVI +T+
Sbjct  948   AVDKVPKEWKLDPDWDGETKHPHELSHLRRFPSKWRAAIAHLDPVHTVKIVDHFVIGRTD  1007

Query  211   KSDSES  194
             K+D  +
Sbjct  1008  KNDCAT  1013



>ref|XP_010275607.1| PREDICTED: uncharacterized protein LOC104610601 [Nelumbo nucifera]
Length=1000

 Score =   313 bits (802),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 1/176 (1%)
 Frame = -2

Query  739  LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLY  560
            LRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM+SLSRGGA+IYY SVFLY
Sbjct  815  LRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSTICKQGMESLSRGGAIIYYASVFLY  874

Query  559  FWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLA  380
            FWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYK+FTR HI  +GDLEVFTLA
Sbjct  875  FWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRCHITPEGDLEVFTLA  934

Query  379  VDKVPKEWKLDSNWETEPQQP-SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            VDKVPKEWKLD +W+ EP+QP SY+RKFPSKW A +L QDP++TVR+VDHF+I++T
Sbjct  935  VDKVPKEWKLDPDWDREPKQPQSYLRKFPSKWCAAALPQDPVSTVRIVDHFIIQKT  990



>ref|XP_010936846.1| PREDICTED: uncharacterized protein LOC105056370 [Elaeis guineensis]
Length=1032

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 165/189 (87%), Gaps = 4/189 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR R+ERWTFGLYPACIKYLMSAFDVPEVMAVTR NICKNGM+SLSRGGA+IYY SVFL
Sbjct  845   GLRVRMERWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKNGMESLSRGGAIIYYGSVFL  904

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  905   YFWVFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIAVSGDLEVFTL  964

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD  W+ EP+QP   S+ R+FPSKW+A S   DP+N+VR+VDHFVI+++ 
Sbjct  965   AVDKVPKEWKLDPEWDAEPKQPKQLSHRRRFPSKWKAAS-GPDPVNSVRIVDHFVIQRSL  1023

Query  211   KSDSESMNG  185
                +E  NG
Sbjct  1024  TDLTEGGNG  1032



>gb|KJB63807.1| hypothetical protein B456_010G017500 [Gossypium raimondii]
Length=1017

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEV+AVTR NICK G+ SLSRGGA+IYY SVFL
Sbjct  825   GLRARIEQWTFGLYPACIKYLMSAFDVPEVIAVTRSNICKYGIQSLSRGGAIIYYASVFL  884

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  885   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINCDGDLEVFTL  944

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             A+DKVP+EWKLD +W+ E   PQQ S+  K PSKW A+   QDP+NTVR+VD F+I+QT+
Sbjct  945   AIDKVPREWKLDPDWDGEAKQPQQWSHRIKHPSKWSASVSHQDPLNTVRIVDRFIIKQTD  1004

Query  211   KSDSESMNGS  182
               D  S NGS
Sbjct  1005  NQDFASSNGS  1014



>gb|KHG27255.1| aat [Gossypium arboreum]
Length=986

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEV+AVTR NICK G+ SLSRGGA+IYY SVFL
Sbjct  794  GLRARIEQWTFGLYPACIKYLMSAFDVPEVIAVTRSNICKYGIQSLSRGGAIIYYASVFL  853

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  854  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  913

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVP+EWKLD +W+ E   PQQ S+  K PSKW A    QDP+NTVR+VD F+I+QT+
Sbjct  914  AIDKVPREWKLDPDWDGEAKQPQQWSHRIKHPSKWSACVSHQDPLNTVRIVDRFIIKQTD  973

Query  211  KSDSESMNGS  182
              D  S NGS
Sbjct  974  NQDFASSNGS  983



>emb|CDX94143.1| BnaC07g37770D [Brassica napus]
Length=1007

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  822   GLRVRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  881

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI + GDLEVFTL
Sbjct  882   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKSDGDLEVFTL  941

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W++EP+   + S++R+FPSKW AT+LQQDPINTV++VDHFVI +++
Sbjct  942   GVDKVPKEWKLDKDWDSEPRSTVKMSHLRRFPSKWCATTLQQDPINTVKIVDHFVITRSD  1001

Query  211   K  209
             K
Sbjct  1002  K  1002



>gb|KEH40051.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1020

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 168/193 (87%), Gaps = 5/193 (3%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG++S+SRGGA+IYY +VFL
Sbjct  825   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGLESVSRGGAIIYYAAVFL  884

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI++ G+LEVFTL
Sbjct  885   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHISSDGNLEVFTL  944

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLDS WE E   PQ  S++R FPSKWRA    QDP+ TV++VDHF+IE+T+
Sbjct  945   AVDKVPKDWKLDSEWEKETKNPQISSHLRSFPSKWRAAVANQDPVQTVKIVDHFIIERTD  1004

Query  211   KSDSESMNGSKTQ  173
               D     G+ + 
Sbjct  1005  --DKNECGGTDSN  1015



>ref|NP_192917.3| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83050.1| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
Length=1013

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 166/185 (90%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKHGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  888   YFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A++ QQDP+NTV++VD FVI +++
Sbjct  948   AVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSKWGASTSQQDPVNTVKIVDRFVIHRSQ  1007

Query  211   KSDSE  197
             K + E
Sbjct  1008  KENGE  1012



>emb|CAB44318.1| putative protein [Arabidopsis thaliana]
 emb|CAB78223.1| putative protein [Arabidopsis thaliana]
Length=1012

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 166/185 (90%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GAVIYY SVFL
Sbjct  827   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKHGMESLSRSGAVIYYASVFL  886

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  887   YFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  946

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A++ QQDP+NTV++VD FVI +++
Sbjct  947   AVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSKWGASTSQQDPVNTVKIVDRFVIHRSQ  1006

Query  211   KSDSE  197
             K + E
Sbjct  1007  KENGE  1011



>ref|XP_010268877.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
 ref|XP_010268883.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
Length=1012

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSRGGA+IYY SVFL
Sbjct  829   GLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKKGMESLSRGGAIIYYASVFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWL +HFDEAFSSLRIANYK+FTR H+   GDLEVFTL
Sbjct  889   YFWVFSTPVVSLVFGSYLYICINWLQIHFDEAFSSLRIANYKAFTRCHVTHDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEP-QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
             AVDKVPKEWKLD +W+ EP QQ S++RKFPSKW AT++ QDPI+TVR+VDHFVI++T
Sbjct  949   AVDKVPKEWKLDPDWDQEPRQQLSHLRKFPSKWSATAVSQDPISTVRIVDHFVIQKT  1005



>gb|KEH40052.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1067

 Score =   312 bits (799),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 168/193 (87%), Gaps = 5/193 (3%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG++S+SRGGA+IYY +VFL
Sbjct  872   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGLESVSRGGAIIYYAAVFL  931

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI++ G+LEVFTL
Sbjct  932   YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHISSDGNLEVFTL  991

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLDS WE E   PQ  S++R FPSKWRA    QDP+ TV++VDHF+IE+T+
Sbjct  992   AVDKVPKDWKLDSEWEKETKNPQISSHLRSFPSKWRAAVANQDPVQTVKIVDHFIIERTD  1051

Query  211   KSDSESMNGSKTQ  173
               D     G+ + 
Sbjct  1052  --DKNECGGTDSN  1062



>ref|XP_010062120.1| PREDICTED: uncharacterized protein LOC104449600 isoform X3 [Eucalyptus 
grandis]
Length=1044

 Score =   311 bits (798),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  855   GLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGLASLSRGGAAIYYASVFL  914

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN+ GDLEV+TL
Sbjct  915   YFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINSDGDLEVYTL  974

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QDP+NTVR+VDHFVI+Q E
Sbjct  975   AVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQDPVNTVRIVDHFVIKQAE  1034

Query  211   KSDSE  197
             K   E
Sbjct  1035  KPHLE  1039



>gb|KCW69186.1| hypothetical protein EUGRSUZ_F02708 [Eucalyptus grandis]
Length=996

 Score =   310 bits (795),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  807  GLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGLASLSRGGAAIYYASVFL  866

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN+ GDLEV+TL
Sbjct  867  YFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINSDGDLEVYTL  926

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QDP+NTVR+VDHFVI+Q E
Sbjct  927  AVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQDPVNTVRIVDHFVIKQAE  986

Query  211  KSDSE  197
            K   E
Sbjct  987  KPHLE  991



>ref|XP_010455595.1| PREDICTED: uncharacterized protein LOC104737182 [Camelina sativa]
Length=1013

 Score =   311 bits (796),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 165/185 (89%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  888   YFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A + QQDP+NTV++VD F+I ++E
Sbjct  948   AVDKVPKDWKLDKDWDSEPKQSFKMSYERQFPSKWCAPTAQQDPVNTVKIVDRFMIHRSE  1007

Query  211   KSDSE  197
             K + E
Sbjct  1008  KQNGE  1012



>ref|XP_010062121.1| PREDICTED: uncharacterized protein LOC104449600 isoform X4 [Eucalyptus 
grandis]
Length=1011

 Score =   311 bits (796),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  822   GLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGLASLSRGGAAIYYASVFL  881

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN+ GDLEV+TL
Sbjct  882   YFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINSDGDLEVYTL  941

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QDP+NTVR+VDHFVI+Q E
Sbjct  942   AVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQDPVNTVRIVDHFVIKQAE  1001

Query  211   KSDSE  197
             K   E
Sbjct  1002  KPHLE  1006



>gb|KGN62541.1| hypothetical protein Csa_2G360580 [Cucumis sativus]
Length=1025

 Score =   311 bits (796),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E WT+GLYPACIKYLMSAFD+PEVMAV+R NICKNGMDSLSRGGA+IYY SVF 
Sbjct  829   GLRARLEEWTYGLYPACIKYLMSAFDIPEVMAVSRSNICKNGMDSLSRGGAMIYYGSVFF  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS VFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSFVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEP------QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
             AVDKVPKEWKLDS WE E       Q+ S+ R +PSKW+A +  QDP++TV++VD FVI 
Sbjct  949   AVDKVPKEWKLDSKWEGEAREMEGGQKMSHQRSYPSKWKAAAPHQDPVHTVKIVDQFVIR  1008

Query  220   QTEKSDS-ESMNGSKTQ  173
             Q   +D+ E +NGS+  
Sbjct  1009  QARGNDNFEDVNGSEIH  1025



>ref|XP_004152730.1| PREDICTED: uncharacterized protein LOC101204257 [Cucumis sativus]
 ref|XP_004160010.1| PREDICTED: uncharacterized LOC101204257 [Cucumis sativus]
Length=1025

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E WT+GLYPACIKYLMSAFD+PEVMAV+R NICKNGMDSLSRGGA+IYY SVF 
Sbjct  829   GLRARLEEWTYGLYPACIKYLMSAFDIPEVMAVSRSNICKNGMDSLSRGGAMIYYGSVFF  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS VFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSFVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEP------QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
             AVDKVPKEWKLDS WE E       Q+ S+ R +PSKW+A +  QDP++TV++VD FVI 
Sbjct  949   AVDKVPKEWKLDSKWEGEAREMEGGQKMSHQRSYPSKWKAAAPHQDPVHTVKIVDQFVIR  1008

Query  220   QTEKSDS-ESMNGSKTQ  173
             Q   +D+ E +NGS+  
Sbjct  1009  QARGNDNFEDVNGSEIH  1025



>ref|XP_010422134.1| PREDICTED: uncharacterized protein LOC104707474 [Camelina sativa]
Length=1013

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 164/185 (89%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  888   YFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A + QQDP+NTV++VD F I ++E
Sbjct  948   AVDKVPKDWKLDKDWDSEPKQSFKMSYERQFPSKWCAPTAQQDPVNTVKIVDRFTIHRSE  1007

Query  211   KSDSE  197
             K + E
Sbjct  1008  KQNGE  1012



>ref|XP_006396852.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
 gb|ESQ38305.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
Length=1013

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 164/185 (89%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  888   YFWVFSTPVVSMVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKENKDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+W LD +W++EP+Q    SY RKFPSKW A++ QQDP+ TV+VVD+FVI +++
Sbjct  948   AVDKVPKDWNLDKDWDSEPKQSGVMSYKRKFPSKWSASTAQQDPVTTVKVVDYFVIHRSQ  1007

Query  211   KSDSE  197
             K + E
Sbjct  1008  KQNGE  1012



>ref|XP_009137306.1| PREDICTED: uncharacterized protein LOC103861350 [Brassica rapa]
Length=1007

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  822   GLRVRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  881

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI + GDLEVFTL
Sbjct  882   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKSDGDLEVFTL  941

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W++EP+   + S++R+FPSKW AT+ QQDPINTV++VDHFVI +++
Sbjct  942   GVDKVPKEWKLDKDWDSEPRSTVKMSHLRRFPSKWCATTSQQDPINTVKIVDHFVISRSD  1001

Query  211   K  209
             K
Sbjct  1002  K  1002



>emb|CDX98782.1| BnaA03g45670D [Brassica napus]
Length=1007

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  822   GLRVRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  881

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI + GDLEVFTL
Sbjct  882   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKSDGDLEVFTL  941

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W++EP+   + S++R+FPSKW AT+ QQDPINTV++VDHFVI +++
Sbjct  942   GVDKVPKEWKLDKDWDSEPRSTVKMSHLRRFPSKWCATTSQQDPINTVKIVDHFVISRSD  1001

Query  211   K  209
             K
Sbjct  1002  K  1002



>ref|XP_010062116.1| PREDICTED: uncharacterized protein LOC104449600 isoform X1 [Eucalyptus 
grandis]
Length=1109

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  920   GLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGLASLSRGGAAIYYASVFL  979

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN+ GDLEV+TL
Sbjct  980   YFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINSDGDLEVYTL  1039

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W+ EP+QP   S+++KFPSKW + +  QDP+NTVR+VDHFVI+Q E
Sbjct  1040  AVDKVPKEWKLDPDWDGEPKQPQQLSHLKKFPSKWSSAAPLQDPVNTVRIVDHFVIKQAE  1099

Query  211   KSDSE  197
             K   E
Sbjct  1100  KPHLE  1104



>ref|XP_002874725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1027

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 166/185 (90%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GAVIYY SVFL
Sbjct  842   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKHGMESLSRSGAVIYYASVFL  901

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  902   YFWVFSTPVVSMVFGSYLYICINWFHLHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  961

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W++EP+Q    SY R+FPSKW +++ QQDP+NTV++VD FVI +++
Sbjct  962   AVDKVPKDWKLDKDWDSEPKQSFKMSYEREFPSKWCSSTAQQDPVNTVKIVDRFVIHRSQ  1021

Query  211   KSDSE  197
             K + E
Sbjct  1022  KENGE  1026



>ref|XP_010434128.1| PREDICTED: uncharacterized protein LOC104718144 [Camelina sativa]
Length=1013

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGMASLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  888   YFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W++EP+Q    SY R+FPSKW A + QQDP+NTV++VD F I ++E
Sbjct  948   AVDKVPKDWKLDKDWDSEPKQSFKMSYERQFPSKWCAPTAQQDPVNTVKIVDRFTIHRSE  1007

Query  211   KSDSE  197
             K + E
Sbjct  1008  KQNGE  1012



>emb|CDX86745.1| BnaA09g21350D [Brassica napus]
Length=960

 Score =   307 bits (786),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 3/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  775  GLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKEGMESLSRSGAVIYYASVFL  834

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  835  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKKNKDIEVFTL  894

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD +W+ EP+Q    S+ RKFPSKW A+S QQDP+  V+VVDHFVI +++
Sbjct  895  AVDKVPKDWKLDKDWDAEPKQSGVMSHKRKFPSKWCASSAQQDPVAAVKVVDHFVIYRSQ  954

Query  211  KSDSE  197
              + E
Sbjct  955  NQNGE  959



>dbj|BAK04122.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 154/186 (83%), Gaps = 4/186 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+E+WT GLYPACIKYLMSAFDVPE+MAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  136  GLRTRLEQWTLGLYPACIKYLMSAFDVPEIMAVTRINICKNGMMSLSRSVLIMYYTSVFI  195

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  196  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  255

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE E   P Q  + R++PSKWR+ S   DP+ +VRVVDHF I +T 
Sbjct  256  AVDKVPKDWKLDPKWEAEERGPHQLGHHRRYPSKWRSAS-SPDPVRSVRVVDHFTITRTV  314

Query  211  KSDSES  194
              D E+
Sbjct  315  APDPET  320



>ref|XP_008444644.1| PREDICTED: uncharacterized protein LOC103487913 [Cucumis melo]
Length=1025

 Score =   308 bits (788),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 163/197 (83%), Gaps = 7/197 (4%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E WT+GLYPACIKYLMSAFD+PEVMAV+R NICKNGMDSLSRGGA+IYY SVF 
Sbjct  829   GLRARLEEWTYGLYPACIKYLMSAFDIPEVMAVSRSNICKNGMDSLSRGGAMIYYGSVFF  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS VFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889   YFWVFSTPVVSFVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEP------QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
             AVDKVPKEWKLDS WE E       Q+ S+ R FPSKW+A +  QDP++TV++VD FVI 
Sbjct  949   AVDKVPKEWKLDSKWEGEAREMEGDQKMSHQRSFPSKWKAAAPHQDPVHTVKIVDQFVIR  1008

Query  220   QTEKSDS-ESMNGSKTQ  173
             Q   +D     NGS+  
Sbjct  1009  QGRGNDRFGDANGSEIH  1025



>emb|CDY47423.1| BnaA02g21590D [Brassica napus]
Length=960

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  775  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGMESLSRSGAVIYYASVFL  834

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  835  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKENKDIEVFTL  894

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD +W+ EP+Q    S+ R+FPSKW A+S QQDP+ TV+VVD+F+I +++
Sbjct  895  AVDKVPKDWKLDKDWDAEPKQSGVMSHKREFPSKWCASSAQQDPVATVKVVDYFLIHRSQ  954

Query  211  KSDSE  197
              + E
Sbjct  955  NQNGE  959



>ref|XP_006413590.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
 gb|ESQ55043.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
Length=1005

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM++LSR GA IYY SVFL
Sbjct  820  GLRARIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGMETLSRSGAAIYYASVFL  879

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI   GDLEVFTL
Sbjct  880  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKPDGDLEVFTL  939

Query  382  AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             VDKVPKEWKLD +W++EP+   + S+ R+FPSKW AT+LQQDPINTV++VD FVI +++
Sbjct  940  GVDKVPKEWKLDKDWDSEPRPTVKMSHHRRFPSKWCATTLQQDPINTVKIVDRFVIRRSD  999

Query  211  K  209
            K
Sbjct  1000 K  1000



>ref|XP_010540555.1| PREDICTED: uncharacterized protein LOC104814278 isoform X2 [Tarenaya 
hassleriana]
Length=991

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GA IYY SVFL
Sbjct  809  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKHGMESLSRTGAAIYYASVFL  868

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  869  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHIRRDGDIEVFTL  928

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVPK+WKLD +W++EP+Q    S+ R++PSKW AT+ QQDP+NTV++VD FVI ++ 
Sbjct  929  AIDKVPKDWKLDRDWDSEPKQAGKMSHERRYPSKWCATTAQQDPVNTVKIVDRFVIRKSG  988

Query  211  K  209
            +
Sbjct  989  R  989



>ref|XP_009128650.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
 ref|XP_009128652.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
Length=1013

 Score =   306 bits (785),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKENKDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W+ EP+Q    S+ R+FPSKW A+S QQDP+ TV+VVD+F+I +++
Sbjct  948   AVDKVPKDWKLDKDWDAEPKQSGVMSHKREFPSKWCASSAQQDPVATVKVVDYFLIHRSQ  1007

Query  211   KSDSE  197
               + E
Sbjct  1008  NQNGE  1012



>emb|CDY52938.1| BnaCnng23820D [Brassica napus]
Length=1013

 Score =   306 bits (784),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 163/185 (88%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKEGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  888   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKENKDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W+ EP+Q    S+ R+FPSKW A+S QQDP+ TV+VVD+F+I +++
Sbjct  948   AVDKVPKDWKLDKHWDAEPKQSGVMSHKREFPSKWCASSAQQDPVATVKVVDYFLIHRSQ  1007

Query  211   KSDSE  197
               + E
Sbjct  1008  NQNGE  1012



>ref|XP_010540547.1| PREDICTED: uncharacterized protein LOC104814278 isoform X1 [Tarenaya 
hassleriana]
Length=1012

 Score =   306 bits (784),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GA IYY SVFL
Sbjct  830   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKHGMESLSRTGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHIRRDGDIEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             A+DKVPK+WKLD +W++EP+Q    S+ R++PSKW AT+ QQDP+NTV++VD FVI ++ 
Sbjct  950   AIDKVPKDWKLDRDWDSEPKQAGKMSHERRYPSKWCATTAQQDPVNTVKIVDRFVIRKSG  1009

Query  211   K  209
             +
Sbjct  1010  R  1010



>ref|XP_009102715.1| PREDICTED: uncharacterized protein LOC103828821 [Brassica rapa]
Length=1014

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  829   GLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKEGMESLSRSGAVIYYASVFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  889   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKKNKDIEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+W LD +W+ EP+Q    S+ RKFPSKW A+S QQDP+  V+VVDHFVI +++
Sbjct  949   AVDKVPKDWTLDKDWDAEPKQSGVMSHKRKFPSKWCASSAQQDPVAAVKVVDHFVIYRSQ  1008

Query  211   KSDSE  197
               + E
Sbjct  1009  NQNGE  1013



>ref|XP_006286984.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
 gb|EOA19882.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
Length=1013

 Score =   305 bits (782),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 3/184 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GAVIYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRTNICKDGMESLSRSGAVIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  888   YFWVFSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHILEDGDIEVFTL  947

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  W++EP+Q    SY RK+PSKW A + QQDP+NTV++VD F I ++ 
Sbjct  948   AVDKVPKDWKLDKEWDSEPKQSFKMSYERKYPSKWCAPTAQQDPVNTVKIVDRFTIHRSA  1007

Query  211   KSDS  200
             K + 
Sbjct  1008  KENG  1011



>ref|XP_010684140.1| PREDICTED: uncharacterized protein LOC104898734 [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   305 bits (781),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLM AFDVPEVMAVTR NICKNG+ SLSRG A IYY SVFL
Sbjct  824   GLRARIEQWTFGLYPACIKYLMFAFDVPEVMAVTRSNICKNGIQSLSRGYAAIYYASVFL  883

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             Y+WVFSTPVVSL+FGSYLY+CINW H+HFDEAFSSLRIANYKSFTRFHI   GDLEVFTL
Sbjct  884   YYWVFSTPVVSLIFGSYLYVCINWFHIHFDEAFSSLRIANYKSFTRFHIKCNGDLEVFTL  943

Query  382   AVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  W+ EP   QQ S+ RK PSKW ATS  QDP++TVR++D FVI++TE
Sbjct  944   AVDKVPKKWKLDPKWDGEPKQSQQSSHCRKHPSKWTATSKHQDPLSTVRIIDQFVIQKTE  1003

Query  211   KSD  203
              +D
Sbjct  1004  STD  1006



>ref|XP_010433955.1| PREDICTED: uncharacterized protein LOC104718003 isoform X2 [Camelina 
sativa]
Length=902

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  720  GLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  779

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTR HI   GDLEVFTL
Sbjct  780  YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRLHIKPDGDLEVFTL  839

Query  382  AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             VDKVPKEWKLD +W+ EP+     S+ R+FPSKW AT+LQQDP+NTV++VDHFVI ++E
Sbjct  840  GVDKVPKEWKLDKDWDAEPRPTVNMSHHRRFPSKWCATTLQQDPVNTVKIVDHFVISRSE  899

Query  211  K  209
            K
Sbjct  900  K  900



>ref|NP_194031.5| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
 gb|AEE84691.1| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
Length=1015

 Score =   304 bits (779),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 161/186 (87%), Gaps = 3/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  830   GLRDRIEQWTFGLYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTRFHI   GDLEVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRFHIKPDGDLEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W+ EP+   + S+ R+FPSKW AT+LQQDP+NTV++VD FVI ++E
Sbjct  950   GVDKVPKEWKLDKDWDAEPRSTVKMSHHRRFPSKWCATTLQQDPVNTVKIVDKFVIHRSE  1009

Query  211   KSDSES  194
             K    S
Sbjct  1010  KETGGS  1015



>dbj|BAC81182.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31942.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31123.1| unknown protein [Oryza sativa Japonica Group]
Length=443

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 156/186 (84%), Gaps = 4/186 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  257  GLRARLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLMMYYTSVFI  316

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   G+LE+FTL
Sbjct  317  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGNLEIFTL  376

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE E   P Q S+ RK PSKWR++S   DP+ +VRVVDHF I +T 
Sbjct  377  AVDKVPKDWKLDPKWEAEERRPHQLSHHRKHPSKWRSSS-SPDPVTSVRVVDHFTISRTR  435

Query  211  KSDSES  194
             SD  +
Sbjct  436  TSDPNT  441



>dbj|BAJ98692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 3/179 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY SVFL
Sbjct  313  GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVSVFL  372

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVS+VFGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  373  YFWVLSTPVVSMVFGSYLYVCINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  432

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            AVDKVPKEW LD +W+ EP++P   S+ R+FPSKWRA S   DP + VRVVD FVI +T
Sbjct  433  AVDKVPKEWMLDPDWDMEPKEPLQMSHTRRFPSKWRAGSGWSDPTSVVRVVDQFVIPRT  491



>emb|CDY13280.1| BnaC09g23760D [Brassica napus]
Length=1014

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 160/184 (87%), Gaps = 3/184 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFL
Sbjct  829   GLRVRIEQWTFGLYPACIKYLMSAFDVPEVMAVTRNNICKEGMESLSRSGAVIYYASVFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTL
Sbjct  889   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIKKNKDIEVFTL  948

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD +W+ EP+Q    S+ RKFPSKW A+S QQDP+ TV+VVD FVI +++
Sbjct  949   AVDKVPKDWKLDKDWDAEPKQSGVMSHKRKFPSKWCASSAQQDPVATVKVVDRFVIYRSQ  1008

Query  211   KSDS  200
               + 
Sbjct  1009  NQNG  1012



>ref|XP_009392959.1| PREDICTED: uncharacterized protein LOC103978755 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC +GM+SLSRG A+IYY SVFL
Sbjct  810  GLRARMEKWTFGLYPACIKYLMSAFDIPEVMAVTRGNICNSGMESLSRGSAIIYYASVFL  869

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  870  YFWVFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHITVDGDLEVFTL  929

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK WKLD  W+ E   PQQ S+ R+FPSKW+A S   +PIN+VRVVDHFVIE+T+
Sbjct  930  AVDKVPKSWKLDPEWDAEVRLPQQLSHHRRFPSKWKAAS-GPEPINSVRVVDHFVIERTK  988

Query  211  KSDS  200
             + S
Sbjct  989  PNQS  992



>ref|XP_002869795.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46054.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
Length=1015

 Score =   303 bits (776),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 159/181 (88%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WT G YPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  830   GLRDRIEQWTLGFYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTRFHI   GDLEVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRFHIKPDGDLEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W+ EP+   + S+ R+FPSKW AT+LQQDP+NTV++VDHFVI ++E
Sbjct  950   GVDKVPKEWKLDKDWDAEPRSIVKMSHHRRFPSKWCATTLQQDPVNTVKIVDHFVIRKSE  1009

Query  211   K  209
             K
Sbjct  1010  K  1010



>ref|XP_010433954.1| PREDICTED: uncharacterized protein LOC104718003 isoform X1 [Camelina 
sativa]
Length=1013

 Score =   303 bits (775),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GM+SLSR GA IYY SVFL
Sbjct  831   GLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICREGMESLSRSGAAIYYASVFL  890

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTR HI   GDLEVFTL
Sbjct  891   YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRLHIKPDGDLEVFTL  950

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W+ EP+     S+ R+FPSKW AT+LQQDP+NTV++VDHFVI ++E
Sbjct  951   GVDKVPKEWKLDKDWDAEPRPTVNMSHHRRFPSKWCATTLQQDPVNTVKIVDHFVISRSE  1010

Query  211   K  209
             K
Sbjct  1011  K  1011



>ref|NP_001058842.1| Os07g0134500 [Oryza sativa Japonica Group]
 dbj|BAC83511.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20756.1| Os07g0134500 [Oryza sativa Japonica Group]
Length=527

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 154/190 (81%), Gaps = 4/190 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+E+WT GLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY  VFL
Sbjct  339  GLRTRLEQWTLGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVCVFL  398

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFT 
Sbjct  399  YFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTF  458

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+W LD +W+ EP++P   SY RKFPSKWRA S   DP N VR+VDHFVI +T 
Sbjct  459  AVDKVPKDWMLDPDWDMEPKEPFQMSYTRKFPSKWRAAS-GSDPTNAVRIVDHFVIPRTP  517

Query  211  KSDSESMNGS  182
                 S + S
Sbjct  518  PDSPTSGSAS  527



>ref|XP_010529533.1| PREDICTED: uncharacterized protein LOC104806367 [Tarenaya hassleriana]
Length=1014

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 161/180 (89%), Gaps = 3/180 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+ LSR GA IYY SVFL
Sbjct  830   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKHGMEKLSRTGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLY+CINWLH+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYVCINWLHIHFDEAFSSLRIANYKSFTRFHIRRDGDIEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLD +W++EP+Q    S+ R +PSKW A+++QQDP+N+V++VD FVI ++ 
Sbjct  950   AVDKVPKEWKLDRDWDSEPKQAGKMSHERIYPSKWSASTVQQDPVNSVKIVDRFVIRKSN  1009



>ref|XP_009392951.1| PREDICTED: uncharacterized protein LOC103978755 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1031

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC +GM+SLSRG A+IYY SVFL
Sbjct  844   GLRARMEKWTFGLYPACIKYLMSAFDIPEVMAVTRGNICNSGMESLSRGSAIIYYASVFL  903

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  904   YFWVFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHITVDGDLEVFTL  963

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK WKLD  W+ E   PQQ S+ R+FPSKW+A S   +PIN+VRVVDHFVIE+T+
Sbjct  964   AVDKVPKSWKLDPEWDAEVRLPQQLSHHRRFPSKWKAAS-GPEPINSVRVVDHFVIERTK  1022

Query  211   KSDS  200
              + S
Sbjct  1023  PNQS  1026



>ref|XP_010448789.1| PREDICTED: uncharacterized protein LOC104731191 isoform X2 [Camelina 
sativa]
Length=901

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC++GM+SLSR GA IYY SVFL
Sbjct  719  GLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICRDGMESLSRSGAAIYYASVFL  778

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTR HI   GDLEVFTL
Sbjct  779  YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRLHIKPDGDLEVFTL  838

Query  382  AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             VDKVPKEWKLD +W+ EP+   + S+ R FPSKW AT+LQQDP+NTV++VD FVI ++E
Sbjct  839  GVDKVPKEWKLDKDWDAEPKPTVKMSHHRMFPSKWCATTLQQDPVNTVKIVDRFVISRSE  898

Query  211  K  209
            K
Sbjct  899  K  899



>ref|XP_008799898.1| PREDICTED: uncharacterized protein LOC103714434 isoform X2 [Phoenix 
dactylifera]
Length=984

 Score =   300 bits (767),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+ERWTFGLYPACIKYLMSAFDVPEVMAV R NICK GM+SLSRGGA+IYY SVFL
Sbjct  797  GLRVRMERWTFGLYPACIKYLMSAFDVPEVMAVARSNICKKGMESLSRGGAIIYYASVFL  856

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSL+FGSYLYI INW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  857  YFWVFSTPVVSLIFGSYLYISINWFHIHFDEAFSSLRIANYKAFTRFHITVNGDLEVFTL  916

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVPK+WKLD  W+ EP+QP   S+ R+FPSKW+A S   DP+++VR+VDHFVI+++ 
Sbjct  917  AIDKVPKKWKLDPEWDAEPKQPQQLSHRRRFPSKWKAAS-GPDPVHSVRIVDHFVIQRSH  975

Query  211  KSDSESMNG  185
               +  ++G
Sbjct  976  TDLTLEVSG  984



>ref|XP_010448786.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
 ref|XP_010448787.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
Length=1012

 Score =   300 bits (767),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC++GM+SLSR GA IYY SVFL
Sbjct  830   GLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICRDGMESLSRSGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTR HI   GDLEVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRLHIKPDGDLEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W+ EP+   + S+ R FPSKW AT+LQQDP+NTV++VD FVI ++E
Sbjct  950   GVDKVPKEWKLDKDWDAEPKPTVKMSHHRMFPSKWCATTLQQDPVNTVKIVDRFVISRSE  1009

Query  211   K  209
             K
Sbjct  1010  K  1010



>ref|XP_008799897.1| PREDICTED: uncharacterized protein LOC103714434 isoform X1 [Phoenix 
dactylifera]
Length=1018

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR R+ERWTFGLYPACIKYLMSAFDVPEVMAV R NICK GM+SLSRGGA+IYY SVFL
Sbjct  831   GLRVRMERWTFGLYPACIKYLMSAFDVPEVMAVARSNICKKGMESLSRGGAIIYYASVFL  890

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSL+FGSYLYI INW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  891   YFWVFSTPVVSLIFGSYLYISINWFHIHFDEAFSSLRIANYKAFTRFHITVNGDLEVFTL  950

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             A+DKVPK+WKLD  W+ EP+QP   S+ R+FPSKW+A S   DP+++VR+VDHFVI+++ 
Sbjct  951   AIDKVPKKWKLDPEWDAEPKQPQQLSHRRRFPSKWKAAS-GPDPVHSVRIVDHFVIQRSH  1009

Query  211   KSDSESMNG  185
                +  ++G
Sbjct  1010  TDLTLEVSG  1018



>ref|XP_010932753.1| PREDICTED: uncharacterized protein LOC105053349 isoform X2 [Elaeis 
guineensis]
Length=904

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 161/185 (87%), Gaps = 4/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM+SL R  A+IYY SVFL
Sbjct  720  GLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSKICKKGMESLPRSSAIIYYASVFL  779

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSL+FGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI T GDLEVFTL
Sbjct  780  YFWVFSTPVVSLIFGSYLYLCINWFHIHFDEAFSSLRIANYKAFTRFHITTTGDLEVFTL  839

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVPKEWKLD  W+ EP+ P   S++R+FPSKWRA S   DP+N++R+VDHF+I++++
Sbjct  840  ALDKVPKEWKLDPEWDAEPKPPLQLSHLREFPSKWRAAS-GPDPVNSIRIVDHFIIQKSQ  898

Query  211  KSDSE  197
              ++ 
Sbjct  899  DPNNR  903



>gb|KFK28866.1| hypothetical protein AALP_AA7G058700 [Arabis alpina]
Length=1015

 Score =   299 bits (765),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 3/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR R+E+ TFGLYPACIKYLMSAFD+PEVMAVTR NIC+ GM+S SR GA IYY SVFL
Sbjct  830   GLRVRMEQLTFGLYPACIKYLMSAFDIPEVMAVTRTNICREGMESFSRSGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTP+VSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTR HI   GDLEVFTL
Sbjct  890   YFWVFSTPIVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRLHIKPDGDLEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEP---QQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W++EP   ++ S+ R+FPSKW AT+L QDPINTV++VD FVI ++E
Sbjct  950   GVDKVPKEWKLDKDWDSEPKPTEKMSHHRRFPSKWCATALHQDPINTVKIVDRFVIHRSE  1009

Query  211   KSDSES  194
             K    S
Sbjct  1010  KETGGS  1015



>tpg|DAA39654.1| TPA: hypothetical protein ZEAMMB73_888857 [Zea mays]
Length=756

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E WTFGLYPACIKYLMSAFD+PEVMAVTR  ICK G++SL RGGA+IYY  VFL
Sbjct  547  GLRARLEHWTFGLYPACIKYLMSAFDIPEVMAVTRSTICKKGIESLPRGGAIIYYVCVFL  606

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+FTR HI   GDLEVFTL
Sbjct  607  YFWVLSTPVVSLVFGSYLYLCINWFHIHFDEAFSSLRIANYKAFTRLHIKKNGDLEVFTL  666

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+W LD +W+ EP+QP   SY RKFPSKWRA S   DPIN VR+VD FVI +T 
Sbjct  667  AVDKVPKDWMLDPDWDMEPKQPFQMSYTRKFPSKWRAAS-GLDPINAVRIVDRFVIPRTP  725

Query  211  KSDS  200
             S +
Sbjct  726  SSPT  729



>dbj|BAJ98325.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 154/186 (83%), Gaps = 4/186 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+E+WT GLYPACIKYLMSAFDVPE+MAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  348  GLRTRLEQWTLGLYPACIKYLMSAFDVPEIMAVTRINICKNGMMSLSRSVLIMYYTSVFI  407

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  408  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  467

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE E   P Q  + R++PSKWR+ S   DP+ +VRVVDHF I +T 
Sbjct  468  AVDKVPKDWKLDPKWEAEERGPHQLGHHRRYPSKWRSAS-SPDPVRSVRVVDHFTITRTV  526

Query  211  KSDSES  194
              D E+
Sbjct  527  APDPET  532



>ref|XP_006285736.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
 gb|EOA18634.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
Length=1015

 Score =   298 bits (764),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 158/186 (85%), Gaps = 3/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR RIE+WTFG YPACIKYLMSAFD+PEVMAVTR NIC+ GMDSLSR GA IYY SVFL
Sbjct  830   GLRDRIEQWTFGFYPACIKYLMSAFDIPEVMAVTRTNICQKGMDSLSRSGAAIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYI INWLH+HFDEAFSSLRIANYKSFTR HI   GDLEVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYISINWLHIHFDEAFSSLRIANYKSFTRLHIKPDGDLEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
              VDKVPKEWKLD +W+ E +   + S+ R +PSKW AT LQQDP+NTV+VVDHFVI ++E
Sbjct  950   GVDKVPKEWKLDKDWDAESRPTVKMSHHRMYPSKWCATILQQDPVNTVKVVDHFVIHRSE  1009

Query  211   KSDSES  194
             K  + S
Sbjct  1010  KEIAGS  1015



>ref|XP_009393277.1| PREDICTED: uncharacterized protein LOC103979011 [Musa acuminata 
subsp. malaccensis]
Length=1017

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R  IC+ G+++L RGGA+IYY SVFL
Sbjct  831   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRSTICRKGIETLPRGGAIIYYASVFL  890

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  891   YFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHITPTGDLEVFTL  950

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLDS W+TEP++P   S++R FPSKW A +   DP+N+VR++DHFVI++T 
Sbjct  951   AVDKVPKDWKLDSKWDTEPKEPLQLSHLRMFPSKWTAAT-GTDPVNSVRIIDHFVIQRTP  1009

Query  211   KSDSESMNG  185
                +++ NG
Sbjct  1010  NPTADA-NG  1017



>ref|XP_010932752.1| PREDICTED: uncharacterized protein LOC105053349 isoform X1 [Elaeis 
guineensis]
Length=1015

 Score =   297 bits (761),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 161/185 (87%), Gaps = 4/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR  ICK GM+SL R  A+IYY SVFL
Sbjct  831   GLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSKICKKGMESLPRSSAIIYYASVFL  890

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSL+FGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI T GDLEVFTL
Sbjct  891   YFWVFSTPVVSLIFGSYLYLCINWFHIHFDEAFSSLRIANYKAFTRFHITTTGDLEVFTL  950

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             A+DKVPKEWKLD  W+ EP+ P   S++R+FPSKWRA S   DP+N++R+VDHF+I++++
Sbjct  951   ALDKVPKEWKLDPEWDAEPKPPLQLSHLREFPSKWRAAS-GPDPVNSIRIVDHFIIQKSQ  1009

Query  211   KSDSE  197
               ++ 
Sbjct  1010  DPNNR  1014



>gb|EMT04291.1| hypothetical protein F775_31134 [Aegilops tauschii]
Length=789

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 3/179 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY SVFL
Sbjct  600  GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVSVFL  659

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVS+VFGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  660  YFWVLSTPVVSMVFGSYLYVCINWFHIHFDEAFSSLRIANYKAFTRFHIKKSGDLEVFTL  719

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            AVDKVPKEW LD +W+ EP++P   S+ R+FPSKWRA S   DP + VRVVD FVI +T
Sbjct  720  AVDKVPKEWMLDPDWDMEPKEPLQMSHTRRFPSKWRAASGWSDPTSVVRVVDQFVIPRT  778



>ref|XP_004987255.1| PREDICTED: uncharacterized protein LOC101783935 isoform X7 [Setaria 
italica]
Length=698

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  512  GLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  571

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  572  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  631

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE++   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  632  AVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRSAS-SPDPVRSVRVVDHFTIERTR  690

Query  211  KSDSE  197
              D E
Sbjct  691  TPDME  695



>ref|XP_008811244.1| PREDICTED: uncharacterized protein LOC103722455 isoform X2 [Phoenix 
dactylifera]
Length=896

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK GM+SL R  A+IYY SVFL
Sbjct  712  GLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVSRSKICKKGMESLPRSSAIIYYASVFL  771

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSL+FGSYLY+CINWLH+HFDEAFSSLRIANYK+FTRFHI + GDLEVFTL
Sbjct  772  YFWVFSTPVVSLIFGSYLYLCINWLHIHFDEAFSSLRIANYKAFTRFHITSTGDLEVFTL  831

Query  382  AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            A+DKVPKEWKLD  W+ EP+   Q S++RKFPSKWR  S   DP+N++R+VDHF+I++++
Sbjct  832  ALDKVPKEWKLDPEWDAEPKPQPQLSHLRKFPSKWRTAS-GPDPVNSMRIVDHFIIQKSQ  890

Query  211  KSD  203
             ++
Sbjct  891  DAN  893



>gb|EEE66522.1| hypothetical protein OsJ_22999 [Oryza sativa Japonica Group]
Length=821

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 154/190 (81%), Gaps = 4/190 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+E+WT GLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY  VFL
Sbjct  633  GLRTRLEQWTLGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVCVFL  692

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFT 
Sbjct  693  YFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTF  752

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+W LD +W+ EP++P   SY RKFPSKWRA S   DP N VR+VDHFVI +T 
Sbjct  753  AVDKVPKDWMLDPDWDMEPKEPFQMSYTRKFPSKWRAAS-GSDPTNAVRIVDHFVIPRTP  811

Query  211  KSDSESMNGS  182
                 S + S
Sbjct  812  PDSPTSGSAS  821



>ref|XP_006657430.1| PREDICTED: uncharacterized protein LOC102702861 [Oryza brachyantha]
Length=1021

 Score =   296 bits (757),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 153/179 (85%), Gaps = 4/179 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR R+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY  VFL
Sbjct  832   GLRTRLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVCVFL  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  892   YFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  951

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
             AVDKVPKEW LD +W+ EP++P   SY RKFPSKWRA S   DP N VRVVDHFVI +T
Sbjct  952   AVDKVPKEWMLDPDWDMEPKEPFQMSYSRKFPSKWRAAS-GSDPTNAVRVVDHFVISRT  1009



>ref|XP_008651926.1| PREDICTED: uncharacterized protein LOC103631870 isoform X5 [Zea 
mays]
 ref|XP_008651927.1| PREDICTED: uncharacterized protein LOC103631870 isoform X5 [Zea 
mays]
Length=762

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  576  GLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  635

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFH+   GDLE+FTL
Sbjct  636  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHVKKDGDLEIFTL  695

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE+E   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  696  AVDKVPKDWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-STDPVRSVRVVDHFTIERTR  754

Query  211  KSDSE  197
              D E
Sbjct  755  TPDME  759



>ref|XP_010538790.1| PREDICTED: uncharacterized protein LOC104813013 [Tarenaya hassleriana]
Length=1007

 Score =   295 bits (756),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK+GM+SLSR GA IYY SVFL
Sbjct  830   GLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKDGMESLSRTGAGIYYASVFL  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI   GD+EVFTL
Sbjct  890   YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIRRDGDIEVFTL  949

Query  382   AVDKVPKEWKLDSNWETEPQQ-PSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPKEWKLDS+W++EP+Q  S+ R  PSKW A++   DP+++V++VD F+I ++ 
Sbjct  950   AVDKVPKEWKLDSDWDSEPRQMMSHHRTHPSKWSASASHHDPLHSVKIVDRFLISKSN  1007



>ref|XP_004987258.1| PREDICTED: uncharacterized protein LOC101786352 isoform X2 [Setaria 
italica]
Length=762

 Score =   290 bits (743),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  576  GLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  635

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  636  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  695

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE++   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  696  AVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRSAS-SPDPVRSVRVVDHFTIERTR  754

Query  211  KSDSE  197
              D E
Sbjct  755  TPDME  759



>gb|EPS68439.1| hypothetical protein M569_06328, partial [Genlisea aurea]
Length=1008

 Score =   295 bits (754),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 157/183 (86%), Gaps = 8/183 (4%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R +IC+NGM+SLSRG A+IYY SVFL
Sbjct  828   GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNSICRNGMESLSRGVAIIYYASVFL  887

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSL+FGSYLY CINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEV+TL
Sbjct  888   YFWVFSTPVVSLIFGSYLYFCINWLHIHFDEAFSSLRIANYKSFTRFHINPTGDLEVYTL  947

Query  382   AVDKVPKEWKLDSNWETE-----PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQ  218
             A   VPKEWKLD  WE E     P   S++RKFPSKWRA S Q DP+ T++++D FVIE+
Sbjct  948   A---VPKEWKLDQKWEGESKTSPPNLSSHLRKFPSKWRAVSSQHDPLTTLKIIDQFVIER  1004

Query  217   TEK  209
             T K
Sbjct  1005  TVK  1007



>ref|XP_008811243.1| PREDICTED: uncharacterized protein LOC103722455 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score =   295 bits (754),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAV+R  ICK GM+SL R  A+IYY SVFL
Sbjct  831   GLRARLEQWTFGLYPACIKYLMSAFDVPEVMAVSRSKICKKGMESLPRSSAIIYYASVFL  890

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSL+FGSYLY+CINWLH+HFDEAFSSLRIANYK+FTRFHI + GDLEVFTL
Sbjct  891   YFWVFSTPVVSLIFGSYLYLCINWLHIHFDEAFSSLRIANYKAFTRFHITSTGDLEVFTL  950

Query  382   AVDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             A+DKVPKEWKLD  W+ EP+   Q S++RKFPSKWR  S   DP+N++R+VDHF+I++++
Sbjct  951   ALDKVPKEWKLDPEWDAEPKPQPQLSHLRKFPSKWRTAS-GPDPVNSMRIVDHFIIQKSQ  1009

Query  211   KSD  203
              ++
Sbjct  1010  DAN  1012



>ref|XP_002461307.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
 gb|EER97828.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
Length=1018

 Score =   295 bits (754),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 157/185 (85%), Gaps = 4/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  832   GLRARLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  892   YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  951

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK WKLD  WE+E   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  952   AVDKVPKGWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-SPDPVRSVRVVDHFTIERTR  1010

Query  211   KSDSE  197
              SD+E
Sbjct  1011  TSDTE  1015



>gb|EEC81473.1| hypothetical protein OsI_24798 [Oryza sativa Indica Group]
Length=935

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 154/190 (81%), Gaps = 4/190 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+E+WT GLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY  VFL
Sbjct  747  GLRTRLEQWTLGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVCVFL  806

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFT 
Sbjct  807  YFWVLSTPVVSLVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTF  866

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+W LD +W+ EP++P   SY RKFPSKWRA S   DP N VR+VDHFVI +T 
Sbjct  867  AVDKVPKDWMLDPDWDMEPKEPFQMSYTRKFPSKWRAAS-GSDPTNAVRIVDHFVIPRTP  925

Query  211  KSDSESMNGS  182
                 S + S
Sbjct  926  PDSPTSGSAS  935



>gb|EMS63037.1| hypothetical protein TRIUR3_32981 [Triticum urartu]
Length=913

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 3/179 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY SVFL
Sbjct  724  GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVSVFL  783

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVS+VFGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  784  YFWVLSTPVVSMVFGSYLYVCINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  843

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            AVDKVPKEW LD +W+ EP++P   S+ R+FPSKWRA S   DP + VRVVD FVI +T
Sbjct  844  AVDKVPKEWMLDPDWDMEPKEPLQMSHTRRFPSKWRAASGWSDPTSVVRVVDQFVIPRT  902



>ref|XP_008670049.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 ref|XP_008670050.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 tpg|DAA39653.1| TPA: hypothetical protein ZEAMMB73_888857 [Zea mays]
Length=1041

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E WTFGLYPACIKYLMSAFD+PEVMAVTR  ICK G++SL RGGA+IYY  VFL
Sbjct  832   GLRARLEHWTFGLYPACIKYLMSAFDIPEVMAVTRSTICKKGIESLPRGGAIIYYVCVFL  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+FTR HI   GDLEVFTL
Sbjct  892   YFWVLSTPVVSLVFGSYLYLCINWFHIHFDEAFSSLRIANYKAFTRLHIKKNGDLEVFTL  951

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+W LD +W+ EP+QP   SY RKFPSKWRA S   DPIN VR+VD FVI +T 
Sbjct  952   AVDKVPKDWMLDPDWDMEPKQPFQMSYTRKFPSKWRAAS-GLDPINAVRIVDRFVIPRTP  1010

Query  211   KSDS  200
              S +
Sbjct  1011  SSPT  1014



>ref|XP_008651925.1| PREDICTED: uncharacterized protein LOC103631870 isoform X4 [Zea 
mays]
Length=907

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  721  GLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  780

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFH+   GDLE+FTL
Sbjct  781  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHVKKDGDLEIFTL  840

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVDKVPK+WKLD  WE+E   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  841  AVDKVPKDWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-STDPVRSVRVVDHFTIERTR  899

Query  211  KSDSE  197
              D E
Sbjct  900  TPDME  904



>ref|XP_010238514.1| PREDICTED: uncharacterized protein LOC100842069 isoform X3 [Brachypodium 
distachyon]
Length=762

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 153/179 (85%), Gaps = 3/179 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY SVFL
Sbjct  573  GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRNTICRKGIESLPRGGAIIYYVSVFL  632

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  633  YFWVLSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  692

Query  382  AVDKVPKEWKLDSNWE---TEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            AVDKVPK+W LD +W+   T+P Q S+ R+FPSKWRA S   DP + VRVVD FVI +T
Sbjct  693  AVDKVPKDWMLDPDWDMETTDPLQMSHSRRFPSKWRAASGWSDPTSVVRVVDQFVIPRT  751



>ref|XP_002461963.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
 gb|EER98484.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
Length=936

 Score =   290 bits (743),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR R+E WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY  VFL
Sbjct  741  GLRTRLEHWTFGLYPACIKYLMSAFDIPEVMAVTRSTICRKGIESLPRGGAIIYYVCVFL  800

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  801  YFWVLSTPVVSLVFGSYLYLCINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  860

Query  382  AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVI  224
            AVDKVPK+W LD +W+ EP+QP   SY RKFPSKWRA S   DPIN VR+VD FVI
Sbjct  861  AVDKVPKDWMLDPDWDMEPKQPFQMSYTRKFPSKWRAAS-GLDPINAVRIVDRFVI  915



>ref|XP_003557697.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
 ref|XP_010228472.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
Length=1016

 Score =   291 bits (746),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 156/186 (84%), Gaps = 4/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WT GLYPACIKYLMSAFDVPE+MAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  830   GLRARLEQWTLGLYPACIKYLMSAFDVPEIMAVTRINICKNGMMSLSRSVLIMYYTSVFI  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  890   YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  949

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  WE E   P Q S+ R++PSKWR+ S   DP+ +VRVVDHF I +T 
Sbjct  950   AVDKVPKDWKLDPKWEAEERGPHQLSHDRRYPSKWRSAS-SPDPVRSVRVVDHFTITRTR  1008

Query  211   KSDSES  194
               D E+
Sbjct  1009  APDPET  1014



>ref|XP_008651921.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 ref|XP_008651922.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 tpg|DAA59346.1| TPA: hypothetical protein ZEAMMB73_449975 [Zea mays]
Length=1018

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  832   GLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFH+   GDLE+FTL
Sbjct  892   YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHVKKDGDLEIFTL  951

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  WE+E   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  952   AVDKVPKDWKLDPRWESEGRGPHQLSHDRKHPSKWRSAS-STDPVRSVRVVDHFTIERTR  1010

Query  211   KSDSE  197
               D E
Sbjct  1011  TPDME  1015



>ref|XP_006856661.1| hypothetical protein AMTR_s00054p00046250 [Amborella trichopoda]
 gb|ERN18128.1| hypothetical protein AMTR_s00054p00046250 [Amborella trichopoda]
Length=1067

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 3/178 (2%)
 Frame = -2

Query  739   LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLY  560
             LRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICK G++SLSRG A+IYY SVFLY
Sbjct  881   LRARLEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKRGLESLSRGHAIIYYASVFLY  940

Query  559   FWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLA  380
             FWVFSTPVVSLVFG YLY+CINWLHVHFDEAFSSLRIANYKSFTRFHI+ KGDLEV+TLA
Sbjct  941   FWVFSTPVVSLVFGCYLYLCINWLHVHFDEAFSSLRIANYKSFTRFHISPKGDLEVYTLA  1000

Query  379   VDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
             VDKVPK+WKLD +W+ E +Q    S++R++PSKW A     DP++TVR+VD FVI +T
Sbjct  1001  VDKVPKDWKLDPDWDGELKQQQKFSHLRRYPSKWSAAVSNHDPLSTVRIVDQFVIHRT  1058



>ref|XP_004987257.1| PREDICTED: uncharacterized protein LOC101786352 isoform X1 [Setaria 
italica]
Length=1018

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 4/185 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  832   GLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  892   YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  951

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  WE++   P Q S+ RK PSKWR+ S   DP+ +VRVVDHF IE+T 
Sbjct  952   AVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRSAS-SPDPVRSVRVVDHFTIERTR  1010

Query  211   KSDSE  197
               D E
Sbjct  1011  TPDME  1015



>ref|NP_001058702.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAC81181.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31941.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20616.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAG93283.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81383.1| hypothetical protein OsI_24595 [Oryza sativa Indica Group]
 gb|EEE66435.1| hypothetical protein OsJ_22800 [Oryza sativa Japonica Group]
Length=1016

 Score =   290 bits (741),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 156/186 (84%), Gaps = 4/186 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  830   GLRARLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLMMYYTSVFI  889

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   G+LE+FTL
Sbjct  890   YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGNLEIFTL  949

Query  382   AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVDKVPK+WKLD  WE E   P Q S+ RK PSKWR++S   DP+ +VRVVDHF I +T 
Sbjct  950   AVDKVPKDWKLDPKWEAEERRPHQLSHHRKHPSKWRSSS-SPDPVTSVRVVDHFTISRTR  1008

Query  211   KSDSES  194
              SD  +
Sbjct  1009  TSDPNT  1014



>ref|XP_010238513.1| PREDICTED: uncharacterized protein LOC100842069 isoform X2 [Brachypodium 
distachyon]
Length=1003

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 153/179 (85%), Gaps = 3/179 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY SVFL
Sbjct  814  GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRNTICRKGIESLPRGGAIIYYVSVFL  873

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  874  YFWVLSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  933

Query  382  AVDKVPKEWKLDSNWE---TEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            AVDKVPK+W LD +W+   T+P Q S+ R+FPSKWRA S   DP + VRVVD FVI +T
Sbjct  934  AVDKVPKDWMLDPDWDMETTDPLQMSHSRRFPSKWRAASGWSDPTSVVRVVDQFVIPRT  992



>ref|XP_010238512.1| PREDICTED: uncharacterized protein LOC100842069 isoform X1 [Brachypodium 
distachyon]
Length=1003

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 153/179 (85%), Gaps = 3/179 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  IC+ G++SL RGGA+IYY SVFL
Sbjct  814  GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRNTICRKGIESLPRGGAIIYYVSVFL  873

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWV STPVVS+VFGSYLYICINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  874  YFWVLSTPVVSMVFGSYLYICINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  933

Query  382  AVDKVPKEWKLDSNWE---TEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQT  215
            AVDKVPK+W LD +W+   T+P Q S+ R+FPSKWRA S   DP + VRVVD FVI +T
Sbjct  934  AVDKVPKDWMLDPDWDMETTDPLQMSHSRRFPSKWRAASGWSDPTSVVRVVDQFVIPRT  992



>emb|CDX86747.1| BnaA09g21370D [Brassica napus]
Length=165

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = -2

Query  679  MSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYIC  500
            MSAFDVPEVMAVTR NICK GM+SLSR GAVIYY SVFLYFWVFSTPVVSLVFGSYLYIC
Sbjct  1    MSAFDVPEVMAVTRNNICKEGMESLSRSGAVIYYASVFLYFWVFSTPVVSLVFGSYLYIC  60

Query  499  INWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQ  320
            INWLH+HFDEAFSSLRIANYKSFTRFHI    D+EVFTLAVDKVPK+WKLD +W+ EP+Q
Sbjct  61   INWLHIHFDEAFSSLRIANYKSFTRFHIKKNKDIEVFTLAVDKVPKDWKLDKDWDAEPKQ  120

Query  319  P---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKSDSE  197
                S+ RKFPSKW A+S QQDP+  V+VVDHFVI +++  + E
Sbjct  121  SGVMSHKRKFPSKWCASSAQQDPVAAVKVVDHFVIYRSQNQNGE  164



>ref|XP_004956163.1| PREDICTED: uncharacterized protein LOC101776542 [Setaria italica]
Length=1021

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 4/178 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+E+WTFGLYPACIKYLMSAFD+PEVMAVTR  ICK G++SL RGGA+IYY  VFL
Sbjct  832   GLRARLEQWTFGLYPACIKYLMSAFDIPEVMAVTRSTICKKGIESLPRGGAIIYYVCVFL  891

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSLVFGSYLY+CINW H+HFDEAFSSLRIANYK+FTRFHI   GDLEVFTL
Sbjct  892   YFWVLSTPVVSLVFGSYLYVCINWFHIHFDEAFSSLRIANYKAFTRFHIKKNGDLEVFTL  951

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQ  218
             AVDKVPK+W LD +W+ EP+ P   SY R+FPSKWR+ S   DPI++VR++D FVI +
Sbjct  952   AVDKVPKDWMLDPDWDMEPKPPLQMSYTRRFPSKWRSAS-GPDPISSVRIIDRFVIPR  1008



>gb|KCW86241.1| hypothetical protein EUGRSUZ_B02927 [Eucalyptus grandis]
Length=1051

 Score =   281 bits (719),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLR R+E+WTFGLYPACIKYLMSAFDVPEVMAV+R +IC+N M+SLSRG   IYY SVF+
Sbjct  835   GLRVRMEQWTFGLYPACIKYLMSAFDVPEVMAVSRTDICQNRMESLSRGVVAIYYASVFV  894

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWVFSTPVVSLVFGSYLYIC+NWLH+H+DEAFSSLRIA+YK FTRFHI+ KGDLEV+TL
Sbjct  895   YFWVFSTPVVSLVFGSYLYICVNWLHLHYDEAFSSLRIADYKGFTRFHIDKKGDLEVYTL  954

Query  382   AVDKVPKEWKLDSNWETEPQQP---SYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
             AVD+VPK+W  D +W  EP QP   S++RKFPS WR+    +DP+ TVR+ D+FVI +  
Sbjct  955   AVDEVPKDWNPDPDWRNEPHQPERSSHLRKFPSMWRSADPLKDPVKTVRIEDYFVIHRNG  1014

Query  211   KSDSESMNGSKTQ  173
             ++  E+   ++ +
Sbjct  1015  ENRQETPGPAQPE  1027



>ref|XP_010044199.1| PREDICTED: uncharacterized protein LOC104433215 [Eucalyptus grandis]
Length=1193

 Score =   282 bits (721),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GL+AR+E+WT+GLYPACIKYLMSAFD+ EVMAV+R+NIC+ GM+SLSRG A IYY SVF+
Sbjct  800  GLQARMEQWTYGLYPACIKYLMSAFDILEVMAVSRRNICQEGMESLSRGSAAIYYASVFV  859

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYIC+NW H+H+DEAFSSLRIANYK FTRFHIN KGDLEV+TL
Sbjct  860  YFWVFSTPVVSLVFGSYLYICVNWFHLHYDEAFSSLRIANYKGFTRFHINKKGDLEVYTL  919

Query  382  AVDKVPKEWKLDSNW---ETEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTE  212
            AVD+VP+EWK D NW   +  P++ S++R FPS+W +    +DP+ TVR+VD FVI +  
Sbjct  920  AVDEVPEEWKRDPNWWKEQKRPERRSHLRNFPSQWSSADPSKDPVKTVRIVDRFVIHRNG  979

Query  211  KSDSES  194
             S  E+
Sbjct  980  ASHQET  985



>ref|XP_004987249.1| PREDICTED: uncharacterized protein LOC101783935 isoform X1 [Setaria 
italica]
 ref|XP_004987250.1| PREDICTED: uncharacterized protein LOC101783935 isoform X2 [Setaria 
italica]
 ref|XP_004987251.1| PREDICTED: uncharacterized protein LOC101783935 isoform X3 [Setaria 
italica]
 ref|XP_004987252.1| PREDICTED: uncharacterized protein LOC101783935 isoform X4 [Setaria 
italica]
 ref|XP_004987253.1| PREDICTED: uncharacterized protein LOC101783935 isoform X5 [Setaria 
italica]
 ref|XP_004987254.1| PREDICTED: uncharacterized protein LOC101783935 isoform X6 [Setaria 
italica]
Length=702

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 3/157 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR+R+E+WT GLYPACIKYLMSAFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  512  GLRSRLEQWTLGLYPACIKYLMSAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  571

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHI   GDLE+FTL
Sbjct  572  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHIKKDGDLEIFTL  631

Query  382  AVDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRA  281
            AVDKVPK+WKLD  WE++   P Q S+ RK PSKWR 
Sbjct  632  AVDKVPKDWKLDPRWESDVRGPHQLSHERKHPSKWRC  668



>ref|XP_001765009.1| predicted protein [Physcomitrella patens]
 gb|EDQ70225.1| predicted protein [Physcomitrella patens]
Length=1105

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 146/193 (76%), Gaps = 6/193 (3%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRARIE WT G YPACIKYLM+AFDVPEVMAVTR NICK+GMDSL RG  + YY SVFL
Sbjct  829   GLRARIEYWTMGFYPACIKYLMAAFDVPEVMAVTRANICKSGMDSLPRGFVLAYYASVFL  888

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             Y+WVFSTPVVSLVFGSYLY CINW H+HFDEAFSSLRIANYKSF RFHIN+ GDL V+TL
Sbjct  889   YYWVFSTPVVSLVFGSYLYACINWFHLHFDEAFSSLRIANYKSFNRFHINSDGDLHVYTL  948

Query  382   AVDKVPKEWKLDSNWETE----PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVI--E  221
             A DKVPKEW LD  WE E    P  PS+ R  PS+W      +D  + VRV+D FVI   
Sbjct  949   AADKVPKEWALDPEWEAEQAEKPDLPSHKRSCPSQWTPVGHIRDRFSKVRVIDEFVIPKR  1008

Query  220   QTEKSDSESMNGS  182
             ++  S+  S  G+
Sbjct  1009  RSPMSNGASEKGT  1021



>ref|XP_002974647.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
 gb|EFJ24167.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
Length=999

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+ERWT GLYPAC+KYLMSAFDVPEVMAVTR NIC+ G+DS+SRG  +IYY+SVFL
Sbjct  824  GLRARMERWTLGLYPACLKYLMSAFDVPEVMAVTRSNICRTGLDSMSRGFKLIYYSSVFL  883

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVS +FGSYLY CINWL++HFDEAFSSLRIANYKSF R H+   GDLEV+TL
Sbjct  884  YFWVFSTPVVSFIFGSYLYTCINWLNLHFDEAFSSLRIANYKSFLRCHVTKTGDLEVYTL  943

Query  382  AVDKVPKEWKLDSNWETEPQ-QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQ  218
            AVDKVPKEW LD  W+ E    PSY RK+PS+W      +D    VRV+DHFV+ +
Sbjct  944  AVDKVPKEWMLDPLWDEEQSVSPSYSRKYPSQWIPLPPYRDANCNVRVIDHFVVSK  999



>ref|XP_002963358.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
 gb|EFJ35229.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
Length=999

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+ERWT GLYPAC+KYLMSAFDVPEVMAVTR NIC+ G+DS+SRG  +IYY+SVFL
Sbjct  824  GLRARMERWTLGLYPACLKYLMSAFDVPEVMAVTRSNICRTGLDSMSRGFKLIYYSSVFL  883

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVS +FGSYLY CINWL++HFDEAFSSLRIANYKSF R H+   GDLEV+TL
Sbjct  884  YFWVFSTPVVSFIFGSYLYTCINWLNLHFDEAFSSLRIANYKSFLRCHVTKTGDLEVYTL  943

Query  382  AVDKVPKEWKLDSNWETEPQ-QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQ  218
            AVDKVPKEW LD  W+ E    PSY RK+PS+W      +D    VRV+DHFV+ +
Sbjct  944  AVDKVPKEWMLDPLWDEEQSVSPSYSRKYPSQWIPLPPYRDANCNVRVIDHFVVSK  999



>gb|KDO84270.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=438

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NICKNGM SLSRGGAVIYY SVFL
Sbjct  266  GLRARIEQWTFGLYPACIKYLMSAFDIPEVMAVTRSNICKNGMQSLSRGGAVIYYASVFL  325

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLV GSYLYIC+NWLH+HFDEAFSSLRIANYK+FTRFHIN  GDLEV+TL
Sbjct  326  YFWVFSTPVVSLVLGSYLYICVNWLHLHFDEAFSSLRIANYKAFTRFHINHDGDLEVYTL  385

Query  382  AVDKVPK  362
            AVDKV K
Sbjct  386  AVDKVRK  392



>gb|EMT21375.1| hypothetical protein F775_01280 [Aegilops tauschii]
Length=661

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  739  LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLY  560
            L+ R + W F +    I +++     P+VMAVTR NICKNGM SLSR   ++YYTSVF+Y
Sbjct  476  LKFRKKNWQFDIIGGFIYFILVFSMFPQVMAVTRINICKNGMMSLSRSVLIMYYTSVFIY  535

Query  559  FWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLA  380
            FW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTR HI   GDLE+FTLA
Sbjct  536  FWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRLHIKKDGDLEIFTLA  595

Query  379  VDKVPKEWKLDSNWETE---PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
            VDKVPK+WKLD  WE E   P Q S+ R++PSKWR+ S   DP+ +VRVVDHF I +T  
Sbjct  596  VDKVPKDWKLDPKWEAEERGPHQLSHHRRYPSKWRSAS-SPDPVRSVRVVDHFTITRTVA  654

Query  208  SDSES  194
             D E+
Sbjct  655  PDPET  659



>gb|KJB58438.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=957

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WTFGLYPACIKYLMSAFDVPEVMAVTR NICKNG+ +LSRGGAVIYY S+FL
Sbjct  829  GLRARMEQWTFGLYPACIKYLMSAFDVPEVMAVTRSNICKNGIQALSRGGAVIYYASIFL  888

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINW H+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  889  YFWVFSTPVVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  948

Query  382  AVDKV  368
            AVDKV
Sbjct  949  AVDKV  953



>gb|KHG27254.1| aat [Gossypium arboreum]
Length=1004

 Score =   239 bits (611),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEV+AVTR NICK G+ SLSRGGA+IYY SVFL
Sbjct  838  GLRARIEQWTFGLYPACIKYLMSAFDVPEVIAVTRSNICKYGIQSLSRGGAIIYYASVFL  897

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHIN  GDLEVFTL
Sbjct  898  YFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHINRDGDLEVFTL  957

Query  382  AVDKVPKEW  356
            A+DKV  ++
Sbjct  958  AIDKVRSQY  966



>gb|KCW44765.1| hypothetical protein EUGRSUZ_L01670 [Eucalyptus grandis]
Length=679

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 138/180 (77%), Gaps = 6/180 (3%)
 Frame = -2

Query  715  TFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPV  536
            T GLY AC +++ SAFD  EVMAV+R +IC+ GM+S+SRG A IYY SV  YFWV S PV
Sbjct  290  TLGLYSACTEFIKSAFDCLEVMAVSRIDICRRGMESMSRGTAAIYYASVLHYFWVISNPV  349

Query  535  VSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VSLVFGSYLY+C  WLH+H+DEAFSSLRIA+YK FTRFHIN +GDLE++TL VDKVP++W
Sbjct  350  VSLVFGSYLYVCAKWLHLHYDEAFSSLRIADYKGFTRFHINKEGDLEIYTLVVDKVPEKW  409

Query  355  KLDSNWETEPQQ-----PSYVRKFPSKW-RATSLQQDPINTVRVVDHFVIEQTEKSDSES  194
            K D  WE E +Q      S++RKFPSKW  A   + DP+ TVR+VD+FVI++  +S  ES
Sbjct  410  KRDKRWEEEEKQREKTERSHLRKFPSKWISADPSKGDPVETVRIVDYFVIQRNGESHQES  469



>gb|KEH40050.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=954

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFDVPEVMAV+R NICKNG++S+SRGGA+IYY +VFL
Sbjct  825  GLRARIEQWTFGLYPACIKYLMSAFDVPEVMAVSRNNICKNGLESVSRGGAIIYYAAVFL  884

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFWVFSTPVVSLVFGSYLYICINWLH+HFDEAFSSLRIANYKSFTRFHI++ G+LEVFTL
Sbjct  885  YFWVFSTPVVSLVFGSYLYICINWLHLHFDEAFSSLRIANYKSFTRFHISSDGNLEVFTL  944

Query  382  AVDKV  368
            AVDKV
Sbjct  945  AVDKV  949



>ref|XP_010040937.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104429834 
[Eucalyptus grandis]
Length=1187

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 138/180 (77%), Gaps = 6/180 (3%)
 Frame = -2

Query  715  TFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPV  536
            T GLY AC +++ SAFD  EVMAV+R +IC+ GM+S+SRG A IYY SV  YFWV S PV
Sbjct  798  TLGLYSACTEFIKSAFDCLEVMAVSRIDICRRGMESMSRGTAAIYYASVLHYFWVISNPV  857

Query  535  VSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VSLVFGSYLY+C  WLH+H+DEAFSSLRIA+YK FTRFHIN +GDLE++TL VDKVP++W
Sbjct  858  VSLVFGSYLYVCAKWLHLHYDEAFSSLRIADYKGFTRFHINKEGDLEIYTLVVDKVPEKW  917

Query  355  KLDSNWETEPQQ-----PSYVRKFPSKW-RATSLQQDPINTVRVVDHFVIEQTEKSDSES  194
            K D  WE E +Q      S++RKFPSKW  A   + DP+ TVR+VD+FVI++  +S  ES
Sbjct  918  KRDKRWEEEEKQREKTERSHLRKFPSKWISADPSKGDPVETVRIVDYFVIQRNGESHQES  977



>ref|XP_010062117.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010062119.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
Length=1058

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  742   GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
             GLRAR+ERWT GLYPACIKYLMSAFDV EVMAVTR NICK G+ SLSRGGA IYY SVFL
Sbjct  920   GLRARLERWTLGLYPACIKYLMSAFDVLEVMAVTRTNICKMGLASLSRGGAAIYYASVFL  979

Query  562   YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
             YFWV STPVVSL+FGSYLYICINWLH+HFDEAFSSLRIANYK+FTRFHIN+ GDLEV+TL
Sbjct  980   YFWVLSTPVVSLIFGSYLYICINWLHIHFDEAFSSLRIANYKAFTRFHINSDGDLEVYTL  1039

Query  382   AVDK  371
             AVDK
Sbjct  1040  AVDK  1043



>ref|XP_008651923.1| PREDICTED: uncharacterized protein LOC103631870 isoform X2 [Zea 
mays]
 ref|XP_008651924.1| PREDICTED: uncharacterized protein LOC103631870 isoform X3 [Zea 
mays]
Length=978

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+E+WT GLYPACIKYLM+AFDVPEVMAVTR NICKNGM SLSR   ++YYTSVF+
Sbjct  832  GLRARLEQWTLGLYPACIKYLMAAFDVPEVMAVTRINICKNGMMSLSRSVLIMYYTSVFI  891

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            YFW+FSTPVVSL+FGSYLYICINW H+HFDEAFSSLRIANYKSFTRFH+   GDLE+FTL
Sbjct  892  YFWIFSTPVVSLIFGSYLYICINWFHIHFDEAFSSLRIANYKSFTRFHVKKDGDLEIFTL  951

Query  382  AVDKVPKE  359
            AVDKV  +
Sbjct  952  AVDKVTDQ  959



>ref|XP_001772190.1| predicted protein [Physcomitrella patens]
 gb|EDQ63003.1| predicted protein, partial [Physcomitrella patens]
Length=945

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR RIE WTFG+YPACIKYLM+AFDVPEVMAVTR NIC+ GM  L RG  ++YY +VFL
Sbjct  816  GLRGRIEHWTFGMYPACIKYLMAAFDVPEVMAVTRNNICEQGMSRLPRGLVLVYYATVFL  875

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            Y+W+FS P+VSLVFGSYLYICINW H+HFDEAFSSLRIANYKSFTR HI++KGDL ++TL
Sbjct  876  YYWIFSCPIVSLVFGSYLYICINWFHLHFDEAFSSLRIANYKSFTRCHISSKGDLHIYTL  935

Query  382  AVDKV  368
            A+DKV
Sbjct  936  AIDKV  940



>gb|KDD72728.1| hypothetical protein H632_c2969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=408

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 121/192 (63%), Gaps = 15/192 (8%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRAR+ERWT GLYP  +++ M+ FDVP+++AV R  +C+    ++SR  A+ YY  V  
Sbjct  219  GLRARLERWTLGLYPGVLRWGMTLFDVPDLIAVARAQLCQG--QAVSRAAALGYYAGVLA  276

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            Y+WV +TP V L+FG+YLY+ +NW+ VH+DEAFSSL+I +YK F R H++  GDLE+F+L
Sbjct  277  YYWVLATPSVGLLFGAYLYVAVNWMGVHYDEAFSSLQIPDYKGFLRLHVSPAGDLEIFSL  336

Query  382  AVDKVPKEWKLDSNWE------TEPQQPSYVRKFPSKWRA-------TSLQQDPINTVRV  242
            A+D+VP+ W+ D  W            PS+    PS+W A       T L   P   VRV
Sbjct  337  ALDRVPRTWREDPRWRGLRGGGGAGAAPSWRAALPSRWAAVRRQGHHTLLADQPEEQVRV  396

Query  241  VDHFVIEQTEKS  206
            VD+  + +   +
Sbjct  397  VDYLKVPRRRDA  408



>gb|EMS47321.1| hypothetical protein TRIUR3_13192 [Triticum urartu]
Length=725

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  658  EVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVH  479
            +VMAVTR NICKNGM SLSR   ++YYTSVF+YFW+FSTPVVSL+FGSYLYICINW H+H
Sbjct  562  KVMAVTRINICKNGMMSLSRSVLIMYYTSVFIYFWIFSTPVVSLIFGSYLYICINWFHIH  621

Query  478  FDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKV  368
            FDEAFSSLRIANYKSFTRFHI   GDLE+FTLAVDK+
Sbjct  622  FDEAFSSLRIANYKSFTRFHIKKDGDLEIFTLAVDKI  658



>ref|XP_011397366.1| hypothetical protein F751_3196 [Auxenochlorella protothecoides]
 gb|KFM24478.1| hypothetical protein F751_3196 [Auxenochlorella protothecoides]
Length=728

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 112/186 (60%), Gaps = 14/186 (8%)
 Frame = -2

Query  739  LRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLY  560
            +R   ERWT GLYP  IK+ M+AFD PE +AV+R  +C      L+R  A+ YY  V  Y
Sbjct  539  MRGAAERWTLGLYPGAIKWAMAAFDAPEAIAVSRDLLCAG--RELNRLQALGYYGGVLAY  596

Query  559  FWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLA  380
            +W+ +TP V+LVFG+YLYIC+NW  VH+DEAFSSL++ ++K F R HI   GDLE+F+L 
Sbjct  597  YWLLATPTVALVFGAYLYICVNWFGVHYDEAFSSLQVPDHKGFLRMHITPAGDLEIFSLG  656

Query  379  VDKVPKEWKLDSNWE-----TEPQQPSYVRKFPSKWRATSLQQD-------PINTVRVVD  236
            +D VP+ W+ D  W       +   P +  + PS+W    ++         P   ++VVD
Sbjct  657  LDTVPRAWREDPAWRAPGGGGDAGVPGWRARHPSRWVPVEVRGGYTLRGTPPEAALKVVD  716

Query  235  HFVIEQ  218
            +  + +
Sbjct  717  YLHVPR  722



>ref|XP_008877911.1| hypothetical protein, variant 4 [Aphanomyces invadans]
 ref|XP_008877914.1| hypothetical protein, variant 5 [Aphanomyces invadans]
 gb|ETV93542.1| hypothetical protein, variant 4 [Aphanomyces invadans]
 gb|ETV93543.1| hypothetical protein, variant 5 [Aphanomyces invadans]
Length=966

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV +TP+  +
Sbjct  779  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWVAATPLSGV  838

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YLY+ +N  H H++EAFS+LR+A+YK+F R HI + GDLE+F L VDK+P +W  D
Sbjct  839  IVGVYLYLAVNVFHSHYNEAFSALRVASYKNFLRLHIKSNGDLEIFALGVDKMPTKWIRD  898

Query  346  SNW----ETEPQQPSYVRKFPSKWRATSLQQDPI  257
             +W    + E   PSY  K PS W+    + D I
Sbjct  899  PDWSGATQAEKVSPSYEWKVPSYWKPKMSRVDNI  932



>ref|XP_008877896.1| hypothetical protein H310_12570 [Aphanomyces invadans]
 ref|XP_008877910.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 ref|XP_008877912.1| hypothetical protein, variant 2 [Aphanomyces invadans]
 gb|ETV93538.1| hypothetical protein H310_12570 [Aphanomyces invadans]
 gb|ETV93539.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETV93540.1| hypothetical protein, variant 2 [Aphanomyces invadans]
Length=1022

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV +TP+  +
Sbjct  835  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWVAATPLSGV  894

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YLY+ +N  H H++EAFS+LR+A+YK+F R HI + GDLE+F L VDK+P +W  D
Sbjct  895  IVGVYLYLAVNVFHSHYNEAFSALRVASYKNFLRLHIKSNGDLEIFALGVDKMPTKWIRD  954

Query  346  SNW----ETEPQQPSYVRKFPSKWRATSLQQDPI  257
             +W    + E   PSY  K PS W+    + D I
Sbjct  955  PDWSGATQAEKVSPSYEWKVPSYWKPKMSRVDNI  988



>ref|XP_008877913.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETV93541.1| hypothetical protein, variant 3 [Aphanomyces invadans]
Length=1011

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV +TP+  +
Sbjct  824  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWVAATPLSGV  883

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YLY+ +N  H H++EAFS+LR+A+YK+F R HI + GDLE+F L VDK+P +W  D
Sbjct  884  IVGVYLYLAVNVFHSHYNEAFSALRVASYKNFLRLHIKSNGDLEIFALGVDKMPTKWIRD  943

Query  346  SNW----ETEPQQPSYVRKFPSKWRATSLQQDPI  257
             +W    + E   PSY  K PS W+    + D I
Sbjct  944  PDWSGATQAEKVSPSYEWKVPSYWKPKMSRVDNI  977



>ref|XP_002954875.1| hypothetical protein VOLCADRAFT_65342 [Volvox carteri f. nagariensis]
 gb|EFJ44074.1| hypothetical protein VOLCADRAFT_65342 [Volvox carteri f. nagariensis]
Length=572

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 110/179 (61%), Gaps = 9/179 (5%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNG--MDSLSRGGAVIYYTSV  569
            GLR  ++R T GLYP  ++  M  +DVPE++AV R  +C+ G  ++S+SR  A+ YY  +
Sbjct  324  GLRQLLQRCTLGLYPGALQLAMGVYDVPELIAVARTTMCEAGGSLESISRLQALSYYAGM  383

Query  568  FLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVF  389
              Y+W+ +TP V  VFG YLYI + W HVH+DEAFSSLR  + KSF R HI   GDL+++
Sbjct  384  LAYYWLLATPAVGFVFGLYLYISVCWFHVHYDEAFSSLREVSCKSFCRLHIGPSGDLQLY  443

Query  388  TLAVDKVPKEWKLDSNW-----ETEPQQPSYVRKFPSKWRATSLQ--QDPINTVRVVDH  233
            TLA+D+VP  W+ D  W        P   ++   +PS+W  T  +  +D  + +R+  H
Sbjct  444  TLALDEVPTRWQEDPRWRGRGGGGNPGVVAHEAHYPSRWVPTRAEAGRDAASPIRLPQH  502



>ref|XP_001695554.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01341.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=477

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNG--MDSLSRGGAVIYYTSV  569
            GLR  +ERWT GLYP  ++  M  +DVPE++AV+R  +C  G  +D++SR  AV YYT +
Sbjct  347  GLRESLERWTLGLYPRALQLAMWVYDVPELIAVSRTAMCAAGGSLDAISRLQAVGYYTGM  406

Query  568  FLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVF  389
              Y+W+ +TP +  VFG YLY+ + W HVHFDEAFSSLR   +KSF R H+   G LE+F
Sbjct  407  LAYYWLLATPAMGFVFGLYLYLSVCWCHVHFDEAFSSLREPGFKSFVRLHLRPDGHLELF  466

Query  388  TLAVDKVPKEW  356
            TLA+D+VP  W
Sbjct  467  TLALDEVPSRW  477



>ref|XP_009843915.1| hypothetical protein H257_16986 [Aphanomyces astaci]
 gb|ETV66544.1| hypothetical protein H257_16986 [Aphanomyces astaci]
Length=1012

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY AC+KY+++ FDVP+ +A+ R NIC+ G  SL+R   ++YY SVFLYFWV +TP+  +
Sbjct  828  LYSACVKYILTVFDVPQAVAIYRTNICQAGFHSLARSEVLVYYYSVFLYFWVAATPLSGI  887

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YLY+ +N    H++EAFS+LR+A+YK+  R HI   GDLE+F L VDK+P +W  D
Sbjct  888  IVGVYLYLAVNVFKSHYNEAFSALRVASYKNILRLHIKPNGDLEMFALGVDKMPTKWIRD  947

Query  346  SNWETEPQQ--PSYVRKFPSKWRATSLQQDPI  257
              W     +  PSY  K PS W+    + D I
Sbjct  948  PAWSGTGHKLAPSYEWKVPSYWKPKMSRVDNI  979



>gb|KDO31855.1| hypothetical protein SPRG_03775 [Saprolegnia parasitica CBS 223.65]
Length=1017

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KYL++ FD+PEV+AV R  IC  G D+LSR  A +YY SVF+YFWV +TP+  +
Sbjct  812  LYSTCVKYLLTFFDIPEVVAVHRMKICYEGFDALSRIEASVYYYSVFMYFWVAATPICGV  871

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YLY  +N    H++EAFSSLR+A+YK+F R     +G+LE++ L +DK+P++W  D
Sbjct  872  IVGLYLYTALNVFKSHYNEAFSSLRVASYKNFVRMRFTPEGNLEIYALGIDKMPQKWVRD  931

Query  346  SNWETEPQ------QPSYVRKFPSKWRATSLQQDPI  257
              W    +       PSY  K+P+ W+    + D I
Sbjct  932  PKWSGAAEARKLNPSPSYEWKYPNYWKPKISKVDNI  967



>ref|XP_008611391.1| hypothetical protein SDRG_07341 [Saprolegnia diclina VS20]
 gb|EQC35107.1| hypothetical protein SDRG_07341 [Saprolegnia diclina VS20]
Length=1015

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KYL++ FD+PEV+AV R  IC  G D+LSR  A +YY SVF+YFWV +TP+  +
Sbjct  812  LYSTCVKYLLTFFDIPEVVAVHRMKICYEGFDALSRIEASVYYYSVFMYFWVAATPICGV  871

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YLY  +N    H++EAFSSLR+A+YK+F R      G+LE++ L +DK+P++W  D
Sbjct  872  IVGLYLYTALNVFKSHYNEAFSSLRVASYKNFVRMRFTPDGNLEIYALGIDKMPQKWVRD  931

Query  346  SNWETEPQ------QPSYVRKFPSKWRATSLQQDPI  257
              W    +       PSY  K+P+ W+    + D I
Sbjct  932  PKWSGAAEARKLNPSPSYEWKYPNYWKPKISKVDNI  967



>ref|XP_008877903.1| hypothetical protein, variant 18 [Aphanomyces invadans]
 ref|XP_008877904.1| hypothetical protein, variant 19 [Aphanomyces invadans]
 gb|ETV93556.1| hypothetical protein, variant 18 [Aphanomyces invadans]
 gb|ETV93557.1| hypothetical protein, variant 19 [Aphanomyces invadans]
Length=904

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV +TP+  +
Sbjct  779  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWVAATPLSGV  838

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            + G YLY+ +N  H H++EAFS+LR+A+YK+F R HI + GDLE+F L VDK+P +W
Sbjct  839  IVGVYLYLAVNVFHSHYNEAFSALRVASYKNFLRLHIKSNGDLEIFALGVDKMPTKW  895



>ref|XP_008877892.1| hypothetical protein, variant 8 [Aphanomyces invadans]
 ref|XP_008877915.1| hypothetical protein, variant 6 [Aphanomyces invadans]
 ref|XP_008877916.1| hypothetical protein, variant 7 [Aphanomyces invadans]
 gb|ETV93544.1| hypothetical protein, variant 6 [Aphanomyces invadans]
 gb|ETV93545.1| hypothetical protein, variant 7 [Aphanomyces invadans]
 gb|ETV93546.1| hypothetical protein, variant 8 [Aphanomyces invadans]
Length=960

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV +TP+  +
Sbjct  835  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWVAATPLSGV  894

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            + G YLY+ +N  H H++EAFS+LR+A+YK+F R HI + GDLE+F L VDK+P +W
Sbjct  895  IVGVYLYLAVNVFHSHYNEAFSALRVASYKNFLRLHIKSNGDLEIFALGVDKMPTKW  951



>ref|XP_008877893.1| hypothetical protein, variant 9 [Aphanomyces invadans]
 gb|ETV93547.1| hypothetical protein, variant 9 [Aphanomyces invadans]
Length=949

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV +TP+  +
Sbjct  824  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWVAATPLSGV  883

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            + G YLY+ +N  H H++EAFS+LR+A+YK+F R HI + GDLE+F L VDK+P +W
Sbjct  884  IVGVYLYLAVNVFHSHYNEAFSALRVASYKNFLRLHIKSNGDLEIFALGVDKMPTKW  940



>gb|ETL46182.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=990

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETL99327.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=990

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETI52906.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETK92766.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO81609.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETP22715.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=990

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETP50692.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=990

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>gb|ETL99329.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=912

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>ref|XP_002909241.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY58055.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=1041

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  849   LYGDFMRLCMTLFDVPEVVALHRNKICTSGFESLGRTELWAYYASVFPYFWVLATPVVSF  908

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  909   VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  968

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  969   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1009



>gb|ETP50694.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=912

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETI52908.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETK92768.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETO81611.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
 gb|ETP22717.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=912

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETL46184.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=912

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETL99326.1| hypothetical protein L917_03802 [Phytophthora parasitica]
Length=1043

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  851   LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  910

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  911   VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  970

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  971   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETI52905.1| hypothetical protein F443_04062 [Phytophthora parasitica P1569]
 gb|ETK92765.1| hypothetical protein L915_03944 [Phytophthora parasitica]
 gb|ETO81608.1| hypothetical protein F444_04117 [Phytophthora parasitica P1976]
 gb|ETP22714.1| hypothetical protein F441_04041 [Phytophthora parasitica CJ01A1]
Length=1043

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  851   LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  910

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  911   VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  970

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  971   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETP50691.1| hypothetical protein F442_04046 [Phytophthora parasitica P10297]
Length=1043

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  851   LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  910

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  911   VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  970

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  971   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETL46181.1| hypothetical protein L916_03887 [Phytophthora parasitica]
Length=1043

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  851   LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  910

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  911   VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  970

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  971   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>ref|XP_008901274.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN13199.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=990

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>ref|XP_008901276.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETN13201.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=912

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>ref|XP_008901271.1| hypothetical protein PPTG_08104 [Phytophthora parasitica INRA-310]
 gb|ETN13198.1| hypothetical protein PPTG_08104 [Phytophthora parasitica INRA-310]
Length=1043

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  851   LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  910

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  911   VFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  970

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  971   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>emb|CCA25522.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=837

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 96/149 (64%), Gaps = 5/149 (3%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY + +++ MSAFD+PEV+A+ R  IC +G ++L+R     YY SVF YF+V + PVV  
Sbjct  632  LYFSFMRFCMSAFDIPEVVAIHRSKICSSGFEALTRFEMWTYYLSVFPYFFVLAAPVVGF  691

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG YLY+ +N   VH++EAFS+LRI++YK+F R HI   GDL V  + +DK+P++W  D
Sbjct  692  VFGLYLYLSLNLWGVHYNEAFSALRISSYKNFLRLHIQPNGDLIVHAIGIDKMPRKWGRD  751

Query  346  SNW-----ETEPQQPSYVRKFPSKWRATS  275
              W       E  +PSY    PS W+  S
Sbjct  752  PAWSGGRNHPEQHKPSYEWSSPSYWKPVS  780



>gb|ETM52471.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=990

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+    VDK+P+ W  D
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEISAFGVDKMPRRWCRD  917

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  918  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  958



>ref|XP_009529340.1| hypothetical protein PHYSODRAFT_315827 [Phytophthora sojae]
 gb|EGZ15591.1| hypothetical protein PHYSODRAFT_315827 [Phytophthora sojae]
Length=1041

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   +   M+ FDVPEV+A+ R  IC +G +SL R    +YY SVF YFWV +TPVVS 
Sbjct  849   LYDDFMLLSMTIFDVPEVVALHRNKICASGFESLGRMELWMYYASVFPYFWVLATPVVSF  908

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N    H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W  D
Sbjct  909   VFGTYLYLSLNIFGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRWCRD  968

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  969   PKWSGGNGPRASLERDLPSFKWTRPSYWKPLVTKVD--NMLRL  1009



>gb|ETM52473.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=912

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 10/163 (6%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  720  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  779

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+    VDK+P+ W  D
Sbjct  780  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEISAFGVDKMPRRWCRD  839

Query  346  SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
              W          E   PS+    PS W+    + D  N +R+
Sbjct  840  PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  880



>gb|ETM52470.1| hypothetical protein L914_03906 [Phytophthora parasitica]
Length=1043

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 10/163 (6%)
 Frame = -2

Query  706   LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
             LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  851   LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  910

Query  526   VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
             VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+    VDK+P+ W  D
Sbjct  911   VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEISAFGVDKMPRRWCRD  970

Query  346   SNWET--------EPQQPSYVRKFPSKWRATSLQQDPINTVRV  242
               W          E   PS+    PS W+    + D  N +R+
Sbjct  971   PKWSGGNGPRASLERNLPSFKWTRPSYWKPLVTKVD--NMLRL  1011



>gb|ETP50693.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=925

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRW  914



>gb|ETL99328.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=925

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRW  914



>gb|ETL46183.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=925

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRW  914



>gb|ETI52907.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETK92767.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETO81610.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
 gb|ETP22716.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=925

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRW  914



>ref|XP_008901275.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN13200.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=925

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+F   VDK+P+ W
Sbjct  858  VFGTYLYLSLNILGYHYNEAFSSLRIASYKNFLRLHFDKEGRLEIFAFGVDKMPRRW  914



>gb|ETM52472.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=925

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSL  527
            LY   ++  M+ FDVPEV+A+ R  IC +G +SL R     YY SVF YFWV +TPVVS 
Sbjct  798  LYGDFMRLCMTIFDVPEVVALHRNKICGSGFESLGRTELWTYYASVFPYFWVLATPVVSF  857

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEW  356
            VFG+YLY+ +N L  H++EAFSSLRIA+YK+F R H + +G LE+    VDK+P+ W
Sbjct  858  VFGTYLYLSLNILGCHYNEAFSSLRIASYKNFLRLHFDKEGRLEISAFGVDKMPRRW  914



>ref|XP_005651351.1| hypothetical protein COCSUDRAFT_12255, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26807.1| hypothetical protein COCSUDRAFT_12255, partial [Coccomyxa subellipsoidea 
C-169]
Length=884

 Score =   132 bits (333),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLR  + R+T   YP  ++  M+ FDVPE +AVTR  +C      LSR     YY  +  
Sbjct  735  GLRDTVARYTLHAYPGVVQAAMALFDVPEAIAVTRTAMCSATTAPLSRFQGAAYYLGMLA  794

Query  562  YFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTL  383
            Y+WV  TP V+ +FG YLY+ +N  HVH+DEAFSSL+I ++K F+R H+  +GDL V+ L
Sbjct  795  YYWVLVTPSVAFIFGGYLYLSVNLFHVHYDEAFSSLQIPHHKGFSRIHVTPEGDLHVYGL  854

Query  382  AVDKV  368
            A+D+V
Sbjct  855  AIDQV  859



>gb|KHG25783.1| hypothetical protein F383_07510 [Gossypium arboreum]
Length=206

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = -3

Query  723  NDGHLAFIQHVSSI*CLPLMYPR*WQ*RGKTSARMGWIHSPEGVL*YIIHPFFFISGFSQ  544
            ++GHLA IQHVS I C  LM+ R W       ARM +   PEGVL YI+    F SGFS+
Sbjct  69   SNGHLASIQHVSCISCPHLMFQRLWLSPEAIFARMEYRRCPEGVLSYIMLQSSFTSGFSR  128

Query  543  LRWYLWSSEVICISVLIGSTYILMKPFLLSVLPTTSHLHDST*TPKATLKFSHLQLIRFR  364
              W+LW SE  CIS L G  Y L +  LLS L  TSH HDST      LKFS LQ IRF+
Sbjct  129  PLWFLWCSEATCISALTGFIYTLTRRSLLSELLITSHSHDSTSIVMVILKFSLLQSIRFQ  188

Query  363  KSGS*TQTGKRSHSS  319
             +G     G  S SS
Sbjct  189  GTGCWILIGIWSRSS  203



>gb|KJB58439.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=975

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = -3

Query  723  NDGHLAFIQHVSSI*CLPLMYPR*WQ*RGKTSARMGWIHSPEGVL*YIIHPFFFISGFSQ  544
            ++GHLA IQHVSSI C  LM+ R W       ARM +   PEGVL YI+    F SGFS+
Sbjct  838  SNGHLASIQHVSSISCPHLMFQRLWLSPEAIFARMEYRRCPEGVLSYIMLQSSFTSGFSR  897

Query  543  LRWYLWSSEVICISVLIGSTYILMKPFLLSVLPTTSHLHDST*TPKATLKFSHLQLIRFR  364
            L W+LW SE  CIS L G  Y L +  LLS L  TSH HDST      LKFS L+ IRF+
Sbjct  898  LLWFLWCSEATCISALTGFIYTLTRRSLLSELLITSHSHDSTSIVMVILKFSLLRSIRFQ  957

Query  363  KSGS*TQTGKRSHSS  319
             +G     G  S SS
Sbjct  958  GNGCWILIGIWSRSS  972



>gb|EJK61150.1| hypothetical protein THAOC_18408 [Thalassiosira oceanica]
Length=525

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -2

Query  691  IKYLMSAFDVPEVMAVTRQN----ICKNGMDSLSRGGAVIYYT-----------SVFLYF  557
            +K  ++ FD+P  +A T       +C +G   L +   ++Y+            S+ LY+
Sbjct  353  LKMTLALFDLPGTIAATHVQMCAVLCADGAYCLYKNDHMLYHQLDRYTILKYGISIGLYY  412

Query  556  WVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAV  377
             VF  P+   +FG++L + +NWL   +D  FSSLR+ ++K+F R HI+ KGDLE+F +  
Sbjct  413  IVFVVPLAGSLFGTWLALSLNWLKCQYDAGFSSLRMEHWKNFLRLHIDDKGDLEIFAICS  472

Query  376  DKVPKEWKLD-SNWETEPQQPSYVRKFPSKW  287
             +VPK+W+ D  +  +   QPS+  + PSKW
Sbjct  473  HRVPKKWRRDPKSRPSTAAQPSWKWRHPSKW  503



>emb|CAB45564.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79255.1| hypothetical protein [Arabidopsis thaliana]
Length=932

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 57/77 (74%), Gaps = 5/77 (6%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNIC--KNGMDSLSRGGAVIYYTSV  569
            GLR RIE+WTFGLYPACIKYLMSAFD+PEVMAVTR NIC  +NG   L    A IYY SV
Sbjct  856  GLRDRIEQWTFGLYPACIKYLMSAFDIPEVMAVTRTNICRERNGSHFLEAEQA-IYYASV  914

Query  568  FLYFWVFSTPVVSLVFG  518
            FLYFWV   P    +FG
Sbjct  915  FLYFWVLLNPCC--IFG  929



>ref|XP_002288749.1| hypothetical protein THAPSDRAFT_261726 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94185.1| hypothetical protein THAPSDRAFT_261726 [Thalassiosira pseudonana 
CCMP1335]
Length=866

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 86/163 (53%), Gaps = 24/163 (15%)
 Frame = -2

Query  691  IKYLMSAFDVPEVMAVTR----QNICKNGMD-----------SLSRGGAVIYYTSVFLYF  557
            +K  +S FD+P V+  T     +++C  G D            L R   + Y  ++  YF
Sbjct  639  LKTTLSVFDLPGVIGSTHVKMCEHLCSGGNDCLYSNNFAMFQQLDRATIIKYLAAMSFYF  698

Query  556  WVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAV  377
             VF+ P+   VFGS+L + +N L   ++E FSSLR+ ++K+F + HI+ +G+LEVF + +
Sbjct  699  AVFAVPIAGNVFGSWLALTLNVLKCQYNEGFSSLRLEHWKNFLKLHIDGEGNLEVFAIGL  758

Query  376  DKVPKEWKLDSNWETE---------PQQPSYVRKFPSKWRATS  275
             +VPK W  D  W  +         P +PS+  K PSKW   S
Sbjct  759  HRVPKRWVKDPLWGGDIHGKKNGATPIKPSWSWKTPSKWMPLS  801



>ref|XP_002783413.1| hypothetical protein Pmar_PMAR006939 [Perkinsus marinus ATCC 
50983]
 gb|EER15209.1| hypothetical protein Pmar_PMAR006939 [Perkinsus marinus ATCC 
50983]
Length=296

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 96/186 (52%), Gaps = 17/186 (9%)
 Frame = -2

Query  706  LYPACIKYL-MSAFDVPEVMAVTRQNICKNGM--DSLSRGGAVIYYTSVFLYFWVFSTPV  536
            L P+ +  L +S  D+P ++   R   C        L+R   +     +  Y W+  TP+
Sbjct  55   LLPSSLCTLALSISDLPRIIVTNRDAACATMATDQDLTRLDYIALIGPLVPYLWIIITPI  114

Query  535  VSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHIN-TKGDLEVFTLAVDKVPKE  359
             S + G YL + +N L  H+ EAFSSL+I +YK+F R HI+   GDL+ F + VD VP  
Sbjct  115  ASFILGCYLLVSLNVLGQHWTEAFSSLKIRDYKNFVRMHISPITGDLQCFVIGVDHVPTR  174

Query  358  WKLDSNWE-----TEPQQPSYVRKFPSKWRATSLQQDP-------INTVRVVDHFVIEQT  215
            W++D  W+        + PS+    PSK+R   ++++P        +  +VVD FV++ +
Sbjct  175  WEMDPYWDRTLMPKSARVPSWKWVTPSKYRP-RVKKNPNGKALKGGSQAKVVDFFVVKAS  233

Query  214  EKSDSE  197
            +K   E
Sbjct  234  KKRRPE  239



>gb|ETO31334.1| hypothetical protein RFI_05786, partial [Reticulomyxa filosa]
Length=633

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -2

Query  604  SRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTR  425
            SR   ++Y+ +  L++W+  TP+ + V   YL++ +N+L +HF EAFSS+R+ ++K+F R
Sbjct  441  SRAHRLLYHITAVLFYWILCTPLAAFVVALYLFVSVNFLGIHFTEAFSSMRMEDFKNFLR  500

Query  424  FHINTKGDLEVFTLAVDKVPKEWKLDSNW  338
             HI+  G L ++ + VDKVP+ W+ DS W
Sbjct  501  CHIDKDGSLSIYAIGVDKVPRRWQQDSEW  529



>gb|KHG18087.1| hypothetical protein F383_21533 [Gossypium arboreum]
Length=80

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 64/133 (48%), Gaps = 53/133 (40%)
 Frame = -2

Query  727  IERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVF  548
            +E+WTFGL PACIKY MSAFDVPEVMAVTR NICKNG+ +LSR   VI+           
Sbjct  1    MEQWTFGLSPACIKYRMSAFDVPEVMAVTRSNICKNGIQALSR--RVIH-----------  47

Query  547  STPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKV  368
                                           R  + + FT              LAVDKV
Sbjct  48   --------------------------TIPHQRDGDLEVFT--------------LAVDKV  67

Query  367  PKEWKLDSNWETE  329
            P+EW LDS+W+ E
Sbjct  68   PREWMLDSDWDME  80



>ref|XP_002778054.1| hypothetical protein Pmar_PMAR018491 [Perkinsus marinus ATCC 
50983]
 gb|EER09849.1| hypothetical protein Pmar_PMAR018491 [Perkinsus marinus ATCC 
50983]
Length=249

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 95/201 (47%), Gaps = 38/201 (19%)
 Frame = -2

Query  700  PACIKYL-MSAFDVPEVMAVTRQNIC---KNGMDSLSRGGAVIYYTSVFLYFWVFSTPVV  533
            PA +  L +S  D+P      R  +C   +N M  + R   + Y  SV  + ++  TP+ 
Sbjct  5    PASLNSLFISITDLPSHAFHNRAGVCAALQNNM-PIDRFQYLRYIASVSPFLYIIMTPIA  63

Query  532  SLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEW  356
            S +FG YL I +N+L  H  EAFSSLRI +YK F R  I+   GDL VF + +D V + W
Sbjct  64   SFIFGVYLLISLNYLGQHCTEAFSSLRINDYKHFLRMWISPDTGDLHVFVIGIDHVARHW  123

Query  355  KLDSNWETE-----PQQPSYVRKFPSKWRATSLQQ-------------------------  266
            + D  W+ +      Q PS+    PSK+R  S ++                         
Sbjct  124  EADPYWDGKLLPKGSQVPSWKWITPSKYRPKSERKAEEDDLTLLARRVEQGLGPSPSDYR  183

Query  265  --DPINTVRVVDHFVIEQTEK  209
               P    ++VD+FV+E +EK
Sbjct  184  KPQPDGQPKLVDYFVVESSEK  204



>ref|XP_002778051.1| hypothetical protein Pmar_PMAR018488 [Perkinsus marinus ATCC 
50983]
 gb|EER09846.1| hypothetical protein Pmar_PMAR018488 [Perkinsus marinus ATCC 
50983]
Length=183

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 14/147 (10%)
 Frame = -2

Query  610  SLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSF  431
             L+R   +     +  Y W+  TP+ S + G YL + +N L  H+ EAFSSL+I +YK+F
Sbjct  5    DLTRLDYIALIGPLVPYLWIIITPIASFILGCYLLVSLNVLGQHWTEAFSSLKIRDYKNF  64

Query  430  TRFHIN-TKGDLEVFTLAVDKVPKEWKLDSNWE-----TEPQQPSYVRKFPSKWRATSLQ  269
             R HI+   GDL+ F + VD VP  W++D  W+        + PS+    PSK+R   ++
Sbjct  65   VRMHISPITGDLQCFVIGVDHVPTHWEMDPYWDRTLMPKSARVPSWKWVTPSKYRP-RVK  123

Query  268  QDP-------INTVRVVDHFVIEQTEK  209
            ++P        +  +VVD F+++ ++K
Sbjct  124  KNPNGKALKGGSQAKVVDFFMVKASKK  150



>emb|CCC89292.1| unnamed protein product, partial [Trypanosoma congolense IL3000]
Length=743

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 93/178 (52%), Gaps = 13/178 (7%)
 Frame = -2

Query  679  MSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVFSTPVVSLVFGSY  512
            +   D+ E +A     +  N   S+S    R   ++YY  + L +W+ + P++S +FG +
Sbjct  560  LQGLDITENLAYLSHQVGTNNTGSISHSADRIHVILYYLHILLIYWLLAAPLLSFIFGIF  619

Query  511  LYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGD-LEVFTLAVDKVPKEWKLDSNWE  335
            L++ +++  + +D ++SS +I +YK F RF ++ K   L  + +A   VPK W LD  + 
Sbjct  620  LFVSVHYFDLAYDASYSSFQIEDYKHFVRFCVDAKTRVLHGYVIAETYVPKIWSLDGRYV  679

Query  334  TE------PQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEKSDSESMNGSK  179
             E         P ++RK PS+W     +  P +  RV+++FV+ +  +  S +  GS+
Sbjct  680  AECTDAEMQHLPPHLRKHPSRWIRRG-EAGPNSAPRVLENFVV-KPHRVTSRNPKGSR  735



>ref|XP_002783415.1| hypothetical protein Pmar_PMAR006941 [Perkinsus marinus ATCC 
50983]
 gb|EER15211.1| hypothetical protein Pmar_PMAR006941 [Perkinsus marinus ATCC 
50983]
Length=412

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 95/201 (47%), Gaps = 38/201 (19%)
 Frame = -2

Query  700  PACIKYL-MSAFDVPEVMAVTRQNIC---KNGMDSLSRGGAVIYYTSVFLYFWVFSTPVV  533
            PA +  L +S  D+P      R  +C   +N M  + R   + Y  SV  + ++  TP+ 
Sbjct  161  PASLNSLFISITDLPSHAFHNRAGVCAAIQNNM-PIDRFQYLRYIASVSPFLYIIMTPIA  219

Query  532  SLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEW  356
            S +FG YL I +N+L  H  EAFSSLRI +YK F R  I+   GDL VF + +D V + W
Sbjct  220  SFIFGVYLLISLNYLGQHCTEAFSSLRIHDYKHFLRMWISPDTGDLHVFVIGIDHVARHW  279

Query  355  KLDSNWETE-----PQQPSYVRKFPSKWRATSLQQ-------------------------  266
            + D  W+ +      Q PS+    PSK+R  S ++                         
Sbjct  280  EADPYWDGKLLPKGSQVPSWKWITPSKYRPKSERKAEEDDLTLLARRVEQGLGPSPSDYR  339

Query  265  --DPINTVRVVDHFVIEQTEK  209
               P    ++VD+FV+E +EK
Sbjct  340  KPQPDGQPKLVDYFVVESSEK  360



>ref|XP_002765607.1| hypothetical protein Pmar_PMAR013671 [Perkinsus marinus ATCC 
50983]
 gb|EEQ98324.1| hypothetical protein Pmar_PMAR013671 [Perkinsus marinus ATCC 
50983]
Length=1068

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 87/184 (47%), Gaps = 33/184 (18%)
 Frame = -2

Query  661   PEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHV  482
             P  + +   N C   +  + R   + Y  SV  + ++  TP+ S +FG YL I +N+L  
Sbjct  820   PPSIGINASNTCFPQLPPIDRFQYLGYLGSVSPFLYIIMTPIASFIFGVYLVISLNYLGQ  879

Query  481   HFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEWKLDSNWETE--PQQ---  320
             H++EAFSSLRI +YK F R  I+   GDL +F + +D V + W+ D  W+    PQ    
Sbjct  880   HWNEAFSSLRIQDYKHFLRMWISPDTGDLHIFVIGIDHVARHWEADPYWDGRLLPQGSHV  939

Query  319   PSYVRKFPSKWRATS---------------------------LQQDPINTVRVVDHFVIE  221
             PS+    PSK+R  S                            +  P    ++VD+FVIE
Sbjct  940   PSWKWITPSKYRPKSDSKSKEDDLSFWARKVEQGLGPSPSDYRKPQPDGQPKLVDYFVIE  999

Query  220   QTEK  209
              ++K
Sbjct  1000  ASKK  1003



>ref|XP_007017324.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY14549.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 2 [Theobroma cacao]
Length=831

 Score = 65.9 bits (159),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEV  653
            GLRARIE+WTFGLYPACIKYLMSAFDVPEV
Sbjct  711  GLRARIEQWTFGLYPACIKYLMSAFDVPEV  740


 Score = 46.2 bits (108),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -3

Query  627  ARMGWIHSPEGVL*YIIHPFFFISGFSQLRWYLWSSEVICISVLIGSTYILMKPFLL  457
            ARM +   PEGVL YI       SG SQ +W+ W  + I +S L G TY L +P LL
Sbjct  775  ARMVYSRYPEGVLSYITRQSSSTSGCSQPQWFHWCLDAIYMSALTGFTYTLTRPSLL  831



>ref|XP_002781370.1| hypothetical protein Pmar_PMAR020755 [Perkinsus marinus ATCC 
50983]
 gb|EER13165.1| hypothetical protein Pmar_PMAR020755 [Perkinsus marinus ATCC 
50983]
Length=1048

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 86/184 (47%), Gaps = 33/184 (18%)
 Frame = -2

Query  661   PEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHV  482
             P  + +   N C      + R   + Y  SV  + ++  TP+ S +FG YL I +N+L  
Sbjct  822   PLSIGINASNTCFPQFPPIDRFQYLGYLGSVSPFLYIIMTPIASFIFGVYLVISLNYLGQ  881

Query  481   HFDEAFSSLRIANYKSFTRFHINTK-GDLEVFTLAVDKVPKEWKLDSNWETE--PQQ---  320
             H++EAFSSLRI +YK F R  I+   GDL +F + +D V + W+ D  W+    PQ    
Sbjct  882   HWNEAFSSLRIQDYKHFLRMWISPDTGDLHIFVIGIDHVARHWEADPYWDGRLLPQGSHV  941

Query  319   PSYVRKFPSKWRATS---------------------------LQQDPINTVRVVDHFVIE  221
             PS+    PSK+R  S                            +  P    ++VD+FVIE
Sbjct  942   PSWKWITPSKYRPKSDSKSKEDDLSFWARKVEQGLGPSPSDYRKPQPDGQPKLVDYFVIE  1001

Query  220   QTEK  209
              ++K
Sbjct  1002  ASKK  1005



>pir||T05132 hypothetical protein F7H19.190 - Arabidopsis thaliana
Length=443

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = -2

Query  379  VDKVPKEWKLDSNWETEPQ---QPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
            + +VPKEWKLD +W+ EP+   + S+ R+FPSKW AT+LQQDP+NTV++VD FVI ++EK
Sbjct  379  IPEVPKEWKLDKDWDAEPRSTVKMSHHRRFPSKWCATTLQQDPVNTVKIVDKFVIHRSEK  438

Query  208  SDSES  194
                S
Sbjct  439  ETGGS  443


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEV  653
            GLR RIE+WTFGLYPACIKYLMSAFD+PEV
Sbjct  353  GLRDRIEQWTFGLYPACIKYLMSAFDIPEV  382



>ref|XP_003875104.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ26609.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=1213

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 82/177 (46%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGM----DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M    +  SR   V+YY     ++W+  TP+VS V GS
Sbjct  1024  VLRCLDPFEMLAHLSEKVSSPEMGTFAEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGS  1083

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      FD  +S+ +I   K F RF ++    +L  + + +  VPK W  D+ +
Sbjct  1084  YLMCCVTLFDSLFDSTYSAFQIEECKHFLRFRLDAATRELHAYVIIMSHVPKSWSWDAAY  1143

Query  337   ETEPQQ------PSYVRKFPSKWRATS--------------LQQDPINTVRVVDHFV  227
             + E +       P ++R +PS+WR  S              L +D    V V++HFV
Sbjct  1144  QKELKSEMVRAAPPHLRAYPSRWRGKSFRTSARRDDGKHAGLDEDMEEGVEVLEHFV  1200



>ref|XP_010698662.1| hypothetical protein LPMP_204610 [Leishmania panamensis]
 gb|AIN97955.1| hypothetical protein LPMP_204610 [Leishmania panamensis]
Length=1212

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 83/177 (47%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   ++YY     ++W   TP+VS V GS
Sbjct  1023  ILRCLDPFEMLAYLSEKVSSPEMGTFAGDASRVDELLYYLYFVFFYWTLVTPLVSFVIGS  1082

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      +D A+S+ +I  YK F RF ++    +L  + +A+  VPK W  DS +
Sbjct  1083  YLMCCVTLFDCLYDAAYSAFQIEEYKHFVRFRLDVATRELHAYVVALRHVPKSWTWDSTY  1142

Query  337   ETEPQ------QPSYVRKFPSKW-----RATSLQQDPINT---------VRVVDHFV  227
             + E +       P ++R  PS+W     RATS   D             V +++HFV
Sbjct  1143  QAELKGDAVRAAPPHLRAHPSRWHGKHFRATSRCDDGKRAAFDEGVEEGVEILEHFV  1199



>ref|XP_003723012.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CBZ14538.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=1212

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 83/177 (47%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGMDSL----SRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M +     SR   ++YY     ++W   TP+VS V GS
Sbjct  1023  ILRCLDPFEMLAYLSEKVSSPEMGTFAGDASRVDELLYYLYFVFFYWTLVTPLVSFVIGS  1082

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      +D A+S+ +I  YK F RF ++    +L  + +A+  VPK W  DS +
Sbjct  1083  YLMCCVTLFDCLYDAAYSAFQIEEYKHFVRFRLDVATRELHAYVVALRHVPKSWTWDSTY  1142

Query  337   ETEPQ------QPSYVRKFPSKW-----RATSLQQDPINT---------VRVVDHFV  227
             + E +       P ++R  PS+W     RATS   D             V +++HFV
Sbjct  1143  QAELKGDAVRAAPPHLRAHPSRWHGKHFRATSRCDDGKRAAFDEGVEEGVEILEHFV  1199



>ref|XP_001682794.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CAJ03651.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=1213

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 83/177 (47%), Gaps = 25/177 (14%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGM----DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M    +  SR   V+YY     ++W+  TP+VS V GS
Sbjct  1024  VLRCLDPFEMLAYLSEKVSSPEMGTFTEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGS  1083

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      FD  +S+ +I  YK+F RF ++    +L  + + +  VPK W  D+ +
Sbjct  1084  YLMCCVTLFDSLFDATYSAFQIEEYKNFVRFRLDAATRELHAYVIIMSHVPKSWSWDAAY  1143

Query  337   ETEPQQ------PSYVRKFPSKW--------------RATSLQQDPINTVRVVDHFV  227
             + E +       P ++R +PS+W              + T L +     V +++HFV
Sbjct  1144  QKELRSEKMQAAPPHLRAYPSRWHGKRFRTSARCDDGKHTELDEGMEEEVEILEHFV  1200



>emb|CCC46388.1| conserved hypothetical protein, fragment [Trypanosoma vivax Y486]
Length=909

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 75/134 (56%), Gaps = 7/134 (5%)
 Frame = -2

Query  715  TFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVF  548
            +F +   C+  L+ + DV E +A   +++  N   + S    R    +YY  V L+FW+ 
Sbjct  709  SFMVNGGCV--LLRSMDVIENLAYLSRHVSTNVTGTFSPATDRLHVTLYYLHVLLFFWLL  766

Query  547  STPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDK  371
            +TPVVS V G +L++ +++    +D A+SS +I +YK F RF ++ +   L  + +A  +
Sbjct  767  ATPVVSFVIGVFLFVSVHFFDFLYDAAYSSFQIEDYKQFVRFKLDGESRSLHGYVVARTR  826

Query  370  VPKEWKLDSNWETE  329
            VPK WK DSN   E
Sbjct  827  VPKAWKRDSNHVME  840



>ref|XP_001465175.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CAM67422.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=1213

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 86/188 (46%), Gaps = 25/188 (13%)
 Frame = -2

Query  682   LMSAFDVPEVMAVTRQNICKNGM----DSLSRGGAVIYYTSVFLYFWVFSTPVVSLVFGS  515
             ++   D  E++A   + +    M    +  SR   V+YY     ++W+  TP+VS V GS
Sbjct  1024  VLRCLDPFEMLAYLSEKVSSPEMGTFTEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGS  1083

Query  514   YLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLDSNW  338
             YL  C+      FD  +S+ +I  YK F RF ++    +L  + + +  VPK W  D+ +
Sbjct  1084  YLMCCVTLFDSLFDATYSAFQIEEYKHFVRFRLDAATRELHAYVIIMSHVPKSWSWDAAY  1143

Query  337   ETEPQQ------PSYVRKFPSKWRA----TSLQQDP----------INTVRVVDHFVIEQ  218
             + E +       P ++R +PS+W      TS+++D              V +++HFV   
Sbjct  1144  QKELKSEKVRTAPPHLRAYPSRWHGKNFRTSVRRDDGKHAGYDEGMEEGVEILEHFVCAP  1203

Query  217   TEKSDSES  194
                  S S
Sbjct  1204  HRPPTSTS  1211



>emb|CBH08850.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=1118

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVFSTPVVS  530
             AC   L+ + D+ E +A    ++  N   +LS    R   V+YY  + L +W+ +TP++S
Sbjct  940   ACT--LLRSMDMIENLAYLSYHVGTNVTGTLSHTTNRVQVVLYYLHILLIYWLLATPLLS  997

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGD-LEVFTLAVDKVPKEWK  353
              + G +L++ +++  + +D ++SS +I +YK F RF ++ +   L  + +A   VPK W 
Sbjct  998   FIIGVFLFVSVHYFDLTYDASYSSFQIEDYKHFLRFCLDGRTRCLHAYVVAEKFVPKVWI  1057

Query  352   LDSNWETEPQQ------PSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
              D    TE +       P +++K PS+W    +      T  V++HFV+ 
Sbjct  1058  CDGRHVTECRDERTKHLPPHLKKHPSRWVPHGVSGTDY-TPTVLEHFVVR  1106



>ref|XP_001218808.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 emb|CAJ16040.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
Length=1118

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMDSLS----RGGAVIYYTSVFLYFWVFSTPVVS  530
             AC   L+ + D+ E +A    ++  N   +LS    R   V+YY  + L +W+ +TP++S
Sbjct  940   ACT--LLRSMDMIENLAYLSYHVGTNVTGTLSHTTNRVQVVLYYLHILLIYWLLATPLLS  997

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGD-LEVFTLAVDKVPKEWK  353
              + G +L++ +++  + +D ++SS +I +YK F RF ++ +   L  + +A   VPK W 
Sbjct  998   FIIGVFLFVSVHYFDLTYDASYSSFQIEDYKHFLRFCLDGRTRCLHAYVVAEKFVPKVWI  1057

Query  352   LDSNWETEPQQ------PSYVRKFPSKWRATSLQQDPINTVRVVDHFVIE  221
              D    TE +       P +++K PS+W    +      T  V++HFV+ 
Sbjct  1058  CDGRHVTECRDERTKHLPPHLKKHPSRWVPHGVSGTDY-TPTVLEHFVVR  1106



>gb|KHG23677.1| Phosphoenolpyruvate carboxylase [Gossypium arboreum]
Length=147

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 6/61 (10%)
 Frame = -2

Query  526  VFGSYLYICINWLH-----VHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPK  362
             FG YL  CI +L      + FDEAFSS RI +YKSFTR HIN  G LEVFTLAVDKVP+
Sbjct  88   TFGLYL-ACIKYLMSAFDVLEFDEAFSSFRITSYKSFTRLHINHDGYLEVFTLAVDKVPR  146

Query  361  E  359
            E
Sbjct  147  E  147



>ref|XP_005846358.1| hypothetical protein CHLNCDRAFT_135803, partial [Chlorella variabilis]
 gb|EFN54256.1| hypothetical protein CHLNCDRAFT_135803, partial [Chlorella variabilis]
Length=247

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -2

Query  496  NWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLDSNWET  332
            +  HVH+DEAFSSL++ ++K F RFHI   GDLE+F L +++ P  W+ D  W T
Sbjct  139  SLFHVHYDEAFSSLQVPHFKGFLRFHITRAGDLEMFALGLERSPHAWREDPRWRT  193



>ref|XP_009313637.1| hypothetical protein DQ04_07941000 [Trypanosoma grayi]
 gb|KEG08130.1| hypothetical protein DQ04_07941000 [Trypanosoma grayi]
Length=1079

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 71/131 (54%), Gaps = 10/131 (8%)
 Frame = -2

Query  544   TPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKV  368
             TP+VS + G +L++   +    +D AFSS +I +YK F RF I+ +  +L  + +A  +V
Sbjct  951   TPLVSFIIGVFLFVSFYFFGFMYDAAFSSFQIEDYKHFVRFRIDGQTRELHGYVVAEKRV  1010

Query  367   PKEWKLD-------SNWETEPQQPSYVRKFPSKWRATSLQQDPINTVRVVDHFVIEQTEK  209
             PK W  D       +N ET+P  P ++RK+PS+W+   +     +   V++HFV++    
Sbjct  1011  PKVWLRDTRHVAEFTNAETKP-LPPHLRKWPSRWQPVQVSGSE-SVPEVLEHFVVKPHRM  1068

Query  208   SDSESMNGSKT  176
                 S N S T
Sbjct  1069  PSHVSRNNSST  1079



>ref|XP_010698663.1| hypothetical protein LPMP_204620 [Leishmania panamensis]
 gb|AIN97956.1| hypothetical protein LPMP_204620 [Leishmania panamensis]
Length=1416

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 82/171 (48%), Gaps = 13/171 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMD----SLSRGGAVIYYTSVFLYFWVFSTPVVS  530
              C++ L+  FD  E ++     +    M     + SR   ++YYT V  ++WV  TP+VS
Sbjct  1229  GCLRVLLRCFDPFESLSFLSMTVSGGEMARFSATASRFQILLYYTYVLFFYWVLITPIVS  1288

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWK  353
             ++ G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K    ++
Sbjct  1289  VLIGTFLLFSVTTFDYMYNPTYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPATVYQ  1348

Query  352   LDSNW-------ETEPQQPSYVRKFPSKWRAT-SLQQDPINTVRVVDHFVI  224
             LD  +         E  +P +++  PS+W    S  Q   +   +++HF +
Sbjct  1349  LDRGYLWSLTGPGLEEHRPPHLKHHPSRWGPVPSDVQRKRHMTELLEHFTV  1399



>ref|XP_003723013.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CBZ14539.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=1415

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 82/171 (48%), Gaps = 13/171 (8%)
 Frame = -2

Query  697   ACIKYLMSAFDVPEVMAVTRQNICKNGMD----SLSRGGAVIYYTSVFLYFWVFSTPVVS  530
              C++ L+  FD  E ++     +    M     + SR   ++YYT V  ++WV  TP+VS
Sbjct  1228  GCLRVLLRCFDPFESLSFLSMTVSGGEMARFSATASRFQILLYYTYVLFFYWVLITPIVS  1287

Query  529   LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWK  353
             ++ G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K    ++
Sbjct  1288  VLIGTFLLFSVTTFDYMYNPTYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPATVYQ  1347

Query  352   LDSNW-------ETEPQQPSYVRKFPSKWRAT-SLQQDPINTVRVVDHFVI  224
             LD  +         E  +P +++  PS+W    S  Q   +   +++HF +
Sbjct  1348  LDRGYLWSLTGPGLEEHRPPHLKHHPSRWGPVPSDVQRKRHMTELLEHFTV  1398



>ref|XP_008877881.1| hypothetical protein, variant 26 [Aphanomyces invadans]
 gb|ETV93564.1| hypothetical protein, variant 26 [Aphanomyces invadans]
Length=892

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWV  551
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV
Sbjct  824  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWV  875



>ref|XP_008877889.1| hypothetical protein, variant 34 [Aphanomyces invadans]
 ref|XP_008877890.1| hypothetical protein, variant 35 [Aphanomyces invadans]
 ref|XP_008877891.1| hypothetical protein, variant 36 [Aphanomyces invadans]
 gb|ETV93572.1| hypothetical protein, variant 34 [Aphanomyces invadans]
 gb|ETV93573.1| hypothetical protein, variant 35 [Aphanomyces invadans]
 gb|ETV93574.1| hypothetical protein, variant 36 [Aphanomyces invadans]
Length=847

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWV  551
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV
Sbjct  779  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWV  830



>ref|XP_008877905.1| hypothetical protein, variant 21 [Aphanomyces invadans]
 ref|XP_008877906.1| hypothetical protein, variant 22 [Aphanomyces invadans]
 ref|XP_008877907.1| hypothetical protein, variant 23 [Aphanomyces invadans]
 ref|XP_008877909.1| hypothetical protein, variant 20 [Aphanomyces invadans]
 gb|ETV93558.1| hypothetical protein, variant 20 [Aphanomyces invadans]
 gb|ETV93559.1| hypothetical protein, variant 21 [Aphanomyces invadans]
 gb|ETV93560.1| hypothetical protein, variant 22 [Aphanomyces invadans]
 gb|ETV93561.1| hypothetical protein, variant 23 [Aphanomyces invadans]
Length=903

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  706  LYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFWV  551
            LY  C+KY+++ FDVP+ +AV R +IC+ G DSL+R   + YY SVFLYFWV
Sbjct  835  LYSTCVKYILTIFDVPQAVAVYRTDICQAGFDSLTRSEVLAYYCSVFLYFWV  886



>emb|CCW59812.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=1281

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (46%), Gaps = 5/144 (3%)
 Frame = -2

Query  691   IKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGA----VIYYTSVFLYFWVFSTPVVSLV  524
             I  ++ A D  E +A     I  + +     G        YY  +  ++W+F TP+VS +
Sbjct  1095  ICVMVRALDPLETLAHYMLKIQSSEIGKFKAGATHREIASYYMHILSFYWIFVTPIVSFI  1154

Query  523   FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLD  347
              G +L + +      +D  +S+ +I ++K F RF I+ +  +L  + LA  KVPK W+LD
Sbjct  1155  IGCFLLVSVTMFDYMYDSTYSAFQIEDFKHFVRFRIDAETRELHGYVLAKKKVPKVWELD  1214

Query  346   SNWETEPQQPSYVRKFPSKWRATS  275
                  +   P      P  W+  S
Sbjct  1215  PRHVDQFDDPKTKHTVPHLWQYPS  1238



>ref|WP_015353193.1| hypothetical protein [Myxococcus stipitatus]
 ref|YP_007364624.1| hypothetical protein MYSTI_07668 [Myxococcus stipitatus DSM 14675]
 gb|AGC48940.1| hypothetical protein MYSTI_07668 [Myxococcus stipitatus DSM 14675]
Length=611

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -2

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            V G YL++ +N    H +EAF SL + ++K+F R HIN KG L V+ + +++VP++WK  
Sbjct  524  VMGLYLWLSVNLFGAHSNEAFISLALPDWKNFLRLHINAKGQLTVYPVGIERVPRKWK--  581

Query  346  SNWETEPQQPSY  311
                  PQ P+Y
Sbjct  582  -RTHAGPQAPAY  592



>ref|XP_003875105.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ26610.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=1397

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = -2

Query  691   IKYLMSAFDVPEVMAVTRQNICKNGMD----SLSRGGAVIYYTSVFLYFWVFSTPVVSLV  524
             ++ L+  FD  E ++     +    +     + SR   ++YY  V  ++WV  TP+VS++
Sbjct  1212  LRVLLRCFDPFESLSFLSMTVSGGEVARFSATASRLQILLYYVYVLFFYWVLITPIVSVL  1271

Query  523   FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLD  347
              G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K  K ++LD
Sbjct  1272  IGTFLLFSVTTFDYMYNPTYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPSKVYQLD  1331

Query  346   SNWE-------TEPQQPSYVRKFPSKWR---ATSLQQDPINTVRVVDHFVI--EQTEKSD  203
               +         E  +P ++++ PS+W    + +  + P+    V++HF +   +T +  
Sbjct  1332  RGYLWSLTSPCLEEHRPPHLKQHPSRWEPVLSDARCKRPMT--EVLEHFTVHPHRTPQRT  1389

Query  202   SESMNGSK  179
              + M  S+
Sbjct  1390  KQPMTDSE  1397



>gb|KDO84271.1| hypothetical protein CISIN_1g0017372mg, partial [Citrus sinensis]
Length=340

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 6/67 (9%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFL  563
            GLRARIE+WTFGLYPACIKYLMSAFD+PE      Q + +    ++SRG + I    + L
Sbjct  266  GLRARIEQWTFGLYPACIKYLMSAFDIPE------QYLQEWNAVTISRGSSHILCFCLSL  319

Query  562  YFWVFST  542
            +  + +T
Sbjct  320  FLGLLNT  326



>ref|XP_001682795.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CAJ03655.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=1399

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 84/172 (49%), Gaps = 17/172 (10%)
 Frame = -2

Query  691   IKYLMSAFDVPEVMAVTRQNICKNGMDSLSRGGA----VIYYTSVFLYFWVFSTPVVSLV  524
             ++ L+  FD  E ++     +    +   S   +    ++YY  V  ++WV  TP+VS++
Sbjct  1214  LRVLLRCFDPFESLSFLSMTVSGGEVACFSANASRLQILLYYVYVLFFYWVLITPIVSVL  1273

Query  523   FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKG-DLEVFTLAVDKVPKEWKLD  347
              G++L   +      ++  +S+ ++  YK F RF ++    +L  + +AV K  K ++LD
Sbjct  1274  IGTFLLFSVTTFDYMYNATYSAFQMEEYKHFVRFRLDAATRELHAYVVAVQKPSKVYQLD  1333

Query  346   SNW-------ETEPQQPSYVRKFPSKWR---ATSLQQDPINTVRVVDHFVIE  221
               +         E  +P ++++ PS+W    + + ++ P+    V++HF + 
Sbjct  1334  RGYLWSLTSPGLEEHRPPHLKQHPSRWGPVLSDARRKRPMT--EVLEHFTVH  1383



>ref|XP_001465174.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CAM67421.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=1398

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 72/139 (52%), Gaps = 13/139 (9%)
 Frame = -2

Query  604   SRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTR  425
             SR   ++YY  V  ++WV  TP+VS++ G++L   +      ++  +S+ ++  YK F R
Sbjct  1246  SRLQILLYYVYVLFFYWVLITPIVSVLIGTFLLFSVTTFDYMYNATYSAFQMEEYKHFVR  1305

Query  424   FHINTKG-DLEVFTLAVDKVPKEWKLDSNW-------ETEPQQPSYVRKFPSKWR---AT  278
             F ++    +L  + +AV K  K ++LD  +         E  +P ++++ PS+W    + 
Sbjct  1306  FRLDAATRELHAYVVAVQKPSKVYQLDRGYLWSLTSPGLEEHRPPHLKQHPSRWGPVLSD  1365

Query  277   SLQQDPINTVRVVDHFVIE  221
             +  + P+    V++HF + 
Sbjct  1366  ARCKRPMT--EVLEHFTVR  1382



>gb|KJB58440.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=859

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPE  656
            GLRAR+E+WTFGLYPACIKYLMSAFDVPE
Sbjct  829  GLRARMEQWTFGLYPACIKYLMSAFDVPE  857



>gb|KCW86237.1| hypothetical protein EUGRSUZ_B02922 [Eucalyptus grandis]
Length=545

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  742  GLRARIERWTFGLYPACIKYLMSAFDVPEV  653
            GLR+RIE+WT GLYPACIKYLMSAFDVPEV
Sbjct  513  GLRSRIEQWTLGLYPACIKYLMSAFDVPEV  542



>gb|KFE61079.1| hypothetical protein DB31_4514 [Hyalangium minutum]
Length=570

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (48%), Gaps = 21/143 (15%)
 Frame = -2

Query  721  RWTFGLYPACIKYLMSAF----DVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFW  554
            RW  G+    + +L +AF     V  +M  T         D LS   AV+ +   FL   
Sbjct  425  RWLAGVLHG-LAHLTAAFLLAWGVSHLMGSTELPFGSVERDLLS---AVLIFAGGFL---  477

Query  553  VFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVD  374
              + P V    G YL + +N   VH +EAFSSL I ++K+F R HI+  G L ++ + + 
Sbjct  478  --AGPTV---MGLYLLVSLNVFGVHANEAFSSLAIPDWKNFIRLHIDKAGHLRLYPIGLR  532

Query  373  KVPKEWK-----LDSNWETEPQQ  320
            +VP+ WK      D  W  +P+ 
Sbjct  533  RVPRSWKPGELARDPAWVADPKD  555



>ref|WP_044198433.1| hypothetical protein [Hyalangium minutum]
Length=544

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (48%), Gaps = 21/143 (15%)
 Frame = -2

Query  721  RWTFGLYPACIKYLMSAF----DVPEVMAVTRQNICKNGMDSLSRGGAVIYYTSVFLYFW  554
            RW  G+    + +L +AF     V  +M  T         D LS   AV+ +   FL   
Sbjct  399  RWLAGVLHG-LAHLTAAFLLAWGVSHLMGSTELPFGSVERDLLS---AVLIFAGGFL---  451

Query  553  VFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVD  374
              + P V    G YL + +N   VH +EAFSSL I ++K+F R HI+  G L ++ + + 
Sbjct  452  --AGPTV---MGLYLLVSLNVFGVHANEAFSSLAIPDWKNFIRLHIDKAGHLRLYPIGLR  506

Query  373  KVPKEWK-----LDSNWETEPQQ  320
            +VP+ WK      D  W  +P+ 
Sbjct  507  RVPRSWKPGELARDPAWVADPKD  529



>ref|WP_012235264.1| calcineurin-like phosphoesterase [Sorangium cellulosum]
 ref|YP_001613271.1| calcineurin-like phosphoesterase [Sorangium cellulosum So ce56]
 emb|CAN92791.1| Calcineurin-like phosphoesterase family protein [Sorangium cellulosum 
So ce56]
Length=591

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = -2

Query  574  SVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLE  395
             V L+       V S + G YL I +N    H +EAFS+LRI +YK+F R H++  G L 
Sbjct  442  GVTLFVGATGAVVGSTIMGVYLLISLNVARRHGNEAFSALRIQDYKNFLRIHVHRDG-LT  500

Query  394  VFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWR-ATSLQQDPIN  254
            ++ + + KVP+ WK+  +   +P +P ++   P++   A  L ++PI 
Sbjct  501  LYPVGLRKVPRAWKVADD--HKPGEPRFI---PARGALAPELIEEPIT  543



>ref|WP_044198580.1| hypothetical protein [Hyalangium minutum]
 gb|KFE60994.1| hypothetical protein DB31_4618 [Hyalangium minutum]
Length=561

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 6/104 (6%)
 Frame = -2

Query  607  LSRGGAVIYYTSVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFT  428
            L + G  +  T +   F  F  P V+   G YL++ +N    H++EAF +L I ++K+F 
Sbjct  449  LHQAGKFLMDTVLTFAFGFFVGPFVT---GFYLWVSVNGFLAHYNEAFGALAIPDWKNFL  505

Query  427  RFHINTKGDLEVFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFP  296
            R  I+  G L VF + V++VP++WK        P  P+Y    P
Sbjct  506  RLRIDPDGSLTVFPVGVERVPRKWK---KTHAGPYAPAYESDDP  546



>ref|WP_043410718.1| hypothetical protein [Cystobacter violaceus]
 gb|KFA87891.1| hypothetical protein Q664_44715 [Cystobacter violaceus Cb vi76]
Length=571

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 8/93 (9%)
 Frame = -2

Query  526  VFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKLD  347
            + G YL + +N    H +EAF SL IA++K+F R  I+  G+L VF + +++VP++WK  
Sbjct  477  IMGLYLMVSVNGFRAHSNEAFISLAIADFKNFLRLRIDKDGELTVFPVGLERVPRQWK--  534

Query  346  SNWETEPQQPSYVRKFPSKWRAT--SLQQDPIN  254
                  P  P+Y    P   RAT   L + PI 
Sbjct  535  -ETHAGPYAPAYE---PDDPRATPPELIEPPIR  563



>ref|WP_020735096.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008149568.1| hypothetical protein SCE1572_15735 [Sorangium cellulosum So0157-2]
 gb|AGP35827.1| hypothetical protein SCE1572_15735 [Sorangium cellulosum So0157-2]
Length=589

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  574  SVFLYFWVFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLE  395
             V L+  V    V S + G YL I +N    H +EAFS+L+I +YK+F R H++ +G L 
Sbjct  440  GVTLFVGVTGAVVGSTLMGIYLLISLNVARRHGNEAFSALQIEDYKNFLRIHVHREG-LT  498

Query  394  VFTLAVDKVPKEWKLDSNWETEPQQPSYVRKFPSKWR-ATSLQQDPINTVRVV  239
            ++ + +  VP+ WK+      E ++P   R  P     A  L ++P+ T+R+ 
Sbjct  499  IYPVGLRNVPRAWKV-----AEDRRPGEPRLVPQDGALAPELIEEPV-TIRIA  545



>ref|WP_028446622.1| hypothetical protein [Chitinimonas koreensis]
Length=627

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = -2

Query  553  VFSTPVVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVD  374
             F T V  L+FG+Y + C++WL    + AFS +    YK F RF I+  G+L  + L  D
Sbjct  529  AFGTLVGGLLFGTY-FACMSWLGCLGNNAFSPVAYQGYKGFLRFRIDRDGNLHGYMLGTD  587

Query  373  KVPKEWKLDSNWETEPQQPSYVRK  302
             VP+ W+L  N +   ++P +V +
Sbjct  588  SVPRRWRL--NPDPRARRPVWVER  609



>gb|AFE05765.1| hypothetical protein COCOR_04316 [Corallococcus coralloides DSM 
2259]
Length=606

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -2

Query  529  LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKL  350
            LV G YL + +N    H +EAFSSL I ++K+F R H +  G+L V+ +   +VP+ WK 
Sbjct  486  LVVGVYLLLSLNVFSCHPNEAFSSLSIPDWKNFLRLHFDEDGELTVYPVGFRRVPRRWKR  545

Query  349  DSNWETEPQQPSYVRKFPSKWRAT  278
                   P++P +V   P+  RAT
Sbjct  546  GRG----PEEPVWVPD-PTDTRAT  564



>ref|WP_043323473.1| hypothetical protein, partial [Corallococcus coralloides]
Length=546

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -2

Query  529  LVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKEWKL  350
            LV G YL + +N    H +EAFSSL I ++K+F R H +  G+L V+ +   +VP+ WK 
Sbjct  457  LVVGVYLLLSLNVFSCHPNEAFSSLSIPDWKNFLRLHFDEDGELTVYPVGFRRVPRRWKR  516

Query  349  DSNWETEPQQPSYVRKFPSKWRAT  278
                   P++P +V   P+  RAT
Sbjct  517  GRG----PEEPVWVPD-PTDTRAT  535



>ref|WP_006609975.1| hypothetical protein [Bradyrhizobium sp. ORS 285]
 emb|CCD84635.1| conserved membrane hypothetical protein [Bradyrhizobium sp. ORS 
285]
Length=612

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -2

Query  523  FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPK--EWKL  350
            FG  + I   WL ++ ++AFS+LRI +Y +F R  I    D++V  + +D+VP+  EW+ 
Sbjct  513  FGLNMLITCRWLRMNRNDAFSALRIGHYNNFLRLRIEGD-DVKVHAIGLDRVPERHEWRD  571

Query  349  DSNW-ETEPQQPSYVRKFP  296
            +S + E +PQQP +V   P
Sbjct  572  NSQYREGQPQQPRFVPAAP  590



>ref|WP_009027423.1| hypothetical protein [Bradyrhizobium sp. ORS 375]
 emb|CCD92439.1| conserved membrane hypothetical protein [Bradyrhizobium sp. ORS 
375]
Length=615

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 4/79 (5%)
 Frame = -2

Query  523  FGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPK--EWKL  350
            FG  + I   WL ++ ++AFS+LRI +Y +F R  I    D++V  + +DKVP+  EW+ 
Sbjct  513  FGLNMLITCRWLRMNRNDAFSALRIGHYNNFLRLRIEGD-DVQVHAIGLDKVPQRHEWQE  571

Query  349  DSNW-ETEPQQPSYVRKFP  296
            +  + E +PQQP +V   P
Sbjct  572  NPKYREGQPQQPRFVPAAP  590



>gb|AHG91819.1| hypothetical protein J421_4282 [Gemmatimonadetes bacterium KBS708]
Length=585

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 7/96 (7%)
 Frame = -2

Query  538  VVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKE  359
            V S++ G YL I +N  H H  EAFSS+RI +YKS+ R  +   G L ++ + + +V ++
Sbjct  471  VGSVIMGLYLLISLNLFHRHNTEAFSSMRIEDYKSWLRLQVTPDGALRIYPIKLHRVARK  530

Query  358  WKLDSNWETEPQQPSYVRKFPSKWRATS--LQQDPI  257
            W+       EP+  +     P    AT+  L + PI
Sbjct  531  WR-----PAEPRDATPSLLVPDDPHATAPELIESPI  561



>ref|WP_002615021.1| hypothetical protein [Stigmatella aurantiaca]
 gb|EAU65670.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gb|ADO68502.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
Length=591

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = -2

Query  538  VVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKE  359
            V   V G Y ++ +N    H +EAF +L +A+YK+F R  I+  G L ++ + V++VP+ 
Sbjct  483  VGPFVSGLYFWVSVNGFLAHSNEAFGALAVADYKNFLRLRISQDGCLTIYPVGVERVPRH  542

Query  358  WKLDSNWETEPQQPSYVRKFPSKWRATSLQQDPI  257
            WK        P  P+Y    P       L ++PI
Sbjct  543  WK---ETHAGPASPAYAPDDPDA-TEPRLIEEPI  572



>gb|EPX59759.1| hypothetical protein D187_002503 [Cystobacter fuscus DSM 2262]
Length=622

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -2

Query  538  VVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKE  359
            V   V G YL + +N    H +EAF SL I ++K+F R  I+ +G L VF + +++VP++
Sbjct  524  VGPFVMGLYLTVSLNRFGAHSNEAFISLAIPDWKNFLRLRIDPEGQLTVFPVGLERVPRK  583

Query  358  WK  353
            WK
Sbjct  584  WK  585



>ref|WP_043431616.1| hypothetical protein [Cystobacter fuscus]
Length=587

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -2

Query  538  VVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKE  359
            V   V G YL + +N    H +EAF SL I ++K+F R  I+ +G L VF + +++VP++
Sbjct  489  VGPFVMGLYLTVSLNRFGAHSNEAFISLAIPDWKNFLRLRIDPEGQLTVFPVGLERVPRK  548

Query  358  WK  353
            WK
Sbjct  549  WK  550



>ref|WP_035319266.1| hypothetical protein [Brevibacillus laterosporus]
Length=610

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = -2

Query  538  VVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKE  359
            + S + G YLYI +N    H +EAFSSL++ ++K+F R HI+ +G+L ++ + ++K+   
Sbjct  508  IGSSIMGLYLYISLNVFGRHSNEAFSSLKVEDWKNFLRIHIDKEGNLTIYPIGLEKIVTH  567

Query  358  WKLDSNWETEPQQPSYVRKFPSKWRAT-SLQQDPI  257
            W      +T P     V K+P   +A   L + PI
Sbjct  568  WNPAPLTDTGPLLEPDV-KYPEIRKAVPKLIESPI  601



>emb|CCF16816.1| calcineurin-like phosphoesterase family protein [Brevibacillus 
laterosporus GI-9]
Length=630

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = -2

Query  538  VVSLVFGSYLYICINWLHVHFDEAFSSLRIANYKSFTRFHINTKGDLEVFTLAVDKVPKE  359
            + S + G YLYI +N    H +EAFSSL++ ++K+F R HI+ +G+L ++ + ++K+   
Sbjct  528  IGSSIMGLYLYISLNVFGRHSNEAFSSLKVEDWKNFLRIHIDKEGNLTIYPIGLEKIVTH  587

Query  358  WKLDSNWETEPQQPSYVRKFPSKWRAT-SLQQDPI  257
            W      +T P     V K+P   +A   L + PI
Sbjct  588  WNPAPLTDTGPLLEPDV-KYPEIRKAVPKLIESPI  621



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210