BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018M04

Length=659
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   348   3e-117   Nicotiana tomentosiformis
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         345   2e-116   Jatropha curcas
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  345   4e-116   Nicotiana tabacum [American tobacco]
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   344   7e-116   Nicotiana tomentosiformis
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             344   8e-116   Citrus clementina [clementine]
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  344   1e-115   Nicotiana tabacum [American tobacco]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   343   1e-115   Nicotiana sylvestris
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   343   2e-115   Citrus sinensis [apfelsine]
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               343   2e-115   Eucalyptus grandis [rose gum]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            342   4e-115   Juglans regia
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   341   5e-115   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              342   6e-115   Solanum lycopersicum
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   342   6e-115   Citrus sinensis [apfelsine]
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         341   1e-114   Ricinus communis
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   339   2e-114   
gb|ACX37450.1|  plasma membrane intrinsic protein                       340   2e-114   Hevea brasiliensis [jebe]
gb|AAO39007.1|  plasma intrinsic protein 2,1                            340   3e-114   Juglans regia
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         340   4e-114   Jatropha curcas
gb|ACU87558.1|  PIP protein                                             339   5e-114   Gossypium hirsutum [American cotton]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             339   5e-114   Populus trichocarpa [western balsam poplar]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   339   8e-114   Nicotiana tomentosiformis
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        339   8e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                338   1e-113   Populus trichocarpa x Populus deltoides
gb|KJB26182.1|  hypothetical protein B456_004G229000                    338   1e-113   Gossypium raimondii
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   338   1e-113   Sesamum indicum [beniseed]
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               338   1e-113   Eucalyptus grandis [rose gum]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             338   2e-113   Populus tremula x Populus tremuloides
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        338   2e-113   Cucumis melo [Oriental melon]
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   337   2e-113   Eucalyptus grandis [rose gum]
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        338   2e-113   Malus domestica [apple tree]
gb|AEQ29857.1|  aquaporin PIP2                                          337   3e-113   Malus prunifolia
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                337   3e-113   Theobroma cacao [chocolate]
gb|AAW80918.1|  putative plasma membrane intrinsic protein              337   3e-113   Astragalus membranaceus
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   337   3e-113   Populus euphratica
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        337   3e-113   Solanum tuberosum [potatoes]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   337   3e-113   Populus euphratica
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   337   4e-113   Nicotiana sylvestris
gb|KHG08488.1|  putative aquaporin PIP2-2                               337   4e-113   Gossypium arboreum [tree cotton]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    337   4e-113   Gossypium raimondii
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             337   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        337   5e-113   Solanum tuberosum [potatoes]
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   337   6e-113   Eucalyptus grandis [rose gum]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         336   8e-113   Ricinus communis
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               336   9e-113   Eucalyptus grandis [rose gum]
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   336   9e-113   Populus euphratica
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                336   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   336   1e-112   Tarenaya hassleriana [spider flower]
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   336   1e-112   Eucalyptus grandis [rose gum]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              336   1e-112   Cucumis sativus [cucumbers]
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   335   1e-112   
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   336   1e-112   Phoenix dactylifera
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        335   2e-112   Phoenix dactylifera
gb|AEQ20672.1|  PIP2;1                                                  335   2e-112   Karelinia caspia
emb|CDP06739.1|  unnamed protein product                                335   2e-112   Coffea canephora [robusta coffee]
gb|KHG00060.1|  putative aquaporin PIP2-2                               335   2e-112   Gossypium arboreum [tree cotton]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             335   2e-112   Phaseolus vulgaris [French bean]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   335   2e-112   Phoenix dactylifera
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     335   2e-112   Lilium hybrid cultivar
gb|KJB56128.1|  hypothetical protein B456_009G107200                    335   2e-112   Gossypium raimondii
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              335   2e-112   
gb|EAY86778.1|  hypothetical protein OsI_08158                          335   3e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             335   3e-112   Phaseolus vulgaris [French bean]
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               335   4e-112   Camelina sativa [gold-of-pleasure]
gb|AAB18227.1|  MipC                                                    334   5e-112   Mesembryanthemum crystallinum
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               334   5e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             334   5e-112   Populus trichocarpa [western balsam poplar]
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   334   5e-112   Citrus sinensis [apfelsine]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             334   5e-112   Citrus clementina [clementine]
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             334   7e-112   Phaseolus vulgaris [French bean]
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             334   7e-112   Citrus clementina [clementine]
ref|NP_001047491.1|  Os02g0629200                                       334   9e-112   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     336   9e-112   Eucalyptus grandis [rose gum]
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        334   9e-112   Citrus sinensis [apfelsine]
gb|ACG33001.1|  aquaporin PIP2.2                                        333   1e-111   Zea mays [maize]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               333   1e-111   Camelina sativa [gold-of-pleasure]
gb|AAF65845.1|AF255795_1  aquaporin 1                                   333   2e-111   Allium cepa
gb|ABB88840.1|  aquaporin                                               333   2e-111   Stevia rebaudiana
ref|NP_001105026.1|  aquaporin PIP2-4                                   333   2e-111   Zea mays [maize]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               333   2e-111   Populus euphratica
gb|AIA83106.1|  putative aquaporin PIP2                                 333   2e-111   Citrus trifoliata [hardy orange]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          333   2e-111   Sorghum bicolor [broomcorn]
ref|NP_001105025.1|  aquaporin PIP2-3                                   333   3e-111   Zea mays [maize]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  332   3e-111   Pyrus communis
gb|KHG29841.1|  putative aquaporin PIP2-2                               332   3e-111   Gossypium arboreum [tree cotton]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   332   3e-111   Glycine max [soybeans]
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        332   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          332   4e-111   Sorghum bicolor [broomcorn]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               332   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIA83104.1|  putative aquaporin PIP2                                 332   4e-111   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               332   4e-111   Pyrus x bretschneideri [bai li]
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          332   4e-111   Gossypium arboreum [tree cotton]
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        332   4e-111   Cucumis melo [Oriental melon]
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        332   5e-111   Brachypodium distachyon [annual false brome]
dbj|BAG68661.1|  plasma membrane intrinsic protein                      332   5e-111   Tulipa gesneriana
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    332   5e-111   
gb|KJB20285.1|  hypothetical protein B456_003G141600                    333   5e-111   Gossypium raimondii
emb|CDY31523.1|  BnaA10g13480D                                          331   5e-111   Brassica napus [oilseed rape]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             332   5e-111   Citrus clementina [clementine]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             332   5e-111   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   332   6e-111   Medicago truncatula
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   331   6e-111   Solanum tuberosum [potatoes]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           331   7e-111   Raphanus sativus
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             331   7e-111   Eutrema salsugineum [saltwater cress]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               331   8e-111   Populus euphratica
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   332   8e-111   Setaria italica
gb|AFK33316.1|  unknown                                                 331   8e-111   Medicago truncatula
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               331   8e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          331   8e-111   Gossypium arboreum [tree cotton]
gb|KHN32779.1|  Aquaporin PIP2-2                                        329   1e-110   Glycine soja [wild soybean]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               331   1e-110   Elaeis guineensis
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               331   1e-110   Prunus mume [ume]
emb|CDX91340.1|  BnaC04g08100D                                          331   1e-110   
gb|ABK60195.2|  PIP2 protein                                            331   1e-110   Gossypium hirsutum [American cotton]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   331   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               330   1e-110   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   330   1e-110   Glycine max [soybeans]
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   330   1e-110   Brassica rapa
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        330   2e-110   Brassica rapa
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   330   2e-110   Nelumbo nucifera [Indian lotus]
gb|ACZ06859.1|  plasma membrane intrinsic protein                       330   2e-110   Glycine soja [wild soybean]
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               330   2e-110   Populus euphratica
gb|AIG92831.1|  aquaporin PIP2                                          330   2e-110   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    330   2e-110   Brassica rapa
gb|ABU94631.1|  putative aquaporin PIP2;3                               330   2e-110   Phaseolus vulgaris [French bean]
gb|AAV69744.1|  aquaporin                                               330   2e-110   Vitis vinifera
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           330   2e-110   Raphanus sativus
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  332   2e-110   Citrus sinensis [apfelsine]
gb|ABH09326.1|  putative aquaporin                                      330   3e-110   Vitis vinifera
ref|XP_010107541.1|  Aquaporin PIP2-2                                   330   3e-110   Morus notabilis
emb|CAN75442.1|  hypothetical protein VITISV_019657                     330   3e-110   Vitis vinifera
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   330   3e-110   Elaeis guineensis
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   330   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   330   3e-110   Brassica rapa
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   330   3e-110   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    330   4e-110   Arabis alpina [alpine rockcress]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                330   4e-110   Erythranthe guttata [common monkey flower]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   329   4e-110   Morus notabilis
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             330   4e-110   Prunus persica
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     330   4e-110   Vitis cinerea var. helleri x Vitis rupestris
gb|ACU20229.1|  unknown                                                 330   4e-110   Glycine max [soybeans]
emb|CDY46759.1|  BnaA03g17030D                                          330   4e-110   Brassica napus [oilseed rape]
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         330   4e-110   Jatropha curcas
dbj|BAG06231.1|  plasma membrane intrinsic protein                      330   4e-110   Hordeum vulgare [barley]
gb|AAC17529.1|  aquaporin 2                                             330   4e-110   Samanea saman [cow-tamarind]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   329   4e-110   Camelina sativa [gold-of-pleasure]
emb|CDX10333.1|  aquaporin                                              330   4e-110   Coffea arabica [arabica coffee]
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             329   4e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        329   5e-110   Brachypodium distachyon [annual false brome]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   329   5e-110   Glycine max [soybeans]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         329   5e-110   Ricinus communis
gb|KHN00691.1|  Aquaporin PIP2-2                                        329   5e-110   Glycine soja [wild soybean]
gb|ACJ85211.1|  unknown                                                 328   6e-110   Medicago truncatula
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               329   6e-110   Brassica rapa
gb|AFH36337.1|  aquaporin PIP2;2                                        329   6e-110   Quercus petraea [durmast oak]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               329   6e-110   Glycine max [soybeans]
gb|AEY75244.1|  plasma membrane intrinsic protein                       329   6e-110   Malus hupehensis
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         328   7e-110   Helianthemum almeriense
ref|NP_001274308.1|  aquaporin PIP2-1-like                              328   7e-110   Solanum lycopersicum
gb|AIK66515.1|  putative aquaporin                                      329   7e-110   Vitis vinifera
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   329   7e-110   Gossypium raimondii
gb|ACU24483.1|  unknown                                                 328   8e-110   Glycine max [soybeans]
ref|NP_200874.1|  putative aquaporin PIP2-4                             329   8e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AEO13898.1|  aquaporin 7                                             328   9e-110   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001267922.1|  aquaporin-like                                     328   9e-110   Vitis vinifera
gb|AHB33479.1|  plasma intrinsic protein 2-3                            328   9e-110   Cucumis sativus [cucumbers]
ref|NP_001105616.1|  aquaporin PIP2-5                                   328   1e-109   Zea mays [maize]
emb|CDX71032.1|  BnaC03g11160D                                          327   1e-109   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             328   1e-109   Eutrema salsugineum [saltwater cress]
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        328   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   328   1e-109   Camelina sativa [gold-of-pleasure]
gb|AEC45513.1|  plasma membrane intrinsic protein                       328   1e-109   Hevea brasiliensis [jebe]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          328   2e-109   Amborella trichopoda
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             328   2e-109   Elaeis guineensis
emb|CDX88767.1|  BnaA03g08820D                                          327   2e-109   
gb|ADG03686.1|  aquaporin                                               328   2e-109   Hordeum vulgare [barley]
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               328   2e-109   Brachypodium distachyon [annual false brome]
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             327   3e-109   Eutrema salsugineum [saltwater cress]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        327   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   327   3e-109   Tarenaya hassleriana [spider flower]
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   327   3e-109   Fragaria vesca subsp. vesca
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   327   3e-109   Setaria italica
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         327   3e-109   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  327   3e-109   Mimosa pudica [sensitive-plant]
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          327   3e-109   Sorghum bicolor [broomcorn]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             327   4e-109   Capsella rubella
gb|ABK93567.1|  unknown                                                 327   4e-109   Populus trichocarpa [western balsam poplar]
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             327   4e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             327   4e-109   Prunus persica
ref|NP_181254.1|  aquaporin PIP2-2                                      327   4e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               327   4e-109   Brassica rapa
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               327   5e-109   Pyrus x bretschneideri [bai li]
ref|XP_002316367.1|  putative aquaporin family protein                  327   5e-109   Populus trichocarpa [western balsam poplar]
gb|AEY75242.1|  plasma membrane intrinsic protein                       327   6e-109   Malus hupehensis
dbj|BAE02729.1|  PIP aquaporin                                          327   6e-109   Hordeum vulgare [barley]
dbj|BAA23744.1|  HvPIP2;1                                               327   6e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   327   6e-109   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   326   7e-109   Camelina sativa [gold-of-pleasure]
emb|CDX91341.1|  BnaC04g08090D                                          326   9e-109   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        326   9e-109   Petunia x hybrida [garden petunia]
gb|AAV80229.1|  aquaporin 2                                             326   9e-109   Aegiceras corniculatum
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        326   1e-108   Pyrus x bretschneideri [bai li]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   326   1e-108   Fragaria vesca subsp. vesca
ref|NP_001268056.1|  aquaporin PIP2                                     325   1e-108   Vitis vinifera
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                325   1e-108   Hevea brasiliensis [jebe]
gb|ABO69705.2|  aquaporin PIP2                                          325   2e-108   Prunus humilis
gb|ACG32567.1|  aquaporin PIP2.1                                        325   2e-108   Zea mays [maize]
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  325   2e-108   Pyrus communis
gb|ABC69040.1|  aquaporin PIP2-1                                        325   2e-108   Rhododendron catawbiense [Catawba rosebay]
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       325   2e-108   Raphanus sativus
dbj|BAF33069.1|  aquaporin                                              325   2e-108   Hordeum vulgare [barley]
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          325   2e-108   Amborella trichopoda
gb|KHN38765.1|  Aquaporin PIP2-7                                        325   2e-108   Glycine soja [wild soybean]
ref|NP_001280185.1|  aquaporin PIP2-2                                   325   2e-108   Prunus mume [ume]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   325   2e-108   Setaria italica
gb|AAD31846.1|AF133530_1  water channel protein MipH                    325   2e-108   Mesembryanthemum crystallinum
emb|CDY56697.1|  BnaCnng31040D                                          325   3e-108   Brassica napus [oilseed rape]
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               325   3e-108   Sesamum indicum [beniseed]
dbj|BAE06148.1|  PIP aquaporin isoform                                  325   3e-108   Hordeum vulgare [barley]
dbj|BAF32042.1|  putative aquaporin                                     324   3e-108   Cryptomeria japonica
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   325   3e-108   Nicotiana tomentosiformis
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        325   3e-108   Brassica rapa
ref|NP_001105024.1|  aquaporin PIP2-1                                   325   3e-108   Zea mays [maize]
gb|EMS51072.1|  Aquaporin PIP2-5                                        325   3e-108   Triticum urartu
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    325   4e-108   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          325   4e-108   Oryza brachyantha
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        324   4e-108   Eucalyptus grandis [rose gum]
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              324   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    324   4e-108   Pyrus x bretschneideri [bai li]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   324   4e-108   Nicotiana sylvestris
gb|ADJ67992.1|  aquaporin                                               324   5e-108   Fragaria x ananassa
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             324   6e-108   Capsella rubella
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        324   6e-108   Glycine max [soybeans]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               324   6e-108   
emb|CDY09192.1|  BnaA02g06180D                                          323   7e-108   Brassica napus [oilseed rape]
gb|AAC32107.1|  probable aquaporin                                      323   7e-108   Picea mariana [black spruce]
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  323   7e-108   Mimosa pudica [sensitive-plant]
ref|NP_001274386.1|  aquaporin PIP2-1-like                              323   7e-108   Cucumis sativus [cucumbers]
ref|NP_001240223.1|  prolactin-inducible protein                        324   7e-108   Glycine max [soybeans]
gb|ADK25057.1|  plasma membrane intrinsic protein                       323   8e-108   Glycine max [soybeans]
gb|KHN05685.1|  Aquaporin PIP2-7                                        323   8e-108   Glycine soja [wild soybean]
gb|ACG39551.1|  aquaporin PIP2.1                                        324   8e-108   Zea mays [maize]
gb|ABB13430.2|  plasma membrane intrinsic protein                       323   9e-108   Olea europaea
dbj|BAF32141.1|  putative aquaporin                                     323   9e-108   Taxodium distichum [bald cypress]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          323   9e-108   Gossypium arboreum [tree cotton]
gb|AFQ23186.1|  aquaporin PIP2;1                                        323   1e-107   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            323   1e-107   Juglans regia
emb|CBI31462.3|  unnamed protein product                                320   1e-107   Vitis vinifera
gb|ABX83874.1|  plasma membrane intrinsic protein                       323   1e-107   Rhododendron catawbiense [Catawba rosebay]
gb|ABK22173.1|  unknown                                                 323   1e-107   Picea sitchensis
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               323   1e-107   Tarenaya hassleriana [spider flower]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               323   1e-107   Malus domestica [apple tree]
gb|AGD98714.1|  aquaporin protein 11                                    323   1e-107   Camellia sinensis [black tea]
gb|AFK47442.1|  unknown                                                 323   2e-107   Medicago truncatula
gb|KJB62459.1|  hypothetical protein B456_009G418100                    323   2e-107   Gossypium raimondii
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             323   2e-107   Phaseolus vulgaris [French bean]
gb|AAO86707.1|  aquaporin                                               323   2e-107   Zea mays [maize]
emb|CAH60723.1|  putative plasma membrane intrinsic protein             323   2e-107   Populus tremula x Populus tremuloides
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               323   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             323   2e-107   Prunus persica
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    322   2e-107   Camelina sativa [gold-of-pleasure]
ref|NP_001053335.1|  Os04g0521100                                       323   2e-107   
gb|ABK24156.1|  unknown                                                 322   3e-107   Picea sitchensis
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               322   3e-107   Pyrus x bretschneideri [bai li]
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        322   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        322   3e-107   Fragaria vesca subsp. vesca
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             322   3e-107   Eutrema salsugineum [saltwater cress]
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   322   3e-107   Camelina sativa [gold-of-pleasure]
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               322   3e-107   Beta vulgaris [beet]
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   322   3e-107   Nicotiana tomentosiformis
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             322   3e-107   Eutrema salsugineum [saltwater cress]
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               322   3e-107   
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   322   3e-107   Fragaria vesca subsp. vesca
gb|AFK47400.1|  unknown                                                 322   3e-107   Lotus japonicus
gb|AGD98708.1|  aquaporin protein 5                                     322   3e-107   Camellia sinensis [black tea]
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     325   4e-107   Eucalyptus grandis [rose gum]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        322   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   322   4e-107   Nicotiana tomentosiformis
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 322   4e-107   Nicotiana tabacum [American tobacco]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                322   4e-107   Erythranthe guttata [common monkey flower]
emb|CDP04351.1|  unnamed protein product                                318   5e-107   
ref|NP_190910.1|  aquaporin PIP2-1                                      322   5e-107   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   322   5e-107   
gb|AHA84284.1|  prolactin-inducible protein                             322   6e-107   
ref|NP_181255.1|  aquaporin PIP2-3                                      322   6e-107   
gb|ABI96814.1|  plasma membrane intrinsic protein                       322   6e-107   
gb|ACF79873.1|  unknown                                                 322   6e-107   
ref|NP_001105638.1|  aquaporin PIP2-2                                   322   6e-107   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   321   7e-107   
ref|NP_191042.1|  putative aquaporin PIP2-5                             321   7e-107   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             321   9e-107   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  321   9e-107   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        321   1e-106   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   321   1e-106   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 321   1e-106   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               321   1e-106   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    320   1e-106   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 320   1e-106   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        320   1e-106   
ref|NP_001105639.1|  aquaporin PIP2-7                                   320   1e-106   
ref|NP_001289999.1|  aquaporin PIP2-1                                   320   1e-106   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          320   1e-106   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    320   2e-106   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               320   2e-106   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   320   2e-106   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               320   2e-106   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          320   2e-106   
gb|AHG32324.1|  PIP2-3                                                  320   2e-106   
emb|CDY53629.1|  BnaC09g53920D                                          319   3e-106   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        320   3e-106   
emb|CDY13298.1|  BnaC06g14590D                                          320   3e-106   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              320   3e-106   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             320   3e-106   
ref|NP_001059545.1|  Os07g0448800                                       320   3e-106   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       320   3e-106   
gb|AFH36338.1|  aquaporin PIP2;3                                        320   3e-106   
ref|XP_002322877.1|  major intrinsic protein 1                          320   3e-106   
gb|ACU19125.1|  unknown                                                 320   3e-106   
gb|ABI96813.1|  plasma membrane intrinsic protein                       320   3e-106   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             319   4e-106   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                319   4e-106   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          319   4e-106   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             319   4e-106   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               319   5e-106   
ref|NP_001234625.1|  aquaporin                                          319   5e-106   
emb|CDY14415.1|  BnaC03g21800D                                          319   5e-106   
emb|CDY07519.1|  BnaC06g15450D                                          319   5e-106   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               319   6e-106   
ref|NP_001268058.1|  aquaporin-like                                     319   6e-106   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          319   6e-106   
gb|AHG32323.1|  PIP2-2                                                  319   6e-106   
emb|CDX67611.1|  BnaA07g16510D                                          319   6e-106   
gb|AGG39693.1|  aquaporin protein AQU15                                 319   7e-106   
gb|ABK22146.1|  unknown                                                 318   7e-106   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        319   7e-106   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   319   7e-106   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    319   7e-106   
gb|KJB73803.1|  hypothetical protein B456_011G253400                    317   7e-106   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             319   7e-106   
gb|ACU21481.1|  unknown                                                 319   7e-106   
gb|EPS68613.1|  hypothetical protein M569_06155                         318   7e-106   
gb|AAG44947.1|AF290620_1  putative PIP2                                 318   8e-106   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        318   8e-106   
ref|NP_001237286.1|  PIP2,2                                             318   8e-106   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  318   9e-106   
emb|CBI16313.3|  unnamed protein product                                315   1e-105   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  318   1e-105   
gb|ABK60196.1|  PIP2 protein                                            318   1e-105   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               318   1e-105   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               318   1e-105   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               318   1e-105   
gb|AHH02389.1|  aquaporin PIP2-2                                        313   1e-105   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             318   1e-105   
ref|NP_001235204.1|  Pip1 protein                                       318   2e-105   
emb|CAC82712.1|  major intrinsic protein 1                              318   2e-105   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   318   2e-105   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               317   2e-105   
gb|ABK23750.1|  unknown                                                 317   2e-105   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                317   2e-105   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    317   2e-105   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               317   2e-105   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    317   3e-105   
gb|ACJ85173.1|  unknown                                                 317   3e-105   
gb|ACU87555.1|  PIP protein                                             317   3e-105   
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   317   3e-105   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   317   3e-105   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          317   3e-105   
emb|CDP07111.1|  unnamed protein product                                317   3e-105   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               317   3e-105   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   317   4e-105   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    317   4e-105   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   317   4e-105   
ref|NP_001267957.1|  aquaporin PIP2;2                                   316   6e-105   
gb|AGD98707.1|  aquaporin protein 4                                     316   8e-105   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               316   1e-104   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        324   1e-104   
gb|ABH09327.1|  putative aquaporin                                      315   1e-104   
gb|ABK21046.1|  unknown                                                 315   1e-104   
gb|KJB12139.1|  hypothetical protein B456_002G002500                    315   1e-104   
emb|CDX74984.1|  BnaA05g07300D                                          317   1e-104   
ref|XP_003591907.1|  Aquaporin PIP                                      313   2e-104   
gb|ABU94630.1|  putative aquaporin PIP2;2                               315   2e-104   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          315   2e-104   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 315   2e-104   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         315   2e-104   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     315   2e-104   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             315   2e-104   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   315   3e-104   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             315   3e-104   
gb|ABH09328.1|  putative aquaporin                                      315   3e-104   
emb|CDX73446.1|  BnaC08g25570D                                          315   3e-104   
ref|XP_003606383.1|  Aquaporin PIP2-7                                   314   3e-104   
gb|ABM54183.1|  aquaporin                                               314   4e-104   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   314   5e-104   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   314   5e-104   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             314   5e-104   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          314   5e-104   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   313   5e-104   
gb|ABK24624.1|  unknown                                                 314   6e-104   
gb|AAS65964.1|  aquaporin PIP 2                                         313   6e-104   
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        314   6e-104   
gb|KJB32662.1|  hypothetical protein B456_005G254400                    313   6e-104   
gb|AAC16545.1|  aquaporin                                               314   7e-104   
gb|ABK22504.1|  unknown                                                 313   7e-104   
gb|ACN40330.1|  unknown                                                 313   8e-104   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   313   8e-104   
gb|ACU87556.1|  PIP protein                                             313   8e-104   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          313   9e-104   
emb|CCI55668.1|  EaPIP2,1                                               313   9e-104   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          313   1e-103   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          313   1e-103   
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        312   1e-103   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   313   1e-103   
gb|AAY22203.1|  putative aquaporin                                      313   1e-103   
emb|CAB46351.1|  major intrinsic protein 2                              313   1e-103   
ref|NP_001105027.1|  aquaporin PIP2-6                                   313   1e-103   
gb|AAL32127.1|  aquaporin                                               313   1e-103   
ref|NP_179277.1|  putative aquaporin PIP2-8                             313   1e-103   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                313   1e-103   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               312   1e-103   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          313   1e-103   
ref|NP_001275065.1|  major intrinsic protein 2                          313   1e-103   
gb|ACB87734.1|  aquaporin                                               312   2e-103   
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    313   2e-103   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         312   2e-103   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               312   2e-103   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          313   2e-103   
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    312   2e-103   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        312   2e-103   
gb|EMT09900.1|  Putative aquaporin PIP2-2                               313   2e-103   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    312   2e-103   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             312   2e-103   
emb|CDX69112.1|  BnaC01g03410D                                          312   3e-103   
emb|CDX72515.1|  BnaC07g45370D                                          311   3e-103   
gb|ACB42441.1|  aquaporin PIP2;4                                        312   3e-103   
ref|XP_001753248.1|  predicted protein                                  312   3e-103   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    311   3e-103   
emb|CAB61749.1|  putative water channel protein                         310   3e-103   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                312   3e-103   
ref|NP_001059542.1|  Os07g0448100                                       312   3e-103   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               311   4e-103   
ref|XP_010553324.1|  PREDICTED: aquaporin PIP2-2                        308   4e-103   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     311   4e-103   
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...    310   4e-103   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               311   4e-103   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                313   4e-103   
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    312   4e-103   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       311   4e-103   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   311   4e-103   
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     310   5e-103   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    311   5e-103   
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             310   6e-103   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   310   6e-103   
gb|AFH36336.1|  aquaporin PIP2;1                                        311   6e-103   
gb|AAB18228.1|  MipE                                                    311   7e-103   
gb|ACB42440.1|  aquaporin PIP2;3                                        311   8e-103   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   311   8e-103   
gb|ABL76066.1|  aquaporin 2                                             311   8e-103   
gb|EEC81958.1|  hypothetical protein OsI_25844                          311   9e-103   
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  310   9e-103   
emb|CDX76314.1|  BnaA08g10860D                                          310   9e-103   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        311   1e-102   
emb|CDY17511.1|  BnaC03g65520D                                          310   1e-102   
gb|AAG30607.1|AF314656_1  aquaporin                                     310   1e-102   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   310   1e-102   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  310   1e-102   
gb|AAW55294.1|  aquaporin 2                                             307   1e-102   
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    311   1e-102   
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    311   1e-102   
gb|ACR56614.1|  plasma intrinsic protein 2;4                            310   1e-102   
gb|ACB71281.1|  plasma membrane intrinsic protein                       310   2e-102   
ref|XP_001779900.1|  predicted protein                                  310   2e-102   
ref|XP_001762521.1|  predicted protein                                  310   2e-102   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               309   2e-102   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       309   3e-102   
ref|XP_002306187.1|  membrane intrinsic family protein                  309   3e-102   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   310   3e-102   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               309   3e-102   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      309   3e-102   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               309   3e-102   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   309   3e-102   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               309   3e-102   
gb|ACE60220.1|  plasma membrane aquaporin                               309   3e-102   
ref|XP_010520673.1|  PREDICTED: probable aquaporin PIP2-4               309   4e-102   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        309   4e-102   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            309   4e-102   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               309   4e-102   
gb|ABN11917.1|  aquaporin                                               309   4e-102   
ref|XP_006657663.1|  PREDICTED: aquaporin PIP2-5-like                   306   4e-102   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        309   4e-102   
gb|AFO63679.1|  plasma intrinsic protein 2                              309   5e-102   
tpg|DAA33860.1|  TPA: aquaporin PIP1;6                                  309   5e-102   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     310   5e-102   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        308   5e-102   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               309   5e-102   
emb|CAH60721.1|  putative plasma membrane intrinsic protein             308   6e-102   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                308   6e-102   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               308   6e-102   
dbj|BAF63508.1|  plasma membrane intrinsic protein                      308   6e-102   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               308   7e-102   
emb|CBI37861.3|  unnamed protein product                                305   7e-102   



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   348 bits (892),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM+AQCLGAICGCGL
Sbjct  89   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMLAQCLGAICGCGL  148

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  149  VKAFQKAYYVKYGGGANTLNDGYSSGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  208

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAA +
Sbjct  209  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIA  268



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   345 bits (886),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM AQCLGAICGCGL
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQKAYYTRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  259



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   345 bits (884),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM+AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMLAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   344 bits (883),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM+AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMLAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSH+PV
Sbjct  141  VKAFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHIPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   344 bits (882),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYKKDKAWDDQWIFWVGPFIGAAIA  262



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   344 bits (882),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM+AQCLGAICGCGL
Sbjct  89   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMLAQCLGAICGCGL  148

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  149  VKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  208

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAA +
Sbjct  209  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIA  268



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   343 bits (881),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM+AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMLAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   343 bits (880),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   343 bits (879),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ+AYY RYGGGAN L DGYSKG GLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  142  VKAFQRAYYTRYGGGANELADGYSKGVGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIA  261



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   342 bits (878),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV YM AQCLGA+CGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVFYMAAQCLGAVCGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY +YGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   341 bits (875),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCLGAICGCGL
Sbjct  67   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCLGAICGCGL  126

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  127  VKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  186

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+YG +KAWDDQWIFWVGPF+GAA +
Sbjct  187  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVGPFIGAAIA  246



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   342 bits (876),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCLGAICGCGL
Sbjct  77   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCLGAICGCGL  136

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  137  VKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  196

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+YG +KAWDDQWIFWVGPF+GAA +
Sbjct  197  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVGPFIGAAIA  256



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   342 bits (877),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYKKDKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   341 bits (875),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM AQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMAAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ+AYY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  144  VKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  263



>ref|XP_010325989.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=259

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCLGAICGCGL
Sbjct  67   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCLGAICGCGL  126

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  127  VKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  186

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+YG +KAWDDQWIFWVGPF+GAA +
Sbjct  187  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVGPFIGAAIA  246



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVT GLFLARKVSLVRA++YM AQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLARKVSLVRAILYMAAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQKAYYNRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIA  263



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   340 bits (871),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV YM AQCLGA+CGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVFYMAAQCLGAVCGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY +YGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAW+DQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWNDQWIFWVGPFIGAAIA  262



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   340 bits (871),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA+ YM+AQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALGYMIAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFVGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIA  263



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   339 bits (870),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRAVMYMVAQCLGAICGCGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQK+YY  YGGGAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKGFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIA  259



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   339 bits (870),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIA  260



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   339 bits (869),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARK+SL RAVMYM+AQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKISLARAVMYMIAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYVRYGGGAN L  GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYVRYGGGANELATGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPLIGAAIA  262



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   339 bits (869),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARK+SLVRA++YM+AQCLGAICG GL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKISLVRALLYMIAQCLGAICGVGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  145  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAVA  264



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   338 bits (868),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIA  260



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   338 bits (868),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRAVMYMVAQCLGAICGCGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQK+YY  YGGGAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKWFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQW+FWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIA  259



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   338 bits (868),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+Y++AQCLGAI G GL
Sbjct  78   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAISGVGL  137

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  138  VKAFQKAYYVRYGGGANELADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  197

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAA +
Sbjct  198  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIA  257



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   338 bits (867),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKA Y RYGGGAN L DGYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  142  VKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y KDKAWDDQW+FWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNKDKAWDDQWMFWVGPFIGAAIA  261



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGANGL  G+SKGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTKYGGGANGLASGFSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIA  260



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   338 bits (866),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YM+AQC GAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMLAQCAGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRY GGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ K+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_010042277.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=257

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  55   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  114

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKA Y RYGGGAN L DGYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  115  VKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  174

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y KDKAWDDQW+FWVGPF+GAA +
Sbjct  175  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNKDKAWDDQWMFWVGPFIGAAIA  234



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   338 bits (866),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y+VAQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIVAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y+VAQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIVAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM AQCLGAICGCGL
Sbjct  79   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV+Y +DK WDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYNQDKPWDDQWIFWVGPFIGAAIA  258



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG G 
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGF  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV++GGGAN L DGY+KGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  139  VKAFQKSYYVKFGGGANELADGYNKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFVGAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIA  258



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY  YGGGAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIA  260



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCLGAICGCGL
Sbjct  77   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCLGAICGCGL  136

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTF+LVYTVFAATDPKRNARDSHVPV
Sbjct  137  VKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIGTFILVYTVFAATDPKRNARDSHVPV  196

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG  KAW+DQWIFWVGPF+GAA +
Sbjct  197  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGHHKAWNDQWIFWVGPFIGAAIA  256



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY  YGGGAN L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIA  260



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARK+SL RAVMYM+AQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKISLARAVMYMIAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV YGGGAN L  GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYVNYGGGANELATGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGK+KAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIA  262



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA+MYMVAQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  263



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   337 bits (864),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA+MYMVAQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  263



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   337 bits (864),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGG N L  G+SKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTKYGGGVNELATGFSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIA  260



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   337 bits (864),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCLGAICGCGL
Sbjct  85   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCLGAICGCGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTF+LVYTVFAATDPKRNARDSHVPV
Sbjct  145  VKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIGTFILVYTVFAATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG  KAW+DQWIFWVGPF+GAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGHHKAWNDQWIFWVGPFIGAAIA  264



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   337 bits (863),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV YMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVSYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN +Q GYSKGT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVG  128
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+YG DKAWDDQWIFWVGPF+G
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVMYGHDKAWDDQWIFWVGPFLG  258



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   336 bits (862),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA+ YMVAQCLGAICGCGL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALGYMVAQCLGAICGCGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  145  VKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  264



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   336 bits (862),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLAR+VSLVRA++YMVAQCLGA+CGCGL
Sbjct  85   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARRVSLVRAILYMVAQCLGAVCGCGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ+AYY RYGGGAN LQ GYSKGTGLGAEIIGTFVLVYTV +ATDPKR+ARDSHVPV
Sbjct  145  VKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIGTFVLVYTVLSATDPKRSARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV+Y K+KAWDDQWIFWVGPF+GAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYNKEKAWDDQWIFWVGPFIGAAIA  264



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   336 bits (862),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY  YGGGANGL  GYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYTSYGGGANGLAIGYSKGNGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDHWIFWVGPFIGAAIA  260



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   336 bits (862),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+Y++AQCLGAICGCGL
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAICGCGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV +GGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  140  VKAFQKSYYVEHGGGANELALGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIA  259



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   336 bits (861),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  144  VKAFQKSYYNRYGGGANVLASGYNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWDD W+FWVGPF+GA
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDHWLFWVGPFIGA  260



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   336 bits (861),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGA+CGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAVCGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYY+  GGGANGL +GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  142  VKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV+YGK KAWD+QWIFWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYGKQKAWDEQWIFWVGPFIGAAIA  261



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   336 bits (861),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y++AQC GAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCAGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRY GGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ K+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCLGAICGCGL
Sbjct  77   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCLGAICGCGL  136

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  137  VKCFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  196

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAA  122
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG  KAW+DQWIFWVGPF+GAA
Sbjct  197  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGHHKAWNDQWIFWVGPFIGAA  254



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   336 bits (861),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+AQCLGAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYYVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  144  VKGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYDKEKAWDDQWIFWVGPFIGAAIA  263



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+AQCLGAICG GL
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYYVRYGGGAN L  GYS+GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  146  VKGFQKAYYVRYGGGANELSSGYSRGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDDQWIFWVGPFIGAAIA  265



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLAR VSL RA MYMVAQCLGAICGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARXVSLPRAFMYMVAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY +YGGGAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  142  VKAFQKTYYTKYGGGANELADGYSNGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQW+FWVGP +GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWLFWVGPMIGAAIA  261



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 172/180 (96%), Gaps = 2/180 (1%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSLVRAV+YMVAQCLGAICGCGL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRAVLYMVAQCLGAICGCGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ+AYYVRYGGGANGL DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  145  VKAFQRAYYVRYGGGANGLSDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG  KAWDD WIFWVGPF+GAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG--KAWDDHWIFWVGPFIGAAIA  262



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLF+ RKVSL+RA+MYMVAQCLGAICGCGL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALMYMVAQCLGAICGCGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  147  VKAFQKTYYNNYGGGANELQPGFNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAA  266



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYTRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+AQCLGAICG GL
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGAGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            V+ FQKAYYVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  146  VRGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  265



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YM+AQCLGAICG GL
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMIAQCLGAICGVGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKA+YVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  146  VKGFQKAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K KAWDDQWIFWVGPF+GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKAWDDQWIFWVGPFIGAAIA  265



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   335 bits (860),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLF+ RKVSL+RA+MYMVAQCLGAICGCGL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALMYMVAQCLGAICGCGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  147  VKAFQKTYYNNYGGGANELQPGFNKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAA  266



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA+MYMVAQCLGAICGCGL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAIMYMVAQCLGAICGCGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQ GY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKAFQKTYYNTYGGGANELQPGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGPF+GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNREKAWDDQWIFWVGPFIGAAIA  266



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   335 bits (859),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ +YY RYGGGAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  147  VKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIA  266



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   335 bits (858),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY +YGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYNKYGGGANELSDGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY K+KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   335 bits (858),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAA  262



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   334 bits (857),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL++AV+YMVAQCLGAICG G 
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIKAVLYMVAQCLGAICGVGF  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYYVRYGGGAN +  GY+KGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  145  VKAFQKAYYVRYGGGANEMASGYTKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + KAWDD WIFWVGPF+GAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQQKAWDDHWIFWVGPFIGAAIA  264



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   334 bits (857),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  84   IAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGP +GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAA  263



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   334 bits (857),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY  YGGGAN LQ+GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  142  VKAFQKSYYNHYGGGANELQEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + KAWDD W+FWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIA  261



>gb|KDO41796.1| hypothetical protein CISIN_1g023108mg [Citrus sinensis]
Length=287

 Score =   334 bits (857),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR ARD HVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRKARDPHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPL IGFAVFMVHLATIP+TGTGINPARSFG AVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   334 bits (857),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQCLGAICGCG 
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGF  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GA
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGA  263



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   334 bits (856),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIA  262



>ref|XP_006428788.1| hypothetical protein CICLE_v10012375mg [Citrus clementina]
 gb|ESR42028.1| hypothetical protein CICLE_v10012375mg [Citrus clementina]
Length=287

 Score =   334 bits (856),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR ARD HVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRKARDPHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPL IGFAVFMVHLATIP+TGTGINPARSFG AVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   334 bits (856),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ +YY RYGGGAN L DGYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  147  VKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS G AVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIA  266



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   336 bits (862),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGA+CGCGL
Sbjct  152  IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAVCGCGL  211

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYY+  GGGANGL +GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  212  VKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  271

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV+YGK KAWD+QWIFWVGPF+GAA +
Sbjct  272  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYGKQKAWDEQWIFWVGPFIGAAIA  331



>ref|XP_006481457.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Citrus sinensis]
 ref|XP_006481458.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Citrus sinensis]
Length=287

 Score =   334 bits (856),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR ARD HVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRKARDPHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPL IGFAVFMVHLATIP+TGTGINPARSFG AVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   333 bits (855),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIA  266



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   333 bits (854),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  84   IAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLARKVSLVRTVLYIVAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  263



>gb|AAF65845.1|AF255795_1 aquaporin 1 [Allium cepa]
Length=291

 Score =   333 bits (854),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+AQCLGAICG G 
Sbjct  89   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGVGF  148

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKR+ARDSHVPV
Sbjct  149  VKAFQSAYYSRYGGGANTLNAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRSARDSHVPV  208

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  209  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  268



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  79   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLG EIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  139  VKAFQSSYYNRYGGGANELADGYNKGTGLGTEIIGTFVLVYTVFSATDPKRSARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  258



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIA  266



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK++Y  YGGGAN LQ+GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  142  VKAFQKSFYNHYGGGANELQEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + KAWDD W+FWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNQSKAWDDHWLFWVGPFIGAAIA  261



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQCLGAICGCG 
Sbjct  90   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGF  149

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  150  VKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  209

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWI WVGPF+GA
Sbjct  210  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWILWVGPFIGA  266



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAG+SGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  90   IAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  149

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ A+YVRYGGGANGL DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  150  VKGFQSAFYVRYGGGANGLSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  209

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DK WDD WIFWVGPF+GAA +
Sbjct  210  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKTWDDHWIFWVGPFIGAAIA  269



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   333 bits (853),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAICG GL
Sbjct  88   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  148  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIA  267



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   332 bits (851),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV+YGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   332 bits (852),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLF+ RKVSL+RA++YMVAQCLGAICGCGL
Sbjct  89   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCGL  148

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  149  VKAFQKTYYNSYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  208

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGPF+GA
Sbjct  209  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGA  265



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   332 bits (852),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGA+CG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAMCGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+Y + KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVMYNQKKAWDDQWIFWVGPFIGAAIA  260



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   332 bits (852),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVT GLFLARKVSLVRA++YMVAQCLGAICG GL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLARKVSLVRALLYMVAQCLGAICGVGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ+AY+VRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  145  VKGFQEAYFVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY +DKAWDDQWIFWVGPFVGAA +
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDDQWIFWVGPFVGAAIA  264



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   332 bits (852),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAICG GL
Sbjct  87   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  147  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPLIGAAIA  266



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   332 bits (852),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+ QCLGAICG GL
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIGQCLGAICGVGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKA++VRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  146  VKGFQKAFFVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPLIGAAIA  265



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   332 bits (852),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQCLGAICGCG 
Sbjct  88   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGF  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  148  VKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPI GTGINPARSFGAAVIY K+KAWDDQWIFWVGPF+GA
Sbjct  208  LAPLPIGFAVFMVHLATIPIIGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGA  264



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   332 bits (851),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV+YGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   332 bits (851),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA+ YM AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIFYMAAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  141  VKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DK WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQDKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   332 bits (851),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM AQCLGAICGC L
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMAAQCLGAICGCAL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKA Y  YGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKSFQKALYNGYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  259



>ref|XP_003580150.1| PREDICTED: aquaporin PIP2-5 [Brachypodium distachyon]
Length=287

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG GL
Sbjct  84   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AY+VRYGGGANGL  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  144  VKGFQSAYFVRYGGGANGLSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPFIGAAIA  263



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGL + RKVSL+RAV YMVAQCLGAICG G 
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLLVGRKVSLIRAVFYMVAQCLGAICGVGF  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKA+YVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVFAATDPKRNARDSHVPV
Sbjct  146  VKAFQKAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAATDPKRNARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  265



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   332 bits (850),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  76   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALVYMVAQCLGAICGVGL  135

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  136  VKAFQKSYYNRYGGGANELAAGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  195

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  DKAWDD WIFWVGPF+GAA +
Sbjct  196  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNDDKAWDDHWIFWVGPFIGAAIA  255



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   333 bits (854),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLF+ RKVSL+RA++YMVAQCLGAICGCGL
Sbjct  118  IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCGL  177

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN LQDG++KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  178  VKAFQKTYYNSYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  237

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGPF+GA
Sbjct  238  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGA  294



>emb|CDY31523.1| BnaA10g13480D [Brassica napus]
Length=260

 Score =   331 bits (848),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  58   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGL  117

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  118  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  177

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  178  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  237



>ref|XP_006436425.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 ref|XP_006485687.1| PREDICTED: probable aquaporin PIP2-5-like [Citrus sinensis]
 gb|ESR49665.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=287

 Score =   332 bits (850),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAI G GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQW+FWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIA  262



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  95   IAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGL  154

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  155  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  214

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K+KAWDDQWIFWVGP +GAA +
Sbjct  215  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAA  274



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   332 bits (850),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   331 bits (849),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+ Y+VAQCLGAICGCGL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIFYIVAQCLGAICGCGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYYV+YGGGAN L  GY+  TGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKLFQKAYYVKYGGGANELAVGYNTATGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGK+K+WDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKNKSWDDQWIFWVGPFIGAAIA  258



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   331 bits (849),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   331 bits (849),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVR V+Y+VAQCLGAICGCG 
Sbjct  83   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGF  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  143  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  262



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   331 bits (849),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DG+S GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFQKSYYKRYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY +DKAWDD WIFWVGPF GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDDHWIFWVGPFAGAAIA  260



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   332 bits (850),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAG+SGGHINPAVT GLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  88   IAWAFGGMIFILVYCTAGVSGGHINPAVTLGLFLARKVSLVRALLYIVAQCLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  148  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDD WIFWVGPF+GAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDHWIFWVGPFIGAAIA  267



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   331 bits (849),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   331 bits (849),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA +Y+VAQCLGAICG GL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAFLYIVAQCLGAICGVGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAY+VRYGGGAN L DGYSKGTGLGAEIIGTFVLVYTVFAATDPKR+ARDSHVPV
Sbjct  145  VKGFQKAYFVRYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRSARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGP  137
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFWVGP
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWVGP  257



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   331 bits (849),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIA  260



>gb|KHN32779.1| Aquaporin PIP2-2 [Glycine soja]
Length=239

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  35   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  94

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  95   VKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  154

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAA +
Sbjct  155  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIA  214



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQCLGAICG GL
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMIAQCLGAICGVGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ+AYY RYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  146  VKGFQRAYYDRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  265



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQ LGAICG GL
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQSLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAY+ +YGGGANGL DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQKAYFTKYGGGANGLADGYSQGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYDNDKAWDDQWIFWVGPFIGAAIA  259



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            I+WA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  81   ISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYY+R GGGAN L  GYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKGFQKAYYMRSGGGANSLALGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDD WIFWVGPF GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDHWIFWVGPFTGAALA  262



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY++YGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY  DKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNXDKAWDDQWIFWLGPFIGAAIA  258



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIA  259



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            I+WA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  81   ISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            I+WA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  81   ISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMY++AQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYIIAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQK+YYVRYGGGAN L DGYSKG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKGFQKSYYVRYGGGANELADGYSKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ KDKAW D WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNKDKAWHDHWIFWVGPFIGAAIA  262



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIA  259



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +Y GGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFQKSYYTKYQGGANILADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  260



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAF K+ Y RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFNKSLYNRYGGGANSLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY K+K WDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFIGAAIA  260



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  143  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  262



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVY TAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIA  262



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  80   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  140  VKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  259



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            I+WA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  81   ISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>gb|KDO44716.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=337

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAI G GL
Sbjct  133  IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGL  192

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY RYGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  193  VKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  252

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQW+FWVGPF+GAA +
Sbjct  253  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIA  312



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  80   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  140  VKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  259



>ref|XP_010107541.1| Aquaporin PIP2-2 [Morus notabilis]
 gb|EXC16223.1| Aquaporin PIP2-2 [Morus notabilis]
Length=286

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVR ++Y+ AQCLGAICGCGL
Sbjct  82   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRTILYIAAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  142  VKAFQNSYYDRYGGGANSLADGYSNGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDK WDD WIFWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKPWDDHWIFWVGPFIGAAIA  261



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  80   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  140  VKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  259



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+AQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKAYY RYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKSFQKAYYNRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVG  128
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWD QWIFWVGPF+G
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKAWDHQWIFWVGPFIG  256



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKV+LVRA++YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLVRALLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   330 bits (845),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICGC L
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGCAL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKA Y  +GGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ KDK WDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIA  259



>gb|KFK36606.1| hypothetical protein AALP_AA4G145300 [Arabis alpina]
Length=284

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  259



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RAV+YMVAQCLGAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRAVLYMVAQCLGAICGVGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYVRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQKSYYVRYGGGANTLAHGYNTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+  DKAWDDQWIFWVGPFVGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNNDKAWDDQWIFWVGPFVGAAIA  263



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   329 bits (844),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+Y+VAQCLGAICG GL
Sbjct  79   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIVAQCLGAICGTGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY R+GGGAN L D Y+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQSSYYNRHGGGANTLADHYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  DKAWDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPFIGAAIA  258



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQ LGAICG GL
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQSLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+ +YGGGANGL DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQNAYFTKYGGGANGLADGYSQGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPFIGAAIA  259



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  80   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  140  VKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  259



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNQQKAWDDHWIFWVGPFIGAAIA  260



>emb|CDY46759.1| BnaA03g17030D [Brassica napus]
Length=285

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKV+LVRA++YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLVRALLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQ LGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQSLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFQSAYYKRYGGGANTLADGYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNHDKAWDDQWIFWVGPFLGAAIA  260



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGA+CG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAMCGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+VRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  148  VKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIA  267



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKAYYSRYGGGANTLSDGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI+ + KAWDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIFNQQKAWDDHWIFWVGPFIGAAIA  262



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   329 bits (844),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   330 bits (845),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RA+ YMVAQC+GAICG GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLTRALAYMVAQCVGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ++YYV YGGGAN LQDGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVP+
Sbjct  143  VKAFQRSYYVTYGGGANQLQDGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPI  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   329 bits (844),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAA  262



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   329 bits (844),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRAV+Y+VAQCLGAICG GL
Sbjct  87   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIVAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  147  VKGFQSAYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNTDKAWDDQWIFWVGPLIGAAIA  266



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   329 bits (844),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIA  260



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   329 bits (844),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQCLGAICG GL
Sbjct  79   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ ++Y RYGGGAN L D YS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  139  VKAFQSSHYKRYGGGANTLDDNYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY +DKAWDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDDQWIFWVGPFIGAAIA  258



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   329 bits (844),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIA  260



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   328 bits (841),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GA
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGA  259



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   329 bits (843),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  143  VKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  262



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   329 bits (843),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+ Y RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSLYTRYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + KAWDD WIFWVGPFVGAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNQSKAWDDHWIFWVGPFVGAAIA  262



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   329 bits (843),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y + KAWDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYNQQKAWDDHWIFWVGPFIGAAIA  260



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   329 bits (843),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVY TAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYYTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YYV++GGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKSYYVKFGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   328 bits (842),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGAICGCGL
Sbjct  78   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMVAQCLGAICGCGL  137

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK++Y RYGG AN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  138  VKAFQKSHYSRYGG-ANELSGGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  196

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  197  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNTEKAWDDQWIFWVGPFIGAAIA  256



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   328 bits (842),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGL LARKVSLVRA+ Y+VAQCLGAICGCGL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVSLVRAIFYIVAQCLGAICGCGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQKAYYV+YGGGAN L  GY+  TGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKLFQKAYYVKYGGGANELAVGYNIATGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGK+K+WDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKNKSWDDQWIFWVGPFIGAAIA  258



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   329 bits (843),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  80   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  140  VKAFQSAYYNRYGGGANELATGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  259



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   329 bits (843),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ +DK WDD WIFWVGP +GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFNQDKPWDDHWIFWVGPLIGAAIA  260



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   328 bits (842),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCL AICG GL
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLSAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIA  259



>ref|NP_200874.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
 sp|Q9FF53.1|PIP24_ARATH RecName: Full=Probable aquaporin PIP2-4; AltName: Full=Plasma 
membrane intrinsic protein 2.4; Short=AtPIP2;4; Contains: RecName: 
Full=Probable aquaporin PIP2-4, N-terminally processed 
[Arabidopsis thaliana]
 dbj|BAB09839.1| water channel protein [Arabidopsis thaliana]
 gb|AAM64801.1| mipC protein-like (aquaporin) [Arabidopsis thaliana]
 dbj|BAF00622.1| mipC protein - like [Arabidopsis thaliana]
 gb|AED97364.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
Length=291

 Score =   329 bits (843),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCG 
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGF  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGP +GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAA  262



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   328 bits (842),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSL+RA++Y++AQCLGAICG GL
Sbjct  86   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLIRALLYIIAQCLGAICGVGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ +YYVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  146  VKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGP +GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIA  265



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   328 bits (842),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GL
Sbjct  80   IAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPK++ARDSHVPV
Sbjct  140  VKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKKSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  259



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   328 bits (842),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RA++YMVAQCLGAICGC L
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLTRAILYMVAQCLGAICGCAL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKA Y  +GGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ KDK WDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIA  259



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   328 bits (842),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAG+SGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ A+YVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDHWIFWVGPFIGAAIA  262



>emb|CDX71032.1| BnaC03g11160D [Brassica napus]
Length=260

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  58   IAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGL  117

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  118  VKAFQSSYYTRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  177

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDDQWIFWVGP +GAA +
Sbjct  178  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNHEKAWDDQWIFWVGPMIGAAAA  237



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   328 bits (842),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L +GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYVRYGGGANSLAEGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNESKPWDDHWIFWVGPFIGAAIA  260



>gb|AAM63463.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
Length=285

 Score =   328 bits (841),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   328 bits (841),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVT GLFL RKVSL+RA++YMVAQCLGAICGCGL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGRKVSLIRALLYMVAQCLGAICGCGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATD KRNARDSHVP+
Sbjct  144  VKAFQKAYYNRYGGGANELSDGYNKGTGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPI  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAA+I+ KDK WDD WIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDKGWDDHWIFWVGPFIGAALA  263



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  79   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYY RYGGGAN L +GY KG GLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  139  VKGFQSAYYNRYGGGANTLSNGYDKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY   KAWDDQWIFWVGPF+GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNKKAWDDQWIFWVGPFIGAAIA  258



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM+AQCLGAICG GL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMIAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY RYGGG N L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS G AVIY  DKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGPAVIYNNDKAWDDQWIFWVGPFIGAAIA  262



>emb|CDX88767.1| BnaA03g08820D [Brassica napus]
Length=260

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLF+ARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  58   IAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFIARKVSLVRTVLYIVAQCLGAICGCGL  117

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  118  VKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  177

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  178  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  237



>gb|ADG03686.1| aquaporin [Hordeum vulgare]
Length=290

 Score =   328 bits (841),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGA+CG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAMCGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+VRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  148  VKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDK WDDQWIFWVGP +GAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKXWDDQWIFWVGPMIGAAIA  267



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQCLGA+CG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMIAQCLGAMCGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+VRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  148  VKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ KDKAWDDQWIFWVGP VGAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNKDKAWDDQWIFWVGPMVGAAIA  267



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  80   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  259



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGL L RKV+LVRA++YMVAQCLGAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGRKVTLVRALLYMVAQCLGAICGVGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQSSYYDRYGGGANSLADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDK WDD WIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIA  263



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   327 bits (838),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+Y+VAQCLGAICGCGL
Sbjct  80   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQCLGAICGCGL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQ A Y  YGGGANGL DGYS+GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKSFQSALYSNYGGGANGLADGYSEGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDD WIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIA  259



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AY+VRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKGFQSAYFVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDQWIFWVGPLIGAAIA  266



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+Y+ +YGGGAN L  GYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQKSYFNKYGGGANSLAAGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIA  262



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++Y+VAQCLGAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYIVAQCLGAICGVGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKAYY +YGGGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQKAYYTKYGGGANTLGDGYSVGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+ + KAWD  WIFWVGPF+GAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIFNQQKAWDKHWIFWVGPFIGAAIA  263



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  148  VKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPFVGAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIA  267



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>gb|ABK93567.1| unknown [Populus trichocarpa]
Length=285

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DG+S GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY +DKAWD  WIFWVGPF GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDGHWIFWVGPFAGAAIA  260



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+Y+VAQ LGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQSLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L DGY+ GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY K K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   327 bits (837),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVR V+Y+VAQCLGAICGCGL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRTVLYIVAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L +GY+KGTGLGAEIIGTFVLVY VFAATDPKR+ARDSH+PV
Sbjct  141  VKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFVLVYPVFAATDPKRSARDSHIPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFA FMVHLATIPITGTGINPARSFGAAVIY ++KAWDDQWIFWVGP +GAA +
Sbjct  201  LAPLPIGFAAFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAA  260



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   327 bits (837),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQ LGAI G  L
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVAL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY++YGGGAN L DGYS G GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKSYYIKYGGGANSLSDGYSTGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   327 bits (837),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DG+S GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY +DKAWD  WIFWVGPF GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQDKAWDGHWIFWVGPFAGAAIA  260



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   327 bits (837),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQ LGAI G  L
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQSLGAIAGVAL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY++YGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   327 bits (837),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSL+RA++Y++AQCLGAICG GL
Sbjct  86   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLIRALLYIIAQCLGAICGVGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ +YYVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  146  VKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNTDKAWDDQWIFWVGPLIGAAIA  265



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   327 bits (837),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSL+RA++Y++AQCLGAICG GL
Sbjct  86   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLIRALLYIIAQCLGAICGVGL  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ +YYVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  146  VKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAWDDQWIFWVGP +GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNTDKAWDDQWIFWVGPLIGAAIA  265



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   327 bits (837),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISG HINPAVTFGLFLARKVSL RA++YMVAQCLGAICGC L
Sbjct  80   IAWAFGGMIFVLVYCTAGISGDHINPAVTFGLFLARKVSLTRAILYMVAQCLGAICGCAL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQKA Y  +GGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  140  VKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ KDK WDDQWIFWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIA  259



>ref|XP_010516976.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   326 bits (836),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L+RAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVRYGGGANSLADGYSTGAGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   326 bits (836),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            I+WA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  81   ISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K W+D WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWNDHWIFWVGPFIGAAIA  260



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   326 bits (836),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQCLGAICG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY RY GGAN L DGYSK  GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYHRYDGGANMLSDGYSKSVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ +DKAW D WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQDKAWKDHWIFWVGPFIGAAIA  260



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   326 bits (836),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVT GLFLA+KVSLVRA++YM+AQCLGAICGCGL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQKVSLVRAMLYMMAQCLGAICGCGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  142  VKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYGK K WDDQWIFW GPF+GA
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYGKKKTWDDQWIFWGGPFIGA  258



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   326 bits (835),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 173/187 (93%), Gaps = 7/187 (4%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTA-------GISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLG  497
            IAWA GGMIF+LVYCTA        I+GGHINPAVTFGLFLARKVSL+RAV+Y+VAQCLG
Sbjct  79   IAWAFGGMIFVLVYCTAPPSCFSMTIAGGHINPAVTFGLFLARKVSLIRAVLYIVAQCLG  138

Query  496  AICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNA  317
            AICG GLVKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNA
Sbjct  139  AICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNA  198

Query  316  RDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGP  137
            RDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GP
Sbjct  199  RDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGP  258

Query  136  FVGAACS  116
            F+GAA +
Sbjct  259  FIGAAIA  265



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   326 bits (835),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+Y+VAQ LGAICGCGL
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQSLGAICGCGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK+FQ A Y  YGGGANGL DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKSFQSALYTNYGGGANGLADGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIA  262



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   325 bits (834),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYM+AQCLGA+CG GL
Sbjct  78   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALMYMIAQCLGAVCGVGL  137

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ + Y RYGGGAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  138  VKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  197

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  DKAWDD W+FWVGPF+GAA +
Sbjct  198  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIA  257



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   325 bits (834),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAI G GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAIAGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ ++Y RYGGGAN L  GYSKG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSFYKRYGGGANSLAAGYSKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY +DK WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIA  260



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+Y+VAQ LGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIVAQSLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>gb|ACG32567.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  148  VKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIA  267



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQ LGAI G  L
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVAL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY++YGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+YMVAQCLGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLFRAVLYMVAQCLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+Y+ RYGGGAN +  GY+KGT LGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  139  VKAFQKSYFDRYGGGANEVASGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY   KAWDDQWIFWVGPF GAA +
Sbjct  199  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNSKAWDDQWIFWVGPFAGAAIA  258



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGL LARKVSLVRA++YMVAQCLGAICG G 
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVSLVRAILYMVAQCLGAICGVGF  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  262



>dbj|BAF33069.1| aquaporin [Hordeum vulgare]
 dbj|BAJ85080.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRAV+Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ A+YVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDD WIFWVGPF+GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIA  266



>ref|XP_006846005.1| hypothetical protein AMTR_s00155p00061840 [Amborella trichopoda]
 gb|ERN07680.1| hypothetical protein AMTR_s00155p00061840 [Amborella trichopoda]
Length=285

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQCLGA+CG GL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLTRKVSLIRAILYMVAQCLGAMCGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQK++Y +YGGGANGL  GY+ G GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKGFQKSFYDKYGGGANGLAIGYNTGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVG  128
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+G
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIG  256



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQC GAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
             K FQKAYY RYGGGAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  AKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDK WDDQWIFWVGP VGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVA  263



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   325 bits (832),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+Y++AQ LGAICG GL
Sbjct  79   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYIIAQSLGAICGVGL  138

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK YY  YGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  139  VKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  198

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY KDKAWDDQWIFW+GPF+GAA +
Sbjct  199  LAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIA  258



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  87   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  147  VKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGPF GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFAGAAIA  266



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARK+SL+RA+MYMVAQCLGAICG G 
Sbjct  86   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKLSLIRAIMYMVAQCLGAICGVGF  145

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYY +YGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  146  VKAFQSAYYNKYGGGANELSVGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  205

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  206  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNNKAWDDQWIFWVGPFIGAAIA  265



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGL LARKVSLVRA++YMVAQCLGAICG G 
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVSLVRAILYMVAQCLGAICGVGF  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPFVGAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFVGAAIA  262



>ref|XP_011077012.1| PREDICTED: probable aquaporin PIP2-5 [Sesamum indicum]
Length=281

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICG GL
Sbjct  77   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGVGL  136

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ+++Y RYGGGANGL DGYS G GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  137  VKAFQRSHYKRYGGGANGLSDGYSVGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  196

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI   D+AW D WIFWVGPF+GAA +
Sbjct  197  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVILNDDEAWHDHWIFWVGPFIGAAIA  256



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRAV+Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ A+YVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDD W+FWVGPF+GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWMFWVGPFIGAAIA  266



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score =   324 bits (831),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+YMVAQCLGAICG GL
Sbjct  71   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGVGL  130

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK++Y  YGGGAN +  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  131  VKAFQKSFYDMYGGGANSVAPGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  190

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG DK WDDQWIFWVGPF+GA
Sbjct  191  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGA  247



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG GL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN +  G++KG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  145  VKGFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWD+ WIFWVGPF+GA
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFIGA  261



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGL LARKVSLVRA++YMVAQCLGAICG G 
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVSLVRAILYMVAQCLGAICGVGF  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPFVGAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFVGAAIA  262



>ref|NP_001105024.1| aquaporin PIP2-1 [Zea mays]
 sp|Q84RL7.2|PIP21_MAIZE RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; AltName: Full=ZmPIP2-1; AltName: Full=ZmPIP2;1 
[Zea mays]
 gb|AAK26758.1| plasma membrane integral protein ZmPIP2-1 [Zea mays]
 gb|ACF78965.1| unknown [Zea mays]
 gb|ACF84592.1| unknown [Zea mays]
 gb|ACF86144.1| unknown [Zea mays]
 gb|ACG31774.1| aquaporin PIP2.1 [Zea mays]
 tpg|DAA60473.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=290

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  148  VKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIA  267



>gb|EMS51072.1| Aquaporin PIP2-5 [Triticum urartu]
Length=290

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAICG GL
Sbjct  87   IAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGL  146

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ A+YVRYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  147  VKGFQSAFYVRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  206

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  +KAWDD WIFWVGPF+GAA +
Sbjct  207  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFIGAAIA  266



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGL LARKVSLVRA++YMVAQ LGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVSLVRAILYMVAQSLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY  DKAW+DQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIA  260



>ref|XP_006652526.1| PREDICTED: probable aquaporin PIP2-3-like [Oryza brachyantha]
Length=290

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAG+SGGHINPAVTFGLFLARKVSLVRAV+Y+VAQ LGAICG GL
Sbjct  88   IAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIVAQSLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQ AYYVRYGGGAN L DGYSKGTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  148  VKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY + KAW D WIFWVGP +GAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQHKAWHDHWIFWVGPLIGAAIA  267



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQCLGAICG GL
Sbjct  82   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCLGAICGVGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQK+YY +YGGGAN L +GY    GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  142  VKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  261



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAVMYMVAQC GAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVMYMVAQCAGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +Y GGAN L DGYS GTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  141  VKAFQKSYYTKYNGGANVLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY   KAW DQWIFW GPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNKKAWHDQWIFWAGPFIGAAIA  260



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGL LARKVSLVRA++YMVAQ LGAICG GL
Sbjct  81   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVSLVRAILYMVAQSLGAICGVGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY  DKAW+DQWIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNNDKAWNDQWIFWVGPFIGAAIA  260



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG G 
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGF  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYVRYGGGAN +  G++KG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  145  VKAFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  DKAWD+ WIFWVGPF+GA
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNHDKAWDEHWIFWVGPFIGA  261



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMY+VAQ LGAI G GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYIVAQSLGAIAGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKSYYTKYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY K KAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYDKKKAWDDQWIFWVGPFIGAAIA  262



>ref|XP_006296058.1| hypothetical protein CARUB_v10025207mg [Capsella rubella]
 gb|EOA28956.1| hypothetical protein CARUB_v10025207mg [Capsella rubella]
Length=285

 Score =   324 bits (830),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQCLGAICG G 
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQCLGAICGVGF  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AYYV YGGGAN L  GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  141  VKAFQSAYYVNYGGGANTLAAGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ + K WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNESKPWDDHWIFWVGPFIGAAIA  260



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   324 bits (830),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQC GAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
             K FQK+YY RYGGGAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  AKGFQKSYYNRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDK WDDQWIFWVGP VGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVA  263



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   324 bits (830),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRAV+YMVAQ LGAI G  L
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVLYMVAQSLGAIAGVAL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L DGYS G GL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  143  VKAFQKSYYXKYGGGANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIA  262



>emb|CDY09192.1| BnaA02g06180D [Brassica napus]
Length=259

 Score =   323 bits (827),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVS VR V+Y+VAQCLGAICGCGL
Sbjct  56   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSFVRTVLYIVAQCLGAICGCGL  115

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L +GY+KGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSH+PV
Sbjct  116  VKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHIPV  175

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDD-QWIFWVGPFVGAAC  119
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY ++KAWDD QWIFWVGP +GAA 
Sbjct  176  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQEKAWDDQQWIFWVGPMIGAAA  235

Query  118  S  116
            +
Sbjct  236  A  236



>gb|AAC32107.1| probable aquaporin [Picea mariana]
Length=282

 Score =   323 bits (829),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+YMVAQCLGAICGCGL
Sbjct  78   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGCGL  137

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN +  GY+KG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  138  VKAFQKSYYDQYGGGANSVAHGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPV  197

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAA  122
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  K WD+ WIFWVGPF+GAA
Sbjct  198  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGHQKIWDEHWIFWVGPFLGAA  255



>dbj|BAD90700.1| plasma membrane intrinsic protein 2;4 [Mimosa pudica]
Length=281

 Score =   323 bits (829),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGCGL
Sbjct  77   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIAYIVAQCLGAICGCGL  136

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQKA+Y RYGGGAN L  GYS GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  137  VKAFQKAFYNRYGGGANTLSTGYSSGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  196

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHL TIPITGTGINPARSFGAAV+Y   +AWDD WIFWVGPF+GAA +
Sbjct  197  LAPLPIGFAVFMVHLTTIPITGTGINPARSFGAAVMYNNFEAWDDHWIFWVGPFIGAAIA  256



>ref|NP_001274386.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33477.1| plasma intrinsic protein 2-1 [Cucumis sativus]
 gb|KGN48148.1| hypothetical protein Csa_6G445130 [Cucumis sativus]
Length=284

 Score =   323 bits (829),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM AQ LGAICGC L
Sbjct  83   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQSLGAICGCAL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ A+Y  YGGGAN L DGYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQNAHYTEYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ K K WDDQWIFWVGPF+GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVVFNKSKPWDDQWIFWVGPFIGAAIA  262



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   324 bits (830),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQC GAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
             K FQKAYY RYGGGAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  AKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DK WDDQWIFWVGP VGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVA  263



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   323 bits (829),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQC GAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
             K FQKAYY RYGGGAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  AKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DK WDDQWIFWVGP VGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVA  263



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   323 bits (829),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA++YMVAQC GAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCAGAICGTGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
             K FQKAYY RYGGGAN + DGY+ GT LGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  AKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DK WDDQWIFWVGP VGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVA  263



>gb|ACG39551.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   324 bits (830),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAICG GL
Sbjct  88   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGL  147

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  148  VKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  207

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WDD WIFWVGP VGAA +
Sbjct  208  LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIA  267



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   323 bits (829),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVT GLFL RKVSL+RAV+YMVAQCLGAICG GL
Sbjct  85   IAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGRKVSLIRAVLYMVAQCLGAICGVGL  144

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  145  VKAFQKSYYHKYGGGANELAPGYNKGVGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  204

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DK WDD WIFWVGPFVGA
Sbjct  205  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNEDKPWDDHWIFWVGPFVGA  261



>dbj|BAF32141.1| putative aquaporin [Taxodium distichum]
Length=274

 Score =   323 bits (828),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+YMVAQCLGAICG GL
Sbjct  70   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGVGL  129

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK++Y  +GGGAN +  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  130  VKAFQKSFYDMHGGGANSVAQGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  189

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGA  125
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG DK WDDQWIFWVGPF+GA
Sbjct  190  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGA  246



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   323 bits (829),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA+ YM AQCLGAICGCGL
Sbjct  81   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIFYMGAQCLGAICGCGL  140

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  141  VKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHIPV  200

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ +DK WDD WIFWVGPF+GAA +
Sbjct  201  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQDKIWDDHWIFWVGPFIGAAIA  260



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL RA  YMVAQCLGAICG GL
Sbjct  84   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLPRAFFYMVAQCLGAICGVGL  143

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ++YY RY GGAN +  GY+KG GL AEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  144  VKAFQRSYYHRYEGGANMVAPGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHVPV  203

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG DKAWDDQWIFWVGPFVGAA +
Sbjct  204  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGADKAWDDQWIFWVGPFVGAAIA  263



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAICG GL
Sbjct  82   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGL  141

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VK FQK +Y + GGGAN L  GY+KG GLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  142  VKGFQKTHYNQNGGGANELAPGYNKGVGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPV  201

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY +DKAWDDQWIFWVGPF+GAA +
Sbjct  202  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIA  261



>emb|CBI31462.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   320 bits (820),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  634  MIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKA  455
            MIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YMVAQCLGAICG GLVKAFQ A
Sbjct  1    MIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSA  60

Query  454  YYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIG  275
            YY RYGGGAN L  GYSKGTGLGAEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIG
Sbjct  61   YYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIG  120

Query  274  FAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            FAVFMVHLATIPITGTGINPARS GAAVIY  +KAWDDQWIFWVGPF+GAA +
Sbjct  121  FAVFMVHLATIPITGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIA  173



>gb|ABX83874.1| plasma membrane intrinsic protein [Rhododendron catawbiense]
Length=284

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAW+ GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA+MYMVAQCLGAICG  L
Sbjct  80   IAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRALMYMVAQCLGAICGVAL  139

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK++Y RYGGGAN L  GYSKGTGL AEIIGTFVLVYTVF+ATDPKR+ARDSHVPV
Sbjct  140  VKAFQKSHYDRYGGGANSLALGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPV  199

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY  DKAW+DQW+FWVGPF+GAA +
Sbjct  200  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWNDQWMFWVGPFIGAAIA  259



>gb|ABK22173.1| unknown [Picea sitchensis]
Length=282

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RAV+YMVAQCLGAICGCGL
Sbjct  78   IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGCGL  137

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQK+YY +YGGGAN +  GY+KG GL AEIIGTFVLVYTVF+ATDPKRNARDSH+PV
Sbjct  138  VKAFQKSYYDQYGGGANSVAHGYTKGVGLSAEIIGTFVLVYTVFSATDPKRNARDSHIPV  197

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAA  122
            LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  K WD+ WIFWVGPF+GAA
Sbjct  198  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGHQKIWDEHWIFWVGPFLGAA  255



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  655  IAWAXGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGL  476
            IAWA GGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICG GL
Sbjct  83   IAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGVGL  142

Query  475  VKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRNARDSHVPV  296
            VKAFQ +YY RYGGGAN L  GYS G G+GAEIIGTFVLVYTVF+ATDPKRNARDSHVPV
Sbjct  143  VKAFQSSYYTRYGGGANSLASGYSVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHVPV  202

Query  295  LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFVGAACS  116
            LAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ ++K WDD WIFWVGPF GAA +
Sbjct  203  LAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFNQEKPWDDHWIFWVGPFAGAAIA  262



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500