BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018L24

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004252682.2|  PREDICTED: phosphoglucan phosphatase LSF1, c...    257   9e-83   
ref|XP_009609248.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    267   1e-81   Nicotiana tomentosiformis
ref|XP_009609247.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    267   1e-81   Nicotiana tomentosiformis
emb|CDP02110.1|  unnamed protein product                                267   2e-81   Coffea canephora [robusta coffee]
ref|XP_006341321.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    265   9e-81   Solanum tuberosum [potatoes]
ref|XP_006341322.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    265   9e-81   Solanum tuberosum [potatoes]
ref|XP_009798354.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    264   1e-80   Nicotiana sylvestris
ref|XP_009798353.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    264   1e-80   Nicotiana sylvestris
gb|KDO37532.1|  hypothetical protein CISIN_1g016234mg                   256   1e-79   Citrus sinensis [apfelsine]
ref|XP_008443522.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    258   2e-79   Cucumis melo [Oriental melon]
emb|CAN61666.1|  hypothetical protein VITISV_037832                     260   2e-79   Vitis vinifera
gb|KDP45338.1|  hypothetical protein JCGZ_09587                         261   4e-79   Jatropha curcas
ref|XP_002274298.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    260   4e-79   Vitis vinifera
ref|XP_011098472.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    260   7e-79   Sesamum indicum [beniseed]
ref|XP_010550123.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    259   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_008443521.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    258   3e-78   Cucumis melo [Oriental melon]
ref|XP_006470325.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    256   4e-78   Citrus sinensis [apfelsine]
ref|XP_010029172.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    254   7e-78   Eucalyptus grandis [rose gum]
ref|XP_006470324.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    256   1e-77   Citrus sinensis [apfelsine]
ref|XP_010314533.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    256   3e-77   Solanum lycopersicum
ref|XP_004252666.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    256   4e-77   Solanum lycopersicum
ref|XP_011047310.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    255   5e-77   Populus euphratica
ref|XP_002524644.1|  protein tyrosine, putative                         253   6e-77   
ref|XP_004141092.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    255   6e-77   Cucumis sativus [cucumbers]
ref|XP_010029171.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    254   9e-77   Eucalyptus grandis [rose gum]
ref|XP_006369912.1|  hypothetical protein POPTR_0001s34940g             254   9e-77   
ref|XP_006408516.1|  hypothetical protein EUTSA_v100203791mg            249   2e-76   
ref|XP_008341455.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    239   2e-76   
gb|KJB11504.1|  hypothetical protein B456_001G262500                    250   2e-76   Gossypium raimondii
ref|XP_010550119.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    253   3e-76   Tarenaya hassleriana [spider flower]
emb|CDX74302.1|  BnaA03g27450D                                          252   4e-76   
ref|XP_004306346.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    253   4e-76   Fragaria vesca subsp. vesca
gb|KJB11506.1|  hypothetical protein B456_001G262500                    251   4e-76   Gossypium raimondii
emb|CDX91945.1|  BnaC03g32470D                                          252   6e-76   
ref|XP_007217168.1|  hypothetical protein PRUPE_ppa003283mg             252   6e-76   Prunus persica
gb|KJB11507.1|  hypothetical protein B456_001G262500                    251   7e-76   Gossypium raimondii
gb|KJB11505.1|  hypothetical protein B456_001G262500                    251   8e-76   Gossypium raimondii
gb|KHG25778.1|  Laforin                                                 251   1e-75   Gossypium arboreum [tree cotton]
ref|XP_008368457.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    241   2e-75   
ref|XP_006297296.1|  hypothetical protein CARUB_v10013312mg             251   2e-75   Capsella rubella
ref|XP_010496304.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    250   4e-75   Camelina sativa [gold-of-pleasure]
gb|EYU44750.1|  hypothetical protein MIMGU_mgv1a003253mg                250   4e-75   Erythranthe guttata [common monkey flower]
ref|XP_010485414.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    250   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010435625.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    249   5e-75   Camelina sativa [gold-of-pleasure]
gb|KCW56022.1|  hypothetical protein EUGRSUZ_I01789                     249   6e-75   Eucalyptus grandis [rose gum]
ref|XP_009134614.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    248   1e-74   Brassica rapa
ref|XP_010108778.1|  hypothetical protein L484_020512                   248   2e-74   Morus notabilis
ref|XP_010243033.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    244   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_008348024.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    248   3e-74   
ref|XP_009134613.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    247   3e-74   Brassica rapa
ref|XP_002882177.1|  hypothetical protein ARALYDRAFT_340294             251   3e-74   
gb|AAM64470.1|  unknown                                                 247   5e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37617.1|  hypothetical protein AALP_AA3G006400                    247   5e-74   Arabis alpina [alpine rockcress]
ref|NP_566139.1|  phosphoglucan phosphatase LSF1                        247   6e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334080.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    247   6e-74   Pyrus x bretschneideri [bai li]
ref|XP_010243032.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    246   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_007031478.1|  hypothetical protein TCM_016888                    244   5e-73   
ref|XP_010667673.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    244   7e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008362141.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    240   1e-72   
gb|KHN09868.1|  Laforin                                                 243   3e-72   Glycine soja [wild soybean]
ref|XP_003555052.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    243   3e-72   Glycine max [soybeans]
ref|XP_003548577.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    242   4e-72   Glycine max [soybeans]
ref|XP_009375103.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    241   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_008353402.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    239   8e-71   
ref|XP_004514819.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    236   1e-69   Cicer arietinum [garbanzo]
gb|EPS70532.1|  hypothetical protein M569_04230                         226   1e-69   Genlisea aurea
ref|XP_007140957.1|  hypothetical protein PHAVU_008G155300g             234   3e-69   Phaseolus vulgaris [French bean]
gb|KEH22222.1|  phosphoglucan phosphatase LSF1                          231   2e-68   Medicago truncatula
ref|XP_006446507.1|  hypothetical protein CICLE_v10017987mg             214   5e-62   
ref|XP_009416558.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    211   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925641.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    204   1e-57   Elaeis guineensis
ref|XP_006844991.1|  hypothetical protein AMTR_s00058p00193720          203   2e-57   
ref|XP_008801813.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    197   4e-55   Phoenix dactylifera
gb|EMS61561.1|  hypothetical protein TRIUR3_07762                       195   5e-55   Triticum urartu
ref|XP_010660911.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    189   3e-52   Vitis vinifera
ref|XP_006660095.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    185   5e-51   
ref|XP_008664711.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    186   7e-51   Zea mays [maize]
ref|XP_004973312.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    183   5e-50   Setaria italica
ref|XP_002444268.1|  hypothetical protein SORBIDRAFT_07g019250          182   8e-50   Sorghum bicolor [broomcorn]
ref|NP_001061690.1|  Os08g0379300                                       182   9e-50   
gb|EAZ06823.1|  hypothetical protein OsI_29062                          182   1e-49   Oryza sativa Indica Group [Indian rice]
gb|AAF01536.1|AC009325_6  unknown protein                               180   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230946.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    178   2e-48   
ref|XP_003572159.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    178   4e-48   Brachypodium distachyon [annual false brome]
gb|EMT07966.1|  hypothetical protein F775_02023                         174   2e-47   
ref|XP_009375104.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...    167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_002994492.1|  hypothetical protein SELMODRAFT_138678             159   1e-42   
ref|XP_002968238.1|  hypothetical protein SELMODRAFT_89622              156   2e-40   
ref|XP_002976142.1|  hypothetical protein SELMODRAFT_151004             155   4e-40   
emb|CDX74300.1|  BnaA03g27470D                                          138   1e-37   
gb|EEE68601.1|  hypothetical protein OsJ_27133                          145   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001782792.1|  predicted protein                                  144   4e-36   
emb|CDX90722.1|  BnaA03g24020D                                          103   2e-24   
ref|XP_006599111.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...  97.1    2e-19   
gb|KEH22223.1|  phosphoglucan phosphatase LSF1                        90.1    5e-17   Medicago truncatula
emb|CAN68082.1|  hypothetical protein VITISV_009198                   87.0    9e-16   Vitis vinifera
gb|EES98801.1|  5'-AMP-activated protein kinase, beta-1 subunit       63.2    1e-08   Giardia intestinalis ATCC 50581
gb|ESU44956.1|  5'-AMP-activated protein kinase, beta subunit         63.2    1e-08   Giardia intestinalis
gb|EFO65042.1|  5'-AMP-activated protein kinase, beta-1 subunit       62.8    2e-08   Giardia lamblia P15
gb|ESU36508.1|  5'-AMP-activated protein kinase, beta subunit         62.8    2e-08   Giardia intestinalis
ref|XP_001705549.1|  5'-AMP-activated protein kinase, beta-1 subunit  62.8    2e-08   Giardia lamblia ATCC 50803
emb|CDW88326.1|  UNKNOWN                                              63.2    3e-08   Stylonychia lemnae
ref|XP_004027169.1|  hypothetical protein IMG5_188500                 61.6    7e-08   Ichthyophthirius multifiliis
emb|CEJ93127.1|  Putative 5'-AMP-activated protein kinase subunit...  59.3    9e-07   Torrubiella hemipterigena
ref|XP_011129375.1|  carbohydrate-binding module family 48 protein    57.0    1e-06   Gregarina niphandrodes
ref|WP_039750562.1|  hypothetical protein                             54.7    2e-06   
ref|XP_002365589.1|  hypothetical protein TGME49_068960               58.2    2e-06   Toxoplasma gondii ME49
gb|KFH16823.1|  putative 5'-AMP-activated protein kinase subunit ...  57.8    2e-06   Toxoplasma gondii MAS
gb|KFG61441.1|  putative 5'-AMP-activated protein kinase subunit ...  57.8    2e-06   Toxoplasma gondii RUB
ref|XP_008882289.1|  5'-AMP-activated protein kinase subunit beta...  57.8    2e-06   
gb|ESS36349.1|  putative 5'-AMP-activated protein kinase subunit ...  57.8    2e-06   Toxoplasma gondii VEG
gb|EPR64878.1|  putative 5'-AMP-activated protein kinase subunit ...  57.8    2e-06   Toxoplasma gondii GT1
emb|CCA39620.1|  Uncharacterized protein YIL024C                      56.2    2e-06   Komagataella phaffii CBS 7435
gb|KFG39189.1|  putative 5'-AMP-activated protein kinase subunit ...  57.8    2e-06   Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|EWS72472.1|  5'-AMP-activated kinase protein                       57.8    2e-06   Tetrahymena thermophila SB210
ref|WP_028831422.1|  hypothetical protein                             57.4    2e-06   
ref|XP_001419967.1|  predicted protein                                57.4    3e-06   Ostreococcus lucimarinus CCE9901
gb|EJY75483.1|  hypothetical protein OXYTRI_03130                     57.0    4e-06   Oxytricha trifallax
ref|XP_006341460.1|  PREDICTED: sucrose nonfermenting 4-like prot...  57.0    4e-06   
ref|XP_003883989.1|  hypothetical protein NCLIV_037390                57.0    4e-06   Neospora caninum Liverpool
ref|XP_004235851.1|  PREDICTED: sucrose nonfermenting 4-like prot...  57.0    4e-06   
ref|XP_001436706.1|  hypothetical protein                             56.6    5e-06   Paramecium tetraurelia strain d4-2
ref|XP_006341457.1|  PREDICTED: sucrose nonfermenting 4-like prot...  56.6    5e-06   Solanum tuberosum [potatoes]
ref|XP_005712562.1|  unnamed protein product                          56.6    5e-06   Chondrus crispus [carageen]
ref|XP_002991568.1|  hypothetical protein SELMODRAFT_8799             53.1    5e-06   
ref|XP_002898489.1|  5'-AMP-activated protein kinase subunit beta...  56.2    6e-06   Phytophthora infestans T30-4
ref|XP_009530626.1|  hypothetical protein PHYSODRAFT_561976           56.2    6e-06   Phytophthora sojae
ref|XP_008908667.1|  hypothetical protein PPTG_13942                  55.8    7e-06   Phytophthora parasitica INRA-310
ref|XP_007742139.1|  hypothetical protein A1O5_03337                  56.2    7e-06   Cladophialophora psammophila CBS 110553
ref|XP_001483033.1|  hypothetical protein PGUG_04988                  55.8    1e-05   Meyerozyma guilliermondii ATCC 6260
gb|EDK40890.2|  hypothetical protein PGUG_04988                       55.8    1e-05   Meyerozyma guilliermondii ATCC 6260
ref|XP_007926520.1|  carbohydrate-binding module family 48 protein    55.8    1e-05   Pseudocercospora fijiensis CIRAD86
ref|XP_002971727.1|  hypothetical protein SELMODRAFT_8796             52.0    1e-05   
emb|CEF97280.1|  5-AMP-activated protein kinase, beta subunit,int...  55.1    1e-05   Ostreococcus tauri
ref|XP_002140642.1|  hypothetical protein                             54.7    2e-05   Cryptosporidium muris RN66
emb|CDJ42280.1|  Prkab2-prov protein, related                         55.1    2e-05   Eimeria tenella
ref|XP_005764492.1|  hypothetical protein EMIHUDRAFT_357467           54.7    2e-05   Emiliania huxleyi CCMP1516
gb|EWS74006.1|  5'-AMP-activated kinase protein                       54.7    2e-05   Tetrahymena thermophila SB210
ref|XP_003331575.2|  hypothetical protein PGTG_13375                  55.1    2e-05   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_005706424.1|  hypothetical protein isoform 1                   53.1    3e-05   Galdieria sulphuraria
gb|EHK45363.1|  carbohydrate-binding module family 48 protein         54.7    3e-05   Trichoderma atroviride IMI 206040
ref|XP_003288810.1|  hypothetical protein DICPUDRAFT_153082           54.3    3e-05   Dictyostelium purpureum
emb|CCI39612.1|  unnamed protein product                              54.7    3e-05   Albugo candida
gb|KIW89308.1|  hypothetical protein Z519_10161                       54.3    4e-05   Cladophialophora bantiana CBS 173.52
ref|XP_005539089.1|  similar to AKIN beta2                            54.3    4e-05   Cyanidioschyzon merolae strain 10D
emb|CCA26507.1|  5'AMPactivated protein kinase subunit beta putative  54.3    4e-05   Albugo laibachii Nc14
ref|XP_007839909.1|  hypothetical protein PFICI_13137                 54.3    4e-05   Pestalotiopsis fici W106-1
emb|CCI39611.1|  unnamed protein product                              54.3    4e-05   Albugo candida
gb|KIO30523.1|  carbohydrate-binding module family 48 protein         53.9    4e-05   Tulasnella calospora MUT 4182
gb|KIY03054.1|  hypothetical protein Z520_01520                       53.9    5e-05   Fonsecaea multimorphosa CBS 102226
gb|KIW28074.1|  hypothetical protein PV07_07758                       53.5    6e-05   Cladophialophora immunda
ref|XP_003717962.1|  hypothetical protein MGG_00987                   53.5    6e-05   Magnaporthe oryzae 70-15
ref|XP_011450447.1|  PREDICTED: 5'-AMP-activated protein kinase s...  53.1    6e-05   Crassostrea gigas
gb|KFA47214.1|  hypothetical protein S40293_06725                     53.5    7e-05   Stachybotrys chartarum IBT 40293
ref|XP_008078409.1|  hypothetical protein GLAREA_10168                53.5    7e-05   Glarea lozoyensis ATCC 20868
gb|KEY66748.1|  hypothetical protein S7711_06794                      53.5    7e-05   Stachybotrys chartarum IBT 7711
gb|KFA73266.1|  hypothetical protein S40288_08616                     53.5    7e-05   Stachybotrys chartarum IBT 40288
gb|EFA86476.1|  putative glycoside hydrolase                          53.1    8e-05   Heterostelium album PN500
ref|XP_001694419.1|  predicted protein                                52.8    8e-05   Chlamydomonas reinhardtii
ref|XP_007768135.1|  carbohydrate-binding module family 48 protein    53.1    8e-05   Coniophora puteana RWD-64-598 SS2
gb|EWC45209.1|  hypothetical protein DRE_06097                        53.1    8e-05   Drechslerella stenobrocha 248
gb|KFA60734.1|  hypothetical protein S40285_04717                     53.1    8e-05   Stachybotrys chlorohalonata IBT 40285
ref|XP_640809.1|  hypothetical protein DDB_G0281089                   52.8    9e-05   Dictyostelium discoideum AX4
ref|XP_003054854.1|  carbohydrate-binding module family 48 protein    52.0    1e-04   Micromonas pusilla CCMP1545
ref|WP_038003049.1|  hypothetical protein                             50.1    1e-04   
gb|EST49374.1|  5'-AMP-activated protein kinase, beta subunit         52.4    1e-04   Spironucleus salmonicida
emb|CCI49792.1|  unnamed protein product                              52.8    1e-04   Albugo candida
ref|XP_002507310.1|  carbohydrate-binding module family 48 protein    52.0    1e-04   Micromonas commoda
emb|CCA27392.1|  5'AMPactivated protein kinase subunit beta putative  52.8    1e-04   Albugo laibachii Nc14
gb|EYU33836.1|  hypothetical protein MIMGU_mgv1a011535mg              52.4    1e-04   Erythranthe guttata [common monkey flower]
gb|AGH32326.1|  5'-AMP-activated protein kinase catalytic subunit...  52.0    1e-04   Cellana toreuma
gb|KEQ76559.1|  hypothetical protein M436DRAFT_78313                  52.8    1e-04   Aureobasidium namibiae CBS 147.97
ref|XP_001745667.1|  hypothetical protein                             52.4    1e-04   Monosiga brevicollis MX1
ref|XP_008868724.1|  hypothetical protein H310_05711                  52.0    1e-04   Aphanomyces invadans
ref|XP_009833767.1|  hypothetical protein, variant                    52.0    2e-04   Aphanomyces astaci
ref|XP_009833768.1|  hypothetical protein H257_09292                  52.0    2e-04   Aphanomyces astaci
ref|XP_002499707.1|  carbohydrate-binding module family 48 protein    52.4    2e-04   Micromonas commoda
ref|XP_001416754.1|  predicted protein                                51.6    2e-04   Ostreococcus lucimarinus CCE9901
ref|XP_005710291.1|  unnamed protein product                          50.8    2e-04   Chondrus crispus [carageen]
ref|XP_001770299.1|  predicted protein                                52.0    2e-04   
ref|XP_003081623.1|  protein kinase, putative (ISS)                   52.0    2e-04   
gb|ESZ97563.1|  carbohydrate-Binding Module family 48 protein         52.0    2e-04   Sclerotinia borealis F-4128
emb|CEF99376.1|  CBS domain                                           52.0    2e-04   Ostreococcus tauri
gb|KIW75206.1|  hypothetical protein Z517_11979                       52.0    2e-04   Fonsecaea pedrosoi CBS 271.37
ref|XP_010249337.1|  PREDICTED: sucrose nonfermenting 4-like prot...  52.0    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009263688.1|  hypothetical protein FPSE_12296                  51.6    2e-04   Fusarium pseudograminearum CS3096
gb|KGU37204.1|  hypothetical protein MGK_01381                        52.0    2e-04   Candida albicans P57055
ref|XP_005703182.1|  5'-AMP-activated protein kinase, regulatory ...  51.6    3e-04   Galdieria sulphuraria
gb|KEQ62310.1|  hypothetical protein M437DRAFT_50344                  52.0    3e-04   Aureobasidium melanogenum CBS 110374
gb|KHC84808.1|  hypothetical protein MGS_01382                        52.0    3e-04   Candida albicans P78042
ref|XP_010551058.1|  PREDICTED: sucrose nonfermenting 4-like protein  51.6    3e-04   Tarenaya hassleriana [spider flower]
gb|EWG40021.1|  hypothetical protein FVEG_02602                       51.6    3e-04   Fusarium verticillioides 7600
ref|XP_002981436.1|  hypothetical protein SELMODRAFT_114544           50.8    3e-04   
ref|XP_003050707.1|  hypothetical protein NECHADRAFT_104398           51.6    3e-04   [Nectria] haematococca mpVI 77-13-4
ref|XP_004980982.1|  PREDICTED: sucrose nonfermenting 4-like prot...  51.6    3e-04   Setaria italica
gb|EGO01584.1|  carbohydrate-binding module family 48 protein         48.5    3e-04   Serpula lacrymans var. lacrymans S7.3
ref|XP_004349217.1|  hypothetical protein CAOG_02467                  50.8    3e-04   Capsaspora owczarzaki ATCC 30864
gb|KGU30630.1|  hypothetical protein MG7_01394                        49.7    3e-04   Candida albicans P34048
gb|KHF98317.1|  Sucrose nonfermenting 4-like protein                  51.2    3e-04   Gossypium arboreum [tree cotton]
gb|KDO18831.1|  hypothetical protein SPRG_15880                       50.8    4e-04   Saprolegnia parasitica CBS 223.65
ref|XP_009026476.1|  hypothetical protein HELRODRAFT_86841            50.4    4e-04   Helobdella robusta
gb|EYB21615.1|  hypothetical protein FG05_09887                       51.2    4e-04   Fusarium graminearum
ref|XP_008611134.1|  hypothetical protein SDRG_07095                  50.8    4e-04   Saprolegnia diclina VS20
gb|KJB26424.1|  hypothetical protein B456_004G240500                  51.2    4e-04   Gossypium raimondii
ref|XP_007807116.1|  hypothetical protein MAC_00776                   51.2    4e-04   Metarhizium acridum CQMa 102
ref|XP_010249336.1|  PREDICTED: sucrose nonfermenting 4-like prot...  51.2    4e-04   Nelumbo nucifera [Indian lotus]
ref|XP_005762051.1|  hypothetical protein EMIHUDRAFT_432923           50.8    4e-04   Emiliania huxleyi CCMP1516
gb|KJB26425.1|  hypothetical protein B456_004G240500                  51.2    4e-04   Gossypium raimondii
emb|CCT68761.1|  uncharacterized protein FFUJ_07574                   51.2    4e-04   Fusarium fujikuroi IMI 58289
gb|EEH08927.1|  conserved hypothetical protein                        51.2    4e-04   Histoplasma capsulatum G186AR
gb|ERT03000.1|  hypothetical protein HMPREF1624_01304                 51.2    4e-04   Sporothrix schenckii ATCC 58251
ref|XP_011073279.1|  PREDICTED: sucrose nonfermenting 4-like protein  50.8    4e-04   Sesamum indicum [beniseed]
gb|AEB14420.1|  glycoside hydrolase family 13 domain protein          48.5    4e-04   Treponema succinifaciens DSM 2489
gb|EPE08216.1|  carbohydrate-binding module family 48 protein         51.2    4e-04   Ophiostoma piceae UAMH 11346
gb|EGU80254.1|  hypothetical protein FOXB_09181                       51.2    5e-04   Fusarium oxysporum Fo5176
gb|EMT63763.1|  5'-AMP-activated protein kinase subunit beta-2        51.2    5e-04   Fusarium oxysporum f. sp. cubense race 4
gb|ENH62746.1|  5'-AMP-activated protein kinase subunit beta-2        51.2    5e-04   Fusarium oxysporum f. sp. cubense race 1
gb|KIH86792.1|  hypothetical protein SPBR_08110                       51.2    5e-04   Sporothrix brasiliensis 5110
dbj|GAM25701.1|  hypothetical protein SAMD00019534_088760             50.4    5e-04   Acytostelium subglobosum LB1
ref|WP_041612028.1|  hypothetical protein                             48.1    5e-04   Treponema succinifaciens
ref|XP_005837329.1|  hypothetical protein GUITHDRAFT_135491           50.1    5e-04   Guillardia theta CCMP2712
gb|EKG12152.1|  hypothetical protein MPH_10716                        50.8    5e-04   Macrophomina phaseolina MS6
ref|XP_003058117.1|  carbohydrate-binding module family 48 protein    50.8    5e-04   Micromonas pusilla CCMP1545
gb|KDP23504.1|  hypothetical protein JCGZ_23337                       50.8    5e-04   Jatropha curcas
gb|ESX02089.1|  hypothetical protein HPODL_04849                      48.9    5e-04   Ogataea parapolymorpha DL-1
gb|EPS61685.1|  hypothetical protein M569_13109                       50.1    6e-04   Genlisea aurea
gb|KHJ31897.1|  putative carbohydrate-binding module family 48 pr...  50.8    6e-04   Erysiphe necator
ref|XP_001588089.1|  hypothetical protein SS1G_10535                  50.8    6e-04   Sclerotinia sclerotiorum 1980 UF-70
gb|KIR45750.1|  hypothetical protein I312_05112                       50.4    6e-04   Cryptococcus gattii CA1280
gb|KGB76162.1|  hypothetical protein CNBG_2000                        50.4    6e-04   Cryptococcus gattii VGII R265
gb|KIR58333.1|  hypothetical protein I314_05959                       50.4    6e-04   Cryptococcus gattii CA1873
ref|XP_001023105.2|  Protein kinase domain containing protein         50.8    6e-04   
gb|KIR28443.1|  hypothetical protein I309_02748                       50.4    6e-04   Cryptococcus gattii VGII LA55
ref|XP_003194559.1|  SNF1-related kinase complex anchoring protei...  50.4    6e-04   Cryptococcus gattii WM276
gb|KIR37920.1|  hypothetical protein I313_06293                       50.4    6e-04   Cryptococcus gattii VGII Ram5
gb|AFR95838.1|  hypothetical protein CNAG_06553                       50.4    6e-04   Cryptococcus neoformans var. grubii H99
ref|XP_006968126.1|  predicted protein                                50.4    7e-04   Trichoderma reesei QM6a
ref|XP_006414362.1|  hypothetical protein EUTSA_v10025902mg           49.3    7e-04   
ref|XP_006357642.1|  PREDICTED: SNF1-related protein kinase regul...  50.1    7e-04   Solanum tuberosum [potatoes]
ref|XP_006650929.1|  PREDICTED: sucrose nonfermenting 4-like prot...  50.4    7e-04   Oryza brachyantha
gb|EHK26537.1|  carbohydrate-binding module family 48 protein         50.4    7e-04   Trichoderma virens Gv29-8
ref|NP_001266176.1|  Tau2                                             50.1    7e-04   Solanum lycopersicum
ref|XP_571430.1|  SNF1-related kinase complex anchoring protein SIP1  50.4    7e-04   Cryptococcus neoformans var. neoformans JEC21
ref|XP_007375905.1|  hypothetical protein SPAPADRAFT_61690            50.4    7e-04   Spathaspora passalidarum NRRL Y-27907
ref|XP_002969965.1|  hypothetical protein SELMODRAFT_170984           50.1    8e-04   Selaginella moellendorffii
gb|KJB68531.1|  hypothetical protein B456_010G248900                  49.3    8e-04   Gossypium raimondii
ref|XP_007798524.1|  putative carbohydrate-binding module family ...  50.4    8e-04   
ref|XP_003955317.1|  hypothetical protein KAFR_0A07480                49.7    8e-04   Kazachstania africana CBS 2517
ref|XP_009620191.1|  PREDICTED: SNF1-related protein kinase regul...  49.7    8e-04   Nicotiana tomentosiformis
ref|XP_010875993.1|  PREDICTED: 5'-AMP-activated protein kinase s...  49.7    8e-04   Esox lucius
ref|XP_010875991.1|  PREDICTED: 5'-AMP-activated protein kinase s...  49.7    9e-04   Esox lucius
gb|KEQ85946.1|  hypothetical protein M438DRAFT_271056                 50.4    9e-04   Aureobasidium pullulans EXF-150
ref|XP_006673650.1|  hypothetical protein CCM_08449                   50.1    9e-04   Cordyceps militaris CM01
ref|NP_001190741.1|  SNF1-related protein kinase regulatory subun...  49.7    0.001   
ref|XP_010875992.1|  PREDICTED: 5'-AMP-activated protein kinase s...  49.7    0.001   Esox lucius
emb|CAB10413.1|  kinase like protein                                  49.7    0.001   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004359166.1|  hypothetical protein DFA_01197                   50.4    0.001   Cavenderia fasciculata
ref|XP_007005423.1|  hypothetical protein TREMEDRAFT_63041            50.1    0.001   Tremella mesenterica DSM 1558
ref|NP_193369.2|  SNF1-related protein kinase regulatory subunit ...  49.7    0.001   
ref|XP_005535074.1|  similar to AMP-activated protein kinase          50.1    0.001   Cyanidioschyzon merolae strain 10D
ref|XP_010875990.1|  PREDICTED: 5'-AMP-activated protein kinase s...  49.7    0.001   Esox lucius
ref|XP_002870164.1|  AMP-activated protein kinase                     49.3    0.001   
gb|EWZ37765.1|  hypothetical protein FOZG_09662                       50.1    0.001   Fusarium oxysporum Fo47
gb|EXL84512.1|  hypothetical protein FOPG_03088                       50.1    0.001   Fusarium oxysporum f. sp. conglutinans race 2 54008
gb|EXA45364.1|  hypothetical protein FOVG_06433                       50.1    0.001   Fusarium oxysporum f. sp. pisi HDV247
gb|EXA45363.1|  hypothetical protein FOVG_06433                       50.1    0.001   Fusarium oxysporum f. sp. pisi HDV247



>ref|XP_004252682.2| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Solanum lycopersicum]
Length=189

 Score =   257 bits (657),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG HDGPATHAVTFVWNG +G++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLS GKY 
Sbjct  45   NGAHDGPATHAVTFVWNGHKGEDVYLVGDFTGNWKEPIQAVHKVGPRFEAEVRLSPGKYL  104

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYII+G WRHST+  TERDERG+ NN+IVVGD+ASVRP + QQTK ANI+KVIERPLTE
Sbjct  105  YKYIISGNWRHSTNFPTERDERGSLNNLIVVGDVASVRPLIPQQTKDANIMKVIERPLTE  164

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFSICPI+LAPK
Sbjct  165  NERFMLAKAARCVAFSICPIKLAPK  189



>ref|XP_009609248.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=588

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G HDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLSQGKY Y
Sbjct  444  GAHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIKAVHKGGPRFEAEVRLSQGKYLY  503

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYII+G WRHST S TERDERGN NNVIVVGD+ASVRP++QQQ K ANI+KVIERPLTEN
Sbjct  504  KYIISGDWRHSTSSPTERDERGNLNNVIVVGDVASVRPTVQQQKKDANIMKVIERPLTEN  563

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICPIRLAPK
Sbjct  564  ERFMLAKAARCVAFSICPIRLAPK  587



>ref|XP_009609247.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=591

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G HDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLSQGKY Y
Sbjct  447  GAHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIKAVHKGGPRFEAEVRLSQGKYLY  506

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYII+G WRHST S TERDERGN NNVIVVGD+ASVRP++QQQ K ANI+KVIERPLTEN
Sbjct  507  KYIISGDWRHSTSSPTERDERGNLNNVIVVGDVASVRPTVQQQKKDANIMKVIERPLTEN  566

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICPIRLAPK
Sbjct  567  ERFMLAKAARCVAFSICPIRLAPK  590



>emb|CDP02110.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +GRHDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFE EVRL QGKYY
Sbjct  464  SGRHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIKAVHKGGPRFEVEVRLPQGKYY  523

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKY+++ QWRHST S TERDERGN NNVIV+GDIASVRPS QQQ K ANI+KVIERPLTE
Sbjct  524  YKYVVSEQWRHSTSSPTERDERGNVNNVIVIGDIASVRPSAQQQKKDANIVKVIERPLTE  583

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFS+CPI+LAPK
Sbjct  584  NERFMLAKAARCVAFSVCPIKLAPK  608



>ref|XP_006341321.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=595

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG HDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLSQGKY 
Sbjct  451  NGAHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIQAVHKGGPRFEAEVRLSQGKYL  510

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYII+G WRHST+S TERDERGN NNVIVVGD+ASVRP +QQQ K ANI+KVIERPLTE
Sbjct  511  YKYIISGNWRHSTNSPTERDERGNLNNVIVVGDVASVRPFIQQQKKDANIMKVIERPLTE  570

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFSICPI LAPK
Sbjct  571  NERFMLAKAARCVAFSICPITLAPK  595



>ref|XP_006341322.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=592

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG HDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLSQGKY 
Sbjct  448  NGAHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIQAVHKGGPRFEAEVRLSQGKYL  507

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYII+G WRHST+S TERDERGN NNVIVVGD+ASVRP +QQQ K ANI+KVIERPLTE
Sbjct  508  YKYIISGNWRHSTNSPTERDERGNLNNVIVVGDVASVRPFIQQQKKDANIMKVIERPLTE  567

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFSICPI LAPK
Sbjct  568  NERFMLAKAARCVAFSICPITLAPK  592



>ref|XP_009798354.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=588

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G HDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLSQGKY Y
Sbjct  444  GAHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIKAVHKGGPRFEAEVRLSQGKYLY  503

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYII+G WRHST S TERDERGN NNVIVVGD+ASVRP++QQQ K A I+KVIERPLTEN
Sbjct  504  KYIISGDWRHSTSSPTERDERGNLNNVIVVGDVASVRPTVQQQKKDATIMKVIERPLTEN  563

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICPI+LAPK
Sbjct  564  ERFMLAKAARCVAFSICPIKLAPK  587



>ref|XP_009798353.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=591

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G HDGPATHAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK GPRFEAEVRLSQGKY Y
Sbjct  447  GAHDGPATHAVTFVWNGHEGEDVYLVGDFTGNWKEPIKAVHKGGPRFEAEVRLSQGKYLY  506

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYII+G WRHST S TERDERGN NNVIVVGD+ASVRP++QQQ K A I+KVIERPLTEN
Sbjct  507  KYIISGDWRHSTSSPTERDERGNLNNVIVVGDVASVRPTVQQQKKDATIMKVIERPLTEN  566

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICPI+LAPK
Sbjct  567  ERFMLAKAARCVAFSICPIKLAPK  590



>gb|KDO37532.1| hypothetical protein CISIN_1g016234mg [Citrus sinensis]
Length=393

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGP THAVTFVWNG EG++V LVGDFTGNWK+PI+A HK G R+E E+RL+QGKYY
Sbjct  249  NGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIRLTQGKYY  308

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI+NGQWRHST S TERD++GN NN+I+VGD ASVRPS+QQ  K AN++KVIERPLTE
Sbjct  309  YKYIVNGQWRHSTISPTERDDKGNVNNIIIVGDTASVRPSIQQPMKDANVVKVIERPLTE  368

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARCIAFS+CPIRL PK
Sbjct  369  NERFMLAKAARCIAFSVCPIRLCPK  393



>ref|XP_008443522.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Cucumis melo]
Length=477

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A HK GPR+EAE++L QGKYY
Sbjct  333  NGRHDGPPTHAVTFVWNGQEGEDVNLVGDFTGNWKEPVKASHKGGPRYEAEMKLPQGKYY  392

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI NGQWRHST S  ERDERGN NNVIV+GD ASVRPS+Q Q K ANI+KVIERPLTE
Sbjct  393  YKYITNGQWRHSTSSPAERDERGNVNNVIVIGDTASVRPSVQPQKKDANIVKVIERPLTE  452

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFS+CPIRL PK
Sbjct  453  NERFMLAKAARCVAFSVCPIRLTPK  477



>emb|CAN61666.1| hypothetical protein VITISV_037832 [Vitis vinifera]
Length=538

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G+HDGPATHAVTFVWNG EG+ VFLVGDFT NWKEPI+AVHK G R+E EVRL+QGKYYY
Sbjct  395  GKHDGPATHAVTFVWNGHEGEEVFLVGDFTANWKEPIKAVHKGGSRYEVEVRLTQGKYYY  454

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I NGQWRHST S TERDER N NNVIVVGDIASVRPS+QQQ K +N++KVIER LTEN
Sbjct  455  KFITNGQWRHSTASPTERDERANVNNVIVVGDIASVRPSIQQQKKDSNVVKVIERQLTEN  514

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARCIAFS+CPIRLAPK
Sbjct  515  ERFMLAKAARCIAFSVCPIRLAPK  538



>gb|KDP45338.1| hypothetical protein JCGZ_09587 [Jatropha curcas]
Length=589

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGPATHAVTFVWNG EG++V LVGDFTGNWKEP++A H  GPR+E EVRLSQGKYY
Sbjct  445  NGRHDGPATHAVTFVWNGHEGEDVSLVGDFTGNWKEPMKASHMGGPRYEVEVRLSQGKYY  504

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI+NGQWRHST S  ERDERGN NNVIV+GD ASVRPS+QQQ K ANI+KVIERPLTE
Sbjct  505  YKYIVNGQWRHSTASPIERDERGNVNNVIVIGDTASVRPSIQQQVKDANILKVIERPLTE  564

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAAR +AFS+CPIRLAPK
Sbjct  565  NERFMLAKAARYVAFSVCPIRLAPK  589



>ref|XP_002274298.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Vitis vinifera]
 emb|CBI34916.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G+HDGPATHAVTFVWNG EG+ VFLVGDFT NWKEPI+AVHK G R+E EVRL+QGKYYY
Sbjct  440  GKHDGPATHAVTFVWNGHEGEEVFLVGDFTANWKEPIKAVHKGGSRYEVEVRLTQGKYYY  499

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I NGQWRHST S TERDER N NNVIVVGDIASVRPS+QQQ K +N++KVIER LTEN
Sbjct  500  KFITNGQWRHSTASPTERDERANVNNVIVVGDIASVRPSIQQQKKDSNVVKVIERQLTEN  559

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARCIAFS+CPIRLAPK
Sbjct  560  ERFMLAKAARCIAFSVCPIRLAPK  583



>ref|XP_011098472.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Sesamum 
indicum]
Length=594

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +GRHDGP+THAVTFVWNG EG++V LVGDFTGNWKEPI+AVHK GPR+E EVRL QGKYY
Sbjct  450  SGRHDGPSTHAVTFVWNGHEGEDVCLVGDFTGNWKEPIKAVHKGGPRYEVEVRLPQGKYY  509

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI NG WRHST S  ERD+RGN NNVIV+GD ASV+PS+QQQ K ANI+KVIERPLTE
Sbjct  510  YKYITNGDWRHSTASPIERDDRGNINNVIVIGDTASVKPSVQQQKKDANIVKVIERPLTE  569

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFS+CPIRLAPK
Sbjct  570  NERFMLAKAARCVAFSVCPIRLAPK  594



>ref|XP_010550123.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=594

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  727  RHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYK  548
            RHDGP THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPR+E EVRL QGKYYYK
Sbjct  452  RHDGPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRYETEVRLPQGKYYYK  511

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENE  368
            YIING WRHST S TERDERGNTNNVIVVGDIASVRPS+Q   K AN+IKVIERPLTENE
Sbjct  512  YIINGNWRHSTASPTERDERGNTNNVIVVGDIASVRPSIQPPKKDANVIKVIERPLTENE  571

Query  367  RFMLAKAARCIAFSICPIRLAPK  299
            RFMLAKAARCIAFS+CPIRL PK
Sbjct  572  RFMLAKAARCIAFSVCPIRLCPK  594



>ref|XP_008443521.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Cucumis melo]
Length=589

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A HK GPR+EAE++L QGKYY
Sbjct  445  NGRHDGPPTHAVTFVWNGQEGEDVNLVGDFTGNWKEPVKASHKGGPRYEAEMKLPQGKYY  504

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI NGQWRHST S  ERDERGN NNVIV+GD ASVRPS+Q Q K ANI+KVIERPLTE
Sbjct  505  YKYITNGQWRHSTSSPAERDERGNVNNVIVIGDTASVRPSVQPQKKDANIVKVIERPLTE  564

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFS+CPIRL PK
Sbjct  565  NERFMLAKAARCVAFSVCPIRLTPK  589



>ref|XP_006470325.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=528

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGP THAVTFVWNG EG++V LVGDFTGNWK+PI+A HK G R+E E+RL++GKYY
Sbjct  384  NGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIRLTKGKYY  443

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI+NGQWRHST S TERD++GN NNVI+VGD ASVRPS+QQ  K AN++KVIERPLTE
Sbjct  444  YKYIVNGQWRHSTISPTERDDKGNVNNVIIVGDTASVRPSIQQPMKDANVVKVIERPLTE  503

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARCIAFS+CPIRL PK
Sbjct  504  NERFMLAKAARCIAFSVCPIRLCPK  528



>ref|XP_010029172.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=477

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            GRHDGPATHAVTFVWNG EG++V LVGDFTGNWKEP++A HK G R+EAE+RL QGKYYY
Sbjct  334  GRHDGPATHAVTFVWNGHEGEDVNLVGDFTGNWKEPVKATHKGGSRYEAEMRLPQGKYYY  393

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYIINGQWRHST+S  ERD+ GN NNVI++GD AS+RPS+QQQ K ANI+KVIERPLTE+
Sbjct  394  KYIINGQWRHSTNSPAERDDSGNVNNVIMIGDTASIRPSVQQQKKDANIVKVIERPLTES  453

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC AFS+CPIRLAPK
Sbjct  454  ERFMLAKAARCFAFSVCPIRLAPK  477



>ref|XP_006470324.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=584

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGP THAVTFVWNG EG++V LVGDFTGNWK+PI+A HK G R+E E+RL++GKYY
Sbjct  440  NGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIRLTKGKYY  499

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI+NGQWRHST S TERD++GN NNVI+VGD ASVRPS+QQ  K AN++KVIERPLTE
Sbjct  500  YKYIVNGQWRHSTISPTERDDKGNVNNVIIVGDTASVRPSIQQPMKDANVVKVIERPLTE  559

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARCIAFS+CPIRL PK
Sbjct  560  NERFMLAKAARCIAFSVCPIRLCPK  584



>ref|XP_010314533.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=620

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G HDGPATHA+TFVWNG EG++V+LVGDFT NWKEPI+AVHK GPRFEAEVRLSQGKY Y
Sbjct  477  GAHDGPATHAITFVWNGHEGEDVYLVGDFTDNWKEPIQAVHKGGPRFEAEVRLSQGKYLY  536

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYII+G WRHS +S TERDERGN NNVIVVGD+ASVRP + QQ K ANI+KVIERPLTEN
Sbjct  537  KYIISGNWRHSANSPTERDERGNLNNVIVVGDVASVRPLIPQQKKDANIMKVIERPLTEN  596

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICPI LAPK
Sbjct  597  ERFMLAKAARCVAFSICPITLAPK  620



>ref|XP_004252666.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=617

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G HDGPATHA+TFVWNG EG++V+LVGDFT NWKEPI+AVHK GPRFEAEVRLSQGKY Y
Sbjct  474  GAHDGPATHAITFVWNGHEGEDVYLVGDFTDNWKEPIQAVHKGGPRFEAEVRLSQGKYLY  533

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYII+G WRHS +S TERDERGN NNVIVVGD+ASVRP + QQ K ANI+KVIERPLTEN
Sbjct  534  KYIISGNWRHSANSPTERDERGNLNNVIVVGDVASVRPLIPQQKKDANIMKVIERPLTEN  593

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICPI LAPK
Sbjct  594  ERFMLAKAARCVAFSICPITLAPK  617



>ref|XP_011047310.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Populus 
euphratica]
Length=587

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  727  RHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYK  548
            RH+GPATHA+TFVW G EG++V LVGDFTGNWKEP++A HK GPR+E EVRL QGKYYYK
Sbjct  445  RHEGPATHALTFVWTGQEGEDVSLVGDFTGNWKEPMKASHKGGPRYEVEVRLPQGKYYYK  504

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENE  368
            YIINGQWRHST S TERDERGN NNV VVGDIASVRPS++QQ K  NI+KVIERPLTENE
Sbjct  505  YIINGQWRHSTASPTERDERGNLNNVAVVGDIASVRPSIKQQKKDVNIVKVIERPLTENE  564

Query  367  RFMLAKAARCIAFSICPIRLAPK  299
            RFMLAKAARC+AFS+CPIRLAPK
Sbjct  565  RFMLAKAARCVAFSVCPIRLAPK  587



>ref|XP_002524644.1| protein tyrosine, putative [Ricinus communis]
 gb|EEF37663.1| protein tyrosine, putative [Ricinus communis]
Length=536

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G HDGPATHAVTFVWNG EG++V LVGDFTGNWKEP++A H  GPR+E EVRL QGKYY
Sbjct  392  SGGHDGPATHAVTFVWNGQEGEDVSLVGDFTGNWKEPMKASHMGGPRYEVEVRLPQGKYY  451

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIINGQWRHST S  ERDERGN NN+IVVGDIA+VRPS+QQ+ K  NI+KVIERPLTE
Sbjct  452  YKYIINGQWRHSTASPIERDERGNVNNIIVVGDIANVRPSIQQKKKDVNIVKVIERPLTE  511

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERF+LAKAARC+AFS+CPIRLAPK
Sbjct  512  NERFVLAKAARCVAFSVCPIRLAPK  536



>ref|XP_004141092.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004158318.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan phosphatase LSF1, 
chloroplastic-like [Cucumis sativus]
 gb|KGN59670.1| hypothetical protein Csa_3G837030 [Cucumis sativus]
Length=589

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A HK GPR+E E++L QGKYY
Sbjct  445  NGRHDGPPTHAVTFVWNGQEGEDVNLVGDFTGNWKEPVKASHKGGPRYEVEMKLPQGKYY  504

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI NGQWRHST S  ERD+RGN NNVI++GD ASVRPS+Q Q K ANI+KVIERPLTE
Sbjct  505  YKYITNGQWRHSTSSPAERDDRGNVNNVIIIGDTASVRPSVQPQKKDANIVKVIERPLTE  564

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFS+CPIRL PK
Sbjct  565  NERFMLAKAARCVAFSVCPIRLTPK  589



>ref|XP_010029171.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Eucalyptus grandis]
 gb|KCW56023.1| hypothetical protein EUGRSUZ_I01789 [Eucalyptus grandis]
Length=584

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            GRHDGPATHAVTFVWNG EG++V LVGDFTGNWKEP++A HK G R+EAE+RL QGKYYY
Sbjct  441  GRHDGPATHAVTFVWNGHEGEDVNLVGDFTGNWKEPVKATHKGGSRYEAEMRLPQGKYYY  500

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYIINGQWRHST+S  ERD+ GN NNVI++GD AS+RPS+QQQ K ANI+KVIERPLTE+
Sbjct  501  KYIINGQWRHSTNSPAERDDSGNVNNVIMIGDTASIRPSVQQQKKDANIVKVIERPLTES  560

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC AFS+CPIRLAPK
Sbjct  561  ERFMLAKAARCFAFSVCPIRLAPK  584



>ref|XP_006369912.1| hypothetical protein POPTR_0001s34940g [Populus trichocarpa]
 ref|XP_006369913.1| hypothetical protein POPTR_0001s34940g [Populus trichocarpa]
 gb|ERP66481.1| hypothetical protein POPTR_0001s34940g [Populus trichocarpa]
 gb|ERP66482.1| hypothetical protein POPTR_0001s34940g [Populus trichocarpa]
Length=590

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  727  RHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYK  548
            RH+GPATHA+TFVW G EG++V LVGDFTGNWKEP++A HK GPR+E EVRL QGKYYYK
Sbjct  448  RHEGPATHALTFVWTGQEGEDVSLVGDFTGNWKEPMKASHKGGPRYEVEVRLPQGKYYYK  507

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENE  368
            YIINGQWRHST S TERDERGN NNV VVGDIASVRPS++QQ K  NI+KVIERPLTENE
Sbjct  508  YIINGQWRHSTASPTERDERGNLNNVAVVGDIASVRPSIKQQKKDINIVKVIERPLTENE  567

Query  367  RFMLAKAARCIAFSICPIRLAPK  299
            RFMLAKAARC+AFS+CPIRLAPK
Sbjct  568  RFMLAKAARCVAFSVCPIRLAPK  590



>ref|XP_006408516.1| hypothetical protein EUTSA_v100203791mg, partial [Eutrema salsugineum]
 gb|ESQ49969.1| hypothetical protein EUTSA_v100203791mg, partial [Eutrema salsugineum]
Length=454

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HD P THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  309  DGKHDEPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  368

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQT-KGANIIKVIERPLT  377
            YKYIING WRHST S TERD+RGNTNN+IVVGD+ASVRP++QQQ  K ANIIKVIER LT
Sbjct  369  YKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVASVRPTVQQQPRKDANIIKVIERMLT  428

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            E+ERF LAKAARCIAFS+CPIRL PK
Sbjct  429  ESERFRLAKAARCIAFSVCPIRLCPK  454



>ref|XP_008341455.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Malus 
domestica]
Length=148

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+H+GP THAV FVWNG EG++V LVGDFT NWKEPIRA +K G R+EAE RLSQGKYY
Sbjct  4    NGKHEGPPTHAVIFVWNGQEGEDVTLVGDFTANWKEPIRANYKGGSRWEAEXRLSQGKYY  63

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NG WRHST S +ERD+ GN NN+I++GD ASVRPS+QQ  K  NI+KVIERPLTE
Sbjct  64   YKFIVNGNWRHSTSSPSERDKSGNVNNIIIIGDTASVRPSVQQPQKDVNIVKVIERPLTE  123

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC++FSICPIRLAPK
Sbjct  124  NERFMLAKAARCVSFSICPIRLAPK  148



>gb|KJB11504.1| hypothetical protein B456_001G262500 [Gossypium raimondii]
Length=476

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            +GRHDGPATHA+TFVWNG  EG++V LVGDFTGNWKEPI+A HK G R+E E+RL QGKY
Sbjct  331  SGRHDGPATHALTFVWNGHNEGEDVCLVGDFTGNWKEPIKATHKGGARYEVEIRLPQGKY  390

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLT  377
            YYKYIING WRHST S TERDERGN NNVI++GD ASVRP++Q Q K AN+IKVIERPLT
Sbjct  391  YYKYIINGNWRHSTSSPTERDERGNINNVIMIGDTASVRPTIQPQQKDANLIKVIERPLT  450

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            ENERFMLAKAARCIAFS+CPIRL PK
Sbjct  451  ENERFMLAKAARCIAFSVCPIRLVPK  476



>ref|XP_010550119.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010550120.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010550121.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010550122.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=596

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = -1

Query  727  RHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYY  554
            RHDGP THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPR+E EVRL QG  +YY
Sbjct  452  RHDGPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRYETEVRLPQGNGRYY  511

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERDERGNTNNVIVVGDIASVRPS+Q   K AN+IKVIERPLTE
Sbjct  512  YKYIINGNWRHSTASPTERDERGNTNNVIVVGDIASVRPSIQPPKKDANVIKVIERPLTE  571

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARCIAFS+CPIRL PK
Sbjct  572  NERFMLAKAARCIAFSVCPIRLCPK  596



>emb|CDX74302.1| BnaA03g27450D [Brassica napus]
Length=574

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HD P THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  430  DGKHDEPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  489

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+IVVGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  490  YKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKVIERVLTE  549

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  550  SERFRLAKAARCIAFSVCPIRLCPK  574



>ref|XP_004306346.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=592

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGPATHAVTFVWNG EG+NV LVGDFT NWKEPI+  HK G R+E EVRLSQGKYY
Sbjct  448  NGKHDGPATHAVTFVWNGQEGENVNLVGDFTNNWKEPIQLNHKGGSRWELEVRLSQGKYY  507

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+N QWRHST S  ERD+ GN NNVI++GD ASVRPS+QQQ K ANIIKVIERPLTE
Sbjct  508  YKFIVNDQWRHSTSSPAERDDSGNVNNVIIIGDTASVRPSVQQQKKDANIIKVIERPLTE  567

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFSICPIRLAPK
Sbjct  568  NERFMLAKAARCVAFSICPIRLAPK  592



>gb|KJB11506.1| hypothetical protein B456_001G262500 [Gossypium raimondii]
Length=544

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            +GRHDGPATHA+TFVWNG  EG++V LVGDFTGNWKEPI+A HK G R+E E+RL QGKY
Sbjct  399  SGRHDGPATHALTFVWNGHNEGEDVCLVGDFTGNWKEPIKATHKGGARYEVEIRLPQGKY  458

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLT  377
            YYKYIING WRHST S TERDERGN NNVI++GD ASVRP++Q Q K AN+IKVIERPLT
Sbjct  459  YYKYIINGNWRHSTSSPTERDERGNINNVIMIGDTASVRPTIQPQQKDANLIKVIERPLT  518

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            ENERFMLAKAARCIAFS+CPIRL PK
Sbjct  519  ENERFMLAKAARCIAFSVCPIRLVPK  544



>emb|CDX91945.1| BnaC03g32470D [Brassica napus]
Length=580

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HD P THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  436  DGKHDEPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  495

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+IVVGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  496  YKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKVIERVLTE  555

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  556  SERFRLAKAARCIAFSVCPIRLCPK  580



>ref|XP_007217168.1| hypothetical protein PRUPE_ppa003283mg [Prunus persica]
 gb|EMJ18367.1| hypothetical protein PRUPE_ppa003283mg [Prunus persica]
Length=587

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG H+GP THAVTFVWNG EG++V LVGDFT NWKEPIRA HK G R+EAEVRLSQGKYY
Sbjct  443  NGMHEGPPTHAVTFVWNGQEGEDVTLVGDFTANWKEPIRANHKGGSRWEAEVRLSQGKYY  502

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NGQWRHST S +ERD+ GN NN+I++GD ASVRPS+QQQ K  N++KVIERPLTE
Sbjct  503  YKFIVNGQWRHSTSSPSERDQSGNVNNIIIIGDTASVRPSVQQQIKDVNVVKVIERPLTE  562

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC++FSICPIRLAPK
Sbjct  563  NERFMLAKAARCVSFSICPIRLAPK  587



>gb|KJB11507.1| hypothetical protein B456_001G262500 [Gossypium raimondii]
Length=550

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            +GRHDGPATHA+TFVWNG  EG++V LVGDFTGNWKEPI+A HK G R+E E+RL QGKY
Sbjct  405  SGRHDGPATHALTFVWNGHNEGEDVCLVGDFTGNWKEPIKATHKGGARYEVEIRLPQGKY  464

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLT  377
            YYKYIING WRHST S TERDERGN NNVI++GD ASVRP++Q Q K AN+IKVIERPLT
Sbjct  465  YYKYIINGNWRHSTSSPTERDERGNINNVIMIGDTASVRPTIQPQQKDANLIKVIERPLT  524

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            ENERFMLAKAARCIAFS+CPIRL PK
Sbjct  525  ENERFMLAKAARCIAFSVCPIRLVPK  550



>gb|KJB11505.1| hypothetical protein B456_001G262500 [Gossypium raimondii]
Length=573

 Score =   251 bits (642),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            +GRHDGPATHA+TFVWNG  EG++V LVGDFTGNWKEPI+A HK G R+E E+RL QGKY
Sbjct  428  SGRHDGPATHALTFVWNGHNEGEDVCLVGDFTGNWKEPIKATHKGGARYEVEIRLPQGKY  487

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLT  377
            YYKYIING WRHST S TERDERGN NNVI++GD ASVRP++Q Q K AN+IKVIERPLT
Sbjct  488  YYKYIINGNWRHSTSSPTERDERGNINNVIMIGDTASVRPTIQPQQKDANLIKVIERPLT  547

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            ENERFMLAKAARCIAFS+CPIRL PK
Sbjct  548  ENERFMLAKAARCIAFSVCPIRLVPK  573



>gb|KHG25778.1| Laforin [Gossypium arboreum]
Length=572

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            +GRHDGPATHA+TFVWNG  EG++V LVGDFTGNWKEPI+A HK G R+E E+RL QGKY
Sbjct  427  SGRHDGPATHALTFVWNGHNEGEDVCLVGDFTGNWKEPIKATHKGGARYEVEIRLPQGKY  486

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLT  377
            YYKYIING WRHST S TERDERGN NNVI++GD ASVRP++Q Q K AN+IKVIERPLT
Sbjct  487  YYKYIINGNWRHSTSSPTERDERGNINNVIMIGDTASVRPTIQPQQKDANLIKVIERPLT  546

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            ENERFMLAKAARCIAFS+CPIRL PK
Sbjct  547  ENERFMLAKAARCIAFSVCPIRLVPK  572



>ref|XP_008368457.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Malus domestica]
Length=255

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+H+GP THAV FVWNG EG++V LVGDFT NWKEPIRA +K G R+EAEVRLSQGKYY
Sbjct  111  NGKHEGPPTHAVIFVWNGQEGEDVTLVGDFTANWKEPIRANYKGGSRWEAEVRLSQGKYY  170

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NG WRHST S +ERD+ GN NN+I++GD ASVRPS+QQ  K  NI+KVIERPLTE
Sbjct  171  YKFIVNGNWRHSTSSPSERDKSGNVNNIIIIGDTASVRPSVQQPQKDVNIVKVIERPLTE  230

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC++FSICPIRLAPK
Sbjct  231  NERFMLAKAARCVSFSICPIRLAPK  255



>ref|XP_006297296.1| hypothetical protein CARUB_v10013312mg [Capsella rubella]
 gb|EOA30194.1| hypothetical protein CARUB_v10013312mg [Capsella rubella]
Length=583

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  439  DGKHDGSPTHSVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  498

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERDERGNTNN+I+VGDIA+VRP++Q+  K ANIIKVIER LTE
Sbjct  499  YKYIINGDWRHSTTSPTERDERGNTNNIIIVGDIANVRPTIQEPRKDANIIKVIERVLTE  558

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  559  SERFRLAKAARCIAFSVCPIRLCPK  583



>ref|XP_010496304.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Camelina 
sativa]
Length=584

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  440  DGKHDGNPTHSVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  499

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+I+VGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  500  YKYIINGDWRHSTTSPTERDDRGNTNNIIIVGDVANVRPTIQQPRKDANIIKVIERVLTE  559

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  560  SERFRLAKAARCIAFSVCPIRLCPK  584



>gb|EYU44750.1| hypothetical protein MIMGU_mgv1a003253mg [Erythranthe guttata]
Length=597

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G  DGP+THAVTFVWNG EG++V LVGDFTGNWKEPI+AVHK GPR+E E+RL QGKYY
Sbjct  453  SGNPDGPSTHAVTFVWNGHEGEDVALVGDFTGNWKEPIKAVHKGGPRYEVEIRLPQGKYY  512

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI NG WRHST S  ERD+ GN NNVIVVGDIASV+PS+QQQ K ANIIKVIERPLTE
Sbjct  513  YKYITNGDWRHSTASPIERDDSGNVNNVIVVGDIASVKPSVQQQKKDANIIKVIERPLTE  572

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AF +CPI+LAPK
Sbjct  573  NERFMLAKAARCVAFGVCPIKLAPK  597



>ref|XP_010485414.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  440  DGKHDGNPTHSVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  499

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+I+VGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  500  YKYIINGDWRHSTTSPTERDDRGNTNNIIIVGDVANVRPTIQQPRKDANIIKVIERVLTE  559

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  560  SERFRLAKAARCIAFSVCPIRLCPK  584



>ref|XP_010435625.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Camelina sativa]
Length=585

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  441  DGKHDGNPTHSVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  500

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+I+VGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  501  YKYIINGDWRHSTTSPTERDDRGNTNNIIIVGDVANVRPTIQQPRKDANIIKVIERVLTE  560

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  561  SERFRLAKAARCIAFSVCPIRLCPK  585



>gb|KCW56022.1| hypothetical protein EUGRSUZ_I01789 [Eucalyptus grandis]
Length=585

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPE-GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            GRHDGPATHAVTFVWNG E G++V LVGDFTGNWKEP++A HK G R+EAE+RL QGKYY
Sbjct  441  GRHDGPATHAVTFVWNGHEVGEDVNLVGDFTGNWKEPVKATHKGGSRYEAEMRLPQGKYY  500

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIINGQWRHST+S  ERD+ GN NNVI++GD AS+RPS+QQQ K ANI+KVIERPLTE
Sbjct  501  YKYIINGQWRHSTNSPAERDDSGNVNNVIMIGDTASIRPSVQQQKKDANIVKVIERPLTE  560

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERFMLAKAARC AFS+CPIRLAPK
Sbjct  561  SERFMLAKAARCFAFSVCPIRLAPK  585



>ref|XP_009134614.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Brassica rapa]
Length=578

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HD P THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  434  DGKHDEPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  493

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+IVVGD+A+VRP++QQ  K  NIIKVIER LTE
Sbjct  494  YKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDENIIKVIERVLTE  553

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIR+ PK
Sbjct  554  SERFRLAKAARCIAFSVCPIRICPK  578



>ref|XP_010108778.1| hypothetical protein L484_020512 [Morus notabilis]
 gb|EXC20293.1| hypothetical protein L484_020512 [Morus notabilis]
Length=583

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGPATHAV FVWNG EG++V LVGDFTGNWKE IRA HK G R+E EVRL QGKYY
Sbjct  439  NGRHDGPATHAVIFVWNGQEGEDVNLVGDFTGNWKETIRANHKGGSRYEVEVRLPQGKYY  498

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI+NGQWRHST S  E+DE GN+NN+IV+GD ASV PS+QQQ K AN++KVIERPLTE
Sbjct  499  YKYIVNGQWRHSTTSPVEKDEGGNSNNLIVIGDTASVWPSVQQQKKDANVVKVIERPLTE  558

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC+AFS+CPIRL PK
Sbjct  559  NERFMLAKAARCVAFSVCPIRLTPK  583



>ref|XP_010243033.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=449

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            GRHDGPA+HAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK G ++E EVRL+ GKY Y
Sbjct  306  GRHDGPASHAVTFVWNGQEGEDVYLVGDFTGNWKEPIKAVHKGGSKYEVEVRLTHGKYRY  365

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I+NG WRHST S TE DERGN NN+I+VGDIASVRPS Q QTK   I+KVIERPLTE 
Sbjct  366  KFIVNGNWRHSTSSPTETDERGNINNIIMVGDIASVRPSFQHQTKDTMIVKVIERPLTEI  425

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICP+ LAPK
Sbjct  426  ERFMLAKAARCVAFSICPVTLAPK  449



>ref|XP_008348024.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Malus domestica]
Length=590

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGP THAVTFVWNG EG++V LVGDFT NWKEPIRA HK G R+EAEVRLSQGKYY
Sbjct  446  NGKHDGPPTHAVTFVWNGQEGEDVTLVGDFTANWKEPIRATHKGGSRWEAEVRLSQGKYY  505

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NG WRHST S +ERD  GN NN+I++GD ASVRPS+QQ  K  NI+KVIERPLTE
Sbjct  506  YKFIVNGNWRHSTLSPSERDGSGNVNNIIIIGDTASVRPSVQQPQKDVNIVKVIERPLTE  565

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC++FSICPIRLAPK
Sbjct  566  NERFMLAKAARCVSFSICPIRLAPK  590



>ref|XP_009134613.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Brassica rapa]
Length=578

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HD P THAVTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  434  DGKHDEPPTHAVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  493

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+IVVGD+A+VRP++QQ  K ANIIK IER LTE
Sbjct  494  YKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKGIERVLTE  553

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            ++RF LAKAARCIAFS+CPIRL PK
Sbjct  554  SQRFRLAKAARCIAFSVCPIRLCPK  578



>ref|XP_002882177.1| hypothetical protein ARALYDRAFT_340294 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58436.1| hypothetical protein ARALYDRAFT_340294 [Arabidopsis lyrata subsp. 
lyrata]
Length=765

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  620  DGKHDGTPTHSVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  679

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHST S TERD+RGNTNN+IVVGD+A+V+P++QQ  K ANIIKVIER LTE
Sbjct  680  YKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVANVKPTIQQPRKDANIIKVIERVLTE  739

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  740  SERFRLAKAARCIAFSVCPIRLCPK  764



>gb|AAM64470.1| unknown [Arabidopsis thaliana]
Length=591

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG+ V LVGDFTGNWKEPI+A HK GPRFE EVRL+QGKYY
Sbjct  446  DGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYY  505

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHS  S TERD+RGNTNN+IVVGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  506  YKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKVIERVLTE  565

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  566  SERFRLAKAARCIAFSVCPIRLCPK  590



>gb|KFK37617.1| hypothetical protein AALP_AA3G006400 [Arabis alpina]
Length=593

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HD P TH+VTFVWNG EG++V LVGDFTGNWKEPI+A HK GPRFE EVRLSQGKYY
Sbjct  449  DGKHDDPPTHSVTFVWNGHEGEDVLLVGDFTGNWKEPIKATHKGGPRFETEVRLSQGKYY  508

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHS+ S TERD+RGNTNN+IVVGD+A++RP++Q+  K ANIIKVIER LTE
Sbjct  509  YKYIINGDWRHSSISPTERDDRGNTNNIIVVGDVANIRPTIQEPRKDANIIKVIERVLTE  568

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  569  SERFRLAKAARCIAFSVCPIRLCPK  593



>ref|NP_566139.1| phosphoglucan phosphatase LSF1 [Arabidopsis thaliana]
 sp|F4J117.1|LSF1_ARATH RecName: Full=Phosphoglucan phosphatase LSF1, chloroplastic; 
AltName: Full=Phosphoglucan phosphatase like sex Four1; AltName: 
Full=Protein LIKE SEX4 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE73678.1| phosphoglucan phosphatase LSF1 [Arabidopsis thaliana]
Length=591

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG+ V LVGDFTGNWKEPI+A HK GPRFE EVRL+QGKYY
Sbjct  446  DGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYY  505

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYIING WRHS  S TERD+RGNTNN+IVVGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct  506  YKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKVIERVLTE  565

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            +ERF LAKAARCIAFS+CPIRL PK
Sbjct  566  SERFRLAKAARCIAFSVCPIRLCPK  590



>ref|XP_009334080.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Pyrus 
x bretschneideri]
Length=590

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGP THAVTFVWNG EG++V LVGDFT NWKEPIRA HK G R+EAEVRLSQGKYY
Sbjct  446  NGKHDGPPTHAVTFVWNGQEGEDVTLVGDFTANWKEPIRATHKGGSRWEAEVRLSQGKYY  505

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NG WRHST S +ERD  GN NN+I++GD ASVRPS+Q   K  NI+KVIERPLTE
Sbjct  506  YKFIVNGNWRHSTLSPSERDGSGNVNNIIIIGDTASVRPSVQHPQKDVNIVKVIERPLTE  565

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARCI+FSICPIRLAPK
Sbjct  566  NERFMLAKAARCISFSICPIRLAPK  590



>ref|XP_010243032.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=595

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            GRHDGPA+HAVTFVWNG EG++V+LVGDFTGNWKEPI+AVHK G ++E EVRL+ GKY Y
Sbjct  452  GRHDGPASHAVTFVWNGQEGEDVYLVGDFTGNWKEPIKAVHKGGSKYEVEVRLTHGKYRY  511

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I+NG WRHST S TE DERGN NN+I+VGDIASVRPS Q QTK   I+KVIERPLTE 
Sbjct  512  KFIVNGNWRHSTSSPTETDERGNINNIIMVGDIASVRPSFQHQTKDTMIVKVIERPLTEI  571

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC+AFSICP+ LAPK
Sbjct  572  ERFMLAKAARCVAFSICPVTLAPK  595



>ref|XP_007031478.1| hypothetical protein TCM_016888 [Theobroma cacao]
 gb|EOY02404.1| hypothetical protein TCM_016888 [Theobroma cacao]
Length=571

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            GRHDGPATHAVTFVWNG EG++V LVGDFT NWKEPI+A HK   + E E+RL  GKYYY
Sbjct  428  GRHDGPATHAVTFVWNGHEGEDVCLVGDFTENWKEPIKATHKGRAKHEVEIRLPHGKYYY  487

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            KYIING WRHST S TERDERGN NNVI++GD ASVRP +Q Q K AN+IKVIERPLTEN
Sbjct  488  KYIINGHWRHSTSSPTERDERGNINNVIMIGDTASVRPIIQPQKKDANVIKVIERPLTEN  547

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ER MLAKAARCIAFS+CPIRLAPK
Sbjct  548  ERIMLAKAARCIAFSVCPIRLAPK  571



>ref|XP_010667673.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=571

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  724  HDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKY  545
            HDGP THAV FVWNG EG++V LVGDFTGNWK+PI+AVHK GPR+E EVRL QGKYYYKY
Sbjct  430  HDGPPTHAVIFVWNGQEGEDVCLVGDFTGNWKDPIKAVHKGGPRYEIEVRLPQGKYYYKY  489

Query  544  IINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENER  365
            I+NG WRHS  S TE D+RGN NNVIV+GD ASVRPS++Q  K ANI+KVIER LTENER
Sbjct  490  IVNGHWRHSNASPTESDDRGNVNNVIVIGDTASVRPSVRQHKKDANIVKVIERQLTENER  549

Query  364  FMLAKAARCIAFSICPIRLAPK  299
            FMLAKAARCIAFSICPIRL PK
Sbjct  550  FMLAKAARCIAFSICPIRLVPK  571



>ref|XP_008362141.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Malus domestica]
Length=449

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+H+GP THAV FVWNG EG++V LVGDFT NWKEPIRA +K G R+EAE RLSQGKYY
Sbjct  305  NGKHEGPPTHAVIFVWNGQEGEDVTLVGDFTANWKEPIRANYKGGSRWEAEXRLSQGKYY  364

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NG WRHST S +ERD+ GN NN+I++GD ASVRPS+QQ  K  NI+KVIERPLTE
Sbjct  365  YKFIVNGNWRHSTSSPSERDKSGNVNNIIIIGDTASVRPSVQQPQKDVNIVKVIERPLTE  424

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC++FSICPIRLAPK
Sbjct  425  NERFMLAKAARCVSFSICPIRLAPK  449



>gb|KHN09868.1| Laforin [Glycine soja]
Length=589

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGP THAV FVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L QGKYY
Sbjct  445  NGRHDGPPTHAVVFVWNGHEGEDVTLVGDFTGNWKEPLKAKHQGGSRHEVEVKLPQGKYY  504

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NGQW+HST S  ERD+RGN NN+IV+G+ ASVRPS+Q Q K AN++KVIERPL E
Sbjct  505  YKFIVNGQWKHSTASPAERDDRGNVNNIIVIGETASVRPSVQHQQKDANVVKVIERPLNE  564

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
             ERFMLAKAARCIAFSICPIRLAPK
Sbjct  565  KERFMLAKAARCIAFSICPIRLAPK  589



>ref|XP_003555052.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Glycine max]
Length=589

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGP THAV FVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L QGKYY
Sbjct  445  NGRHDGPPTHAVVFVWNGHEGEDVTLVGDFTGNWKEPLKAKHQGGSRHEVEVKLPQGKYY  504

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NGQW+HST S  ERD+RGN NN+IV+G+ ASVRPS+Q Q K AN++KVIERPL E
Sbjct  505  YKFIVNGQWKHSTASPAERDDRGNVNNIIVIGETASVRPSVQHQQKDANVVKVIERPLNE  564

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
             ERFMLAKAARCIAFSICPIRLAPK
Sbjct  565  KERFMLAKAARCIAFSICPIRLAPK  589



>ref|XP_003548577.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN27526.1| Laforin [Glycine soja]
Length=585

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NGRHDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L QGKYY
Sbjct  441  NGRHDGPPTHAVTFVWNGHEGEDVTLVGDFTGNWKEPLKAKHQGGSRHEVEVKLPQGKYY  500

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NGQW+HST S  ERD++GN NN+IV+G+ ASVRPS+Q Q K ANI+KVIERPL E
Sbjct  501  YKFIVNGQWKHSTASPAERDDKGNVNNIIVIGETASVRPSVQHQQKDANIVKVIERPLNE  560

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
             ERFMLAKAARCIAFSICPIRL PK
Sbjct  561  KERFMLAKAARCIAFSICPIRLGPK  585



>ref|XP_009375103.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009377217.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=592

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+H+GP THAVTFVWNG EG++V LVGDFT NWKEPIRA +K G R+EAEVRLS+GKYY
Sbjct  448  NGKHEGPPTHAVTFVWNGQEGEDVTLVGDFTANWKEPIRANYKGGSRWEAEVRLSRGKYY  507

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NG WRHST S +ERD  GN NN+I++GD ASVRPS+QQ  K  NI+KVIERPLTE
Sbjct  508  YKFIVNGNWRHSTSSPSERDGSGNVNNIIIIGDTASVRPSVQQPQKDVNIVKVIERPLTE  567

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARC++FSICPIRLAPK
Sbjct  568  NERFMLAKAARCVSFSICPIRLAPK  592



>ref|XP_008353402.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Malus domestica]
Length=591

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G+H+GP THAV FVWNG EG++V LVGDFT NWKEPIRA +K G R+EAE RLSQGKYYY
Sbjct  448  GKHEGPPTHAVIFVWNGQEGEDVTLVGDFTANWKEPIRANYKGGSRWEAEXRLSQGKYYY  507

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I+NG WRHST S +ERD+ GN NN+I++GD ASVRPS+QQ  K  NI+KVIERPLTEN
Sbjct  508  KFIVNGNWRHSTSSPSERDKSGNVNNIIIIGDTASVRPSVQQPQKDVNIVKVIERPLTEN  567

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARC++FSICPIRLAPK
Sbjct  568  ERFMLAKAARCVSFSICPIRLAPK  591



>ref|XP_004514819.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Cicer arietinum]
Length=580

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G+HDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L Q KYYY
Sbjct  437  GKHDGPPTHAVTFVWNGHEGEDVNLVGDFTGNWKEPLKAKHQGGSRHEVEVKLPQAKYYY  496

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I+NGQW+HST S  ERD+ GN NN+IV+G+ ASVRPS+QQQ K AN++KVIERPL E 
Sbjct  497  KFIVNGQWKHSTASPAERDDSGNVNNIIVIGETASVRPSVQQQQKDANVVKVIERPLNEK  556

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
             RFMLAKAARCIAFSICP+RLAPK
Sbjct  557  XRFMLAKAARCIAFSICPVRLAPK  580



>gb|EPS70532.1| hypothetical protein M569_04230, partial [Genlisea aurea]
Length=274

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYII  539
            GP TH+VTFVWNG EG++V LVGDFT NWK+P++A+HK GPR+EAEVRLSQGKYYYKYII
Sbjct  136  GP-THSVTFVWNGVEGEDVCLVGDFTDNWKDPVKAIHKGGPRYEAEVRLSQGKYYYKYII  194

Query  538  NGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENERFM  359
            NG WRHST+S TERD  GN NNVIV+GD+A+V+PS+Q   K AN++KVIER LTENERF+
Sbjct  195  NGNWRHSTNSPTERDPSGNINNVIVLGDVATVKPSIQPINKDANVVKVIERSLTENERFL  254

Query  358  LAKAARCIAFSICPIRLAPK  299
            LAKAARC AFSICP++L PK
Sbjct  255  LAKAARCTAFSICPVKLRPK  274



>ref|XP_007140957.1| hypothetical protein PHAVU_008G155300g [Phaseolus vulgaris]
 gb|ESW12951.1| hypothetical protein PHAVU_008G155300g [Phaseolus vulgaris]
Length=582

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G HDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A  + G R EAEV+L+QGKYY
Sbjct  438  DGEHDGPPTHAVTFVWNGHEGEDVTLVGDFTGNWKEPLKAKFQGGSRHEAEVKLAQGKYY  497

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YK+I+NGQW+HST S  ERD+RGN NN+IV+G+ A+VRPS+Q Q K AN++KVIERPL E
Sbjct  498  YKFIVNGQWKHSTASPAERDDRGNVNNIIVIGETANVRPSVQHQLKDANVVKVIERPLNE  557

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
             ERFMLAKAARCIAFSICPI L+PK
Sbjct  558  KERFMLAKAARCIAFSICPITLSPK  582



>gb|KEH22222.1| phosphoglucan phosphatase LSF1 [Medicago truncatula]
Length=530

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G+HD P THAVTFVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L QGKYYY
Sbjct  388  GQHDAP-THAVTFVWNGHEGEDVNLVGDFTGNWKEPLKAKHRGGSRHEVEVKLPQGKYYY  446

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTEN  371
            K+I+NGQW+HST S  ERD+ GN NN+I++G+ ASVRPS+Q Q K AN++KVIERPL E 
Sbjct  447  KFIVNGQWKHSTSSPAERDDSGNVNNIIMIGETASVRPSVQHQQKDANVVKVIERPLNEK  506

Query  370  ERFMLAKAARCIAFSICPIRLAPK  299
            ERFMLAKAARCIAFSICP+RLAPK
Sbjct  507  ERFMLAKAARCIAFSICPVRLAPK  530



>ref|XP_006446507.1| hypothetical protein CICLE_v10017987mg, partial [Citrus clementina]
 gb|ESR59747.1| hypothetical protein CICLE_v10017987mg, partial [Citrus clementina]
Length=522

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 114/145 (79%), Gaps = 15/145 (10%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+HDGP THAVTFVWNG E                 ++A HK G R+E E+RL+QGKYY
Sbjct  393  NGKHDGPPTHAVTFVWNGQEIQ---------------LKATHKGGSRYEVEIRLTQGKYY  437

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE  374
            YKYI+NGQWRHST S TERD++GN NN+I+VGD ASVRPS+QQ  K AN++KVIERPLTE
Sbjct  438  YKYIVNGQWRHSTISPTERDDKGNVNNIIIVGDTASVRPSIQQPMKDANVVKVIERPLTE  497

Query  373  NERFMLAKAARCIAFSICPIRLAPK  299
            NERFMLAKAARCIAFS+CPIRL PK
Sbjct  498  NERFMLAKAARCIAFSVCPIRLCPK  522



>ref|XP_009416558.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=593

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVW-NGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGK  560
            NG+HDGP THAV FVW NG  EGD VFLVGDFT NWKEPI+AVHK G +FEAE+RL  GK
Sbjct  446  NGKHDGPPTHAVNFVWSNGCREGDEVFLVGDFTNNWKEPIKAVHKGGSKFEAELRLRHGK  505

Query  559  YYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERP  383
            Y YK+IINGQWRHS     E DE GN NNVI VGDIA +RPS    Q K   ++KVIERP
Sbjct  506  YNYKFIINGQWRHSPALPAESDECGNVNNVIGVGDIARIRPSPSHLQIKDPTVVKVIERP  565

Query  382  LTENERFMLAKAARCIAFSICPIRLAPK  299
            LTE+ERFMLA AAR IAFSICPIRLAPK
Sbjct  566  LTEDERFMLAFAARRIAFSICPIRLAPK  593



>ref|XP_010925641.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Elaeis 
guineensis]
Length=595

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 3/148 (2%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVW-NGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGK  560
            NG+H GP THAV FVW NG  EGD V+LVGDF  NWKE I+AVHK G + E E+RL  GK
Sbjct  448  NGKHGGPPTHAVNFVWSNGSREGDEVYLVGDFISNWKESIKAVHKGGSKLEVELRLRHGK  507

Query  559  YYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERP  383
            Y+YK+I+NGQWRHST   TE DE GN NNVI VGDIA +RP+  Q Q K   ++KVIERP
Sbjct  508  YHYKFIVNGQWRHSTALPTETDEHGNVNNVIRVGDIARIRPAPTQLQIKDPTVVKVIERP  567

Query  382  LTENERFMLAKAARCIAFSICPIRLAPK  299
            LTE+ERF+LA AAR IAFSICPI+LAPK
Sbjct  568  LTEDERFLLAFAARRIAFSICPIKLAPK  595



>ref|XP_006844991.1| hypothetical protein AMTR_s00058p00193720 [Amborella trichopoda]
 gb|ERN06666.1| hypothetical protein AMTR_s00058p00193720 [Amborella trichopoda]
Length=609

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGP--EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            G H+GP THAV FVWNG   EG+ VFL+GDFTGNWKE I+A H+ G ++E E+RL QGKY
Sbjct  462  GTHNGPPTHAVKFVWNGGSREGEEVFLIGDFTGNWKESIKADHRGGSKYEVELRLPQGKY  521

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSM--QQQTKGANIIKVIERP  383
             YK+I+ GQWRHST   TE D+ GN NNVI VG++ASVRP+   QQ  K   I+KVIERP
Sbjct  522  SYKFIVGGQWRHSTSLPTETDQTGNVNNVIRVGEVASVRPASPNQQHAKDPMIVKVIERP  581

Query  382  LTENERFMLAKAARCIAFSICPIRLAPK  299
            LTE ERFMLA AAR IAFSICPIRL PK
Sbjct  582  LTEEERFMLACAARLIAFSICPIRLVPK  609



>ref|XP_008801813.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=595

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 113/148 (76%), Gaps = 3/148 (2%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVW-NGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGK  560
            NG+  GP THAV FVW NG  EGD V+LVGDF  NWKE I+AVHK G ++E E+RL  GK
Sbjct  448  NGKRGGPPTHAVNFVWSNGSREGDEVYLVGDFISNWKESIKAVHKGGSKYEVELRLRHGK  507

Query  559  YYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERP  383
            Y+YK+I+NGQWRHS    TE DE GN NNVI VGDIA +RP+  Q Q K   ++KVIERP
Sbjct  508  YHYKFIVNGQWRHSAALPTETDEHGNVNNVIRVGDIARIRPAPTQLQIKDPTVVKVIERP  567

Query  382  LTENERFMLAKAARCIAFSICPIRLAPK  299
            LTE+ERF+LA AAR IA SICP++LAPK
Sbjct  568  LTEDERFLLAFAARRIALSICPVKLAPK  595



>gb|EMS61561.1| hypothetical protein TRIUR3_07762 [Triticum urartu]
Length=504

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++  HK G R+EAEVRL  GKY
Sbjct  357  NGRHDGTPTHSVCFVWNNGREGEDVELVGDFTSNWKDKLKCNHKGGSRYEAEVRLRHGKY  416

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERPL  380
            YYK+I+ G WRHS+   +E DE GN NNVI VGDIA +RP+  Q Q K  +++KVIER L
Sbjct  417  YYKFIVGGNWRHSSSLPSETDEHGNVNNVIRVGDIARIRPAPSQLQIKDPSVVKVIERAL  476

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF LA AAR +AF+ICPIRLAPK
Sbjct  477  TEDERFSLAFAARLMAFAICPIRLAPK  503



>ref|XP_010660911.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic isoform 
X2 [Vitis vinifera]
Length=560

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            G+HDGPATHAVTFVWNG EG+ VFLVGDFT NWKEPI+AVHK G R+E EVRL+QGKYYY
Sbjct  440  GKHDGPATHAVTFVWNGHEGEEVFLVGDFTANWKEPIKAVHKGGSRYEVEVRLTQGKYYY  499

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTK  416
            K+I NGQWRHST S TERDER N NNVIVVGDIASVRPS+QQQ K
Sbjct  500  KFITNGQWRHSTASPTERDERANVNNVIVVGDIASVRPSIQQQKK  544



>ref|XP_006660095.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Oryza brachyantha]
Length=537

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++ +HK G R+EAEVRL  GKY
Sbjct  390  NGRHDGTPTHSVCFVWNSGWEGEDVELVGDFTSNWKDKVKCIHKGGSRYEAEVRLRHGKY  449

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERPL  380
            YYK+I  GQWRHST   TE DERGN NNVI VGDIA +RP+  Q Q +   ++KVIER L
Sbjct  450  YYKFIAGGQWRHSTSLPTETDERGNVNNVIRVGDIARIRPAPSQLQIRDPTVVKVIERAL  509

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF LA AAR +AF+ICPIRL+PK
Sbjct  510  TEDERFSLAFAARRMAFAICPIRLSPK  536



>ref|XP_008664711.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Zea 
mays]
 tpg|DAA49155.1| TPA: hypothetical protein ZEAMMB73_095755 [Zea mays]
Length=596

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V F+WN G EG++V LVGDFT NWK+ IR  HK G R+EAEVRL  GKY
Sbjct  449  NGRHDGSPTHSVCFIWNSGREGEDVELVGDFTSNWKDKIRCSHKGGSRYEAEVRLRHGKY  508

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQ-QTKGANIIKVIERPL  380
            YYK+I+ GQWRHST   TE DE GN NNVI VGDIA +RP+  Q   K  +++KVIER L
Sbjct  509  YYKFIVGGQWRHSTSLPTETDEHGNVNNVIRVGDIARIRPAPSQLHIKDPSVVKVIERAL  568

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF+LA AAR +AF+ICPIRL+PK
Sbjct  569  TEDERFLLAFAARRMAFAICPIRLSPK  595



>ref|XP_004973312.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
[Setaria italica]
Length=594

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 112/147 (76%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ IR  HK G R+EAEVRL  GKY
Sbjct  447  NGRHDGSPTHSVCFVWNSGREGEDVELVGDFTSNWKDKIRCSHKGGSRYEAEVRLRHGKY  506

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERPL  380
            YYK+I+ GQWRHST   TE DE GN NNVI VGDIA +RP+  Q   +   ++KVIER L
Sbjct  507  YYKFIVGGQWRHSTSLPTETDEHGNVNNVIRVGDIARIRPAPSQLHIRDPTVVKVIERAL  566

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF LA AAR +AF+ICPIRL+PK
Sbjct  567  TEDERFSLAFAARRMAFAICPIRLSPK  593



>ref|XP_002444268.1| hypothetical protein SORBIDRAFT_07g019250 [Sorghum bicolor]
 gb|EES13763.1| hypothetical protein SORBIDRAFT_07g019250 [Sorghum bicolor]
Length=602

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 112/147 (76%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ IR  HK G R+EAEVRL  GKY
Sbjct  455  NGRHDGSPTHSVCFVWNSGREGEDVELVGDFTSNWKDKIRCNHKGGSRYEAEVRLRHGKY  514

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQ-QTKGANIIKVIERPL  380
            YYK+I+ GQWRHST   TE DE GN NNVI VGDIA +RP+  Q   K   ++KVIER L
Sbjct  515  YYKFIVGGQWRHSTSLPTETDEHGNVNNVIRVGDIAWIRPAPSQLHIKDPTVVKVIERAL  574

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF LA AAR +AF+ICPIRL+PK
Sbjct  575  TEDERFSLAFAARRMAFAICPIRLSPK  601



>ref|NP_001061690.1| Os08g0379300 [Oryza sativa Japonica Group]
 dbj|BAD05409.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD05629.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23604.1| Os08g0379300 [Oryza sativa Japonica Group]
Length=593

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++  HK G R+EAE+RL  GKY
Sbjct  446  NGRHDGTPTHSVCFVWNSGREGEDVELVGDFTSNWKDKVKCDHKGGSRYEAEIRLRHGKY  505

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQ-QTKGANIIKVIERPL  380
            YYK+I  GQWRHST   TE DE GN NNVI VGDIA +RP+  Q Q +   ++KVIER L
Sbjct  506  YYKFIAGGQWRHSTSLPTETDEHGNVNNVIRVGDIARIRPAPSQLQIRDPTVVKVIERAL  565

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF+LA AAR +AF+ICPIRL+PK
Sbjct  566  TEDERFLLAFAARRMAFAICPIRLSPK  592



>gb|EAZ06823.1| hypothetical protein OsI_29062 [Oryza sativa Indica Group]
Length=598

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++  HK G R+EAE+RL  GKY
Sbjct  451  NGRHDGTPTHSVCFVWNSGREGEDVELVGDFTSNWKDKVKCNHKGGSRYEAEIRLRHGKY  510

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERPL  380
            YYK+I  GQWRHST   TE DE GN NNVI VGDIA +RP+  Q Q +   ++KVIER L
Sbjct  511  YYKFIAGGQWRHSTSLPTETDEHGNVNNVIRVGDIARIRPAPSQLQIRDPTVVKVIERAL  570

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF+LA AAR +AF+ICPIRL+PK
Sbjct  571  TEDERFLLAFAARRMAFAICPIRLSPK  597



>gb|AAF01536.1|AC009325_6 unknown protein [Arabidopsis thaliana]
Length=716

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            +G+HDG  TH+VTFVWNG EG+ V LVGDFTGNWKEPI+A HK GPRFE EVRL+QGKYY
Sbjct  605  DGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYY  664

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTK  416
            YKYIING WRHS  S TERD+RGNTNN+IVVGD+A+VRP++QQ  K
Sbjct  665  YKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRK  710



>ref|XP_008230946.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Prunus 
mume]
Length=526

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG H+GP THAVTFVWNG EG++V LVGDFT NWKEPIRA HK G R+EAEVRLSQGKYY
Sbjct  403  NGVHEGPPTHAVTFVWNGQEGEDVTLVGDFTANWKEPIRANHKGGSRWEAEVRLSQGKYY  462

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTK  416
            YK+I+NGQWRHST S +ERD+ GN NN+I++GD ASVRPS+QQQ K
Sbjct  463  YKFIVNGQWRHSTSSPSERDQSGNVNNIIIIGDTASVRPSVQQQIK  508



>ref|XP_003572159.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic [Brachypodium 
distachyon]
Length=603

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG+ V L+GDFT NWK+ ++  H+ G R EAEVRL  GKY
Sbjct  456  NGRHDGTPTHSVCFVWNNGREGEEVELIGDFTSNWKDKLKCNHQGGSRHEAEVRLRHGKY  515

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKVIERPL  380
            YYK+I+ GQWRHST   +E DE GN NNVI VGDIA +RP+  Q Q +   ++KVIER L
Sbjct  516  YYKFIVGGQWRHSTSLPSETDEHGNVNNVIRVGDIARIRPAPSQLQIRDPTVVKVIERAL  575

Query  379  TENERFMLAKAARCIAFSICPIRLAPK  299
            TE+ERF LA AAR +AF+ICPIRLAPK
Sbjct  576  TEDERFSLAFAARRMAFAICPIRLAPK  602



>gb|EMT07966.1| hypothetical protein F775_02023 [Aegilops tauschii]
Length=500

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 7/152 (5%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--  563
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++  HK G R+EAE        
Sbjct  348  NGRHDGTPTHSVCFVWNNGREGEDVELVGDFTSNWKDKLKCNHKGGSRYEAESYPQVTNP  407

Query  562  ---KYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS-MQQQTKGANIIKV  395
               +YYYK+I+ G WRHS+   +E DE GN NNVI VGDIA +RP+  Q Q K  +++KV
Sbjct  408  YWFRYYYKFIVGGNWRHSSSLPSETDEHGNVNNVIRVGDIARIRPAPSQLQIKDPSVVKV  467

Query  394  IERPLTENERFMLAKAARCIAFSICPIRLAPK  299
            +ER LTE+ERF LA AAR +AF+ICPIRLAPK
Sbjct  468  MERALTEDERFSLAFAARLMAFAICPIRLAPK  499



>ref|XP_009375104.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009377218.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=553

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            NG+H+GP THAVTFVWNG EG++V LVGDFT NWKEPIRA +K G R+EAEVRLS+GKYY
Sbjct  448  NGKHEGPPTHAVTFVWNGQEGEDVTLVGDFTANWKEPIRANYKGGSRWEAEVRLSRGKYY  507

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTK  416
            YK+I+NG WRHST S +ERD  GN NN+I++GD ASVRPS+QQ  K
Sbjct  508  YKFIVNGNWRHSTSSPSERDGSGNVNNIIIIGDTASVRPSVQQPQK  553



>ref|XP_002994492.1| hypothetical protein SELMODRAFT_138678, partial [Selaginella 
moellendorffii]
 gb|EFJ04443.1| hypothetical protein SELMODRAFT_138678, partial [Selaginella 
moellendorffii]
Length=347

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = -1

Query  724  HDGPATHAVTFVWNGPEGDNVFLVGDFTGN-WKEPIRAVHKTGPRFEAEVRLSQGKYYYK  548
            HDGP THAV FVWN  +G+ V +VGDF G  W EPI+A H +GP++  ++R+ QGKY YK
Sbjct  197  HDGPPTHAVQFVWNHAQGEEVLIVGDFKGGGWNEPIKATHASGPKYIVDLRVPQGKYQYK  256

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS---MQQQTKGANIIKVIERPLT  377
            +I+ GQWRHS    TE D  GN NNV+ VG  AS  P         +    +KVIER LT
Sbjct  257  FIVGGQWRHSNSLPTEMDRWGNVNNVLFVGGRASTTPEGVIHSPMPQDLITVKVIERLLT  316

Query  376  ENERFMLAKAARCIAFSICPIRLAPK  299
            E ERF LA AAR +AFS+CP + APK
Sbjct  317  EEERFTLAFAARRLAFSVCPSKFAPK  342



>ref|XP_002968238.1| hypothetical protein SELMODRAFT_89622 [Selaginella moellendorffii]
 gb|EFJ30492.1| hypothetical protein SELMODRAFT_89622 [Selaginella moellendorffii]
Length=581

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 96/148 (65%), Gaps = 6/148 (4%)
 Frame = -1

Query  724  HDGPATHAVTFVWN--GPEGDNVFLVGDFTGN-WKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            HDGP THAV FVWN    EG+ V +VGDF G  W EPI+A H +GP++  ++R+ QGKY 
Sbjct  429  HDGPPTHAVQFVWNHGCKEGEEVLIVGDFKGGGWNEPIKATHASGPKYIVDLRVPQGKYQ  488

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS---MQQQTKGANIIKVIERP  383
            YK+I+ GQWRHS    TE D  GN NNV+ VG  AS  P         +    +KVIER 
Sbjct  489  YKFIVGGQWRHSNSLPTEMDRWGNVNNVLFVGGRASTTPEGVIHSPMPQDLTTVKVIERL  548

Query  382  LTENERFMLAKAARCIAFSICPIRLAPK  299
            LTE ERF LA AAR +AFS+CP + APK
Sbjct  549  LTEEERFTLAFAARRLAFSVCPSKFAPK  576



>ref|XP_002976142.1| hypothetical protein SELMODRAFT_151004 [Selaginella moellendorffii]
 gb|EFJ23047.1| hypothetical protein SELMODRAFT_151004 [Selaginella moellendorffii]
Length=547

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 96/148 (65%), Gaps = 6/148 (4%)
 Frame = -1

Query  724  HDGPATHAVTFVWN--GPEGDNVFLVGDFTGN-WKEPIRAVHKTGPRFEAEVRLSQGKYY  554
            HDGP THAV FVWN    EG+ V +VGDF G  W EPI+A H +GP++  ++R+ QGKY 
Sbjct  395  HDGPPTHAVQFVWNHGCKEGEEVLIVGDFKGGGWNEPIKATHASGPKYIVDLRVPQGKYQ  454

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS---MQQQTKGANIIKVIERP  383
            YK+I+ GQWRHS    TE D  GN NNV+ VG  AS  P         +    +KVIER 
Sbjct  455  YKFIVGGQWRHSNSLPTEMDRWGNVNNVLFVGGRASTTPEGVIHSPMPQDLITVKVIERL  514

Query  382  LTENERFMLAKAARCIAFSICPIRLAPK  299
            LTE ERF LA AAR +AFS+CP + APK
Sbjct  515  LTEEERFTLAFAARRLAFSVCPSKFAPK  542



>emb|CDX74300.1| BnaA03g27470D [Brassica napus]
Length=96

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = -1

Query  574  LSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTK---GANI  404
            LS  KYYYKYIING WRHST S TERD+RGNTNN+IVVGD+A+VRP++QQ  K     + 
Sbjct  2    LSHEKYYYKYIINGDWRHSTTSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKVRCKYHK  61

Query  403  IKVIERPLTENERFMLAKAARCIAFSICPIRLAPK  299
            IKVIER LTE+E F LAKAARCIAFS+CPIR+ PK
Sbjct  62   IKVIERVLTESEMFRLAKAARCIAFSVCPIRIYPK  96



>gb|EEE68601.1| hypothetical protein OsJ_27133 [Oryza sativa Japonica Group]
Length=593

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 93/147 (63%), Gaps = 12/147 (8%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++  HK G R+EAE+RL  GKY
Sbjct  446  NGRHDGTPTHSVCFVWNSGREGEDVELVGDFTSNWKDKVKCDHKGGSRYEAEIRLRHGKY  505

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPS---MQQQTKGANIIKVIER  386
            YYK+I  GQWRHST   TE DE GN NNVI VGDIA +RP+   +Q +    NI      
Sbjct  506  YYKFIAGGQWRHSTSLPTETDEHGNVNNVIRVGDIARIRPAPSQLQIRQNSCNIGTFGAP  565

Query  385  PLTENER--------FMLAKAARCIAF  329
            P   N+          +L+ +++CI  
Sbjct  566  PACSNQLDIAREGLWTLLSSSSQCIQL  592



>ref|XP_001782792.1| predicted protein [Physcomitrella patens]
 gb|EDQ52369.1| predicted protein [Physcomitrella patens]
Length=577

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 12/152 (8%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGP--EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            G+H+G  TH+V FVWN     G+ V +VG+FT +W +PI+A H +G +F   +RL QG+Y
Sbjct  429  GKHEGLPTHSVQFVWNHGCNPGEEVLVVGEFTSDWTKPIKANHVSGTKFAVNLRLPQGRY  488

Query  556  YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVR------PSMQQQTKGANIIKV  395
             YK+I+ G WRH+ +  T+ D+ GN NNVI +GD+A+        P M+  T     IKV
Sbjct  489  MYKFIVGGHWRHAHNLPTDMDQWGNINNVIQIGDVATSNFNNRSGPRMKDPTN----IKV  544

Query  394  IERPLTENERFMLAKAARCIAFSICPIRLAPK  299
            IERPLTE+ERF LA AAR +AFSI PI    K
Sbjct  545  IERPLTEDERFTLAFAARRMAFSISPITFQSK  576



>emb|CDX90722.1| BnaA03g24020D [Brassica napus]
Length=89

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  610  HKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSM  431
            HK GPRFE EVR SQ KYYYKYIING WRHS  S TERD+RGNTNN+IVVGD+A+V P++
Sbjct  20   HKGGPRFETEVRFSQEKYYYKYIINGDWRHSIISPTERDDRGNTNNIIVVGDVANVMPTI  79

Query  430  QQQTK  416
            QQ  K
Sbjct  80   QQPRK  84



>ref|XP_006599111.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like 
isoform X2 [Glycine max]
Length=519

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -1

Query  733  NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGK  560
            NGRHDGP THAVTFVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L QGK
Sbjct  441  NGRHDGPPTHAVTFVWNGHEGEDVTLVGDFTGNWKEPLKAKHQGGSRHEVEVKLPQGK  498



>gb|KEH22223.1| phosphoglucan phosphatase LSF1 [Medicago truncatula]
Length=574

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY  557
            G+HD P THAVTFVWNG EG++V LVGDFTGNWKEP++A H+ G R E EV+L QGKY
Sbjct  494  GQHDAP-THAVTFVWNGHEGEDVNLVGDFTGNWKEPLKAKHRGGSRHEVEVKLPQGKY  550



>emb|CAN68082.1| hypothetical protein VITISV_009198 [Vitis vinifera]
Length=778

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 66/113 (58%), Gaps = 9/113 (8%)
 Frame = -1

Query  682  GPEGDNVF---LVGDF--TGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHS  518
            G E DNVF   +V D    G  +E        G   E    L+  +YYYK+IINGQWRHS
Sbjct  547  GIELDNVFEANVVDDIRGKGEGREAKEKKLLIGLNQENLELLAMKRYYYKFIINGQWRHS  606

Query  517  TDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENERFM  359
            T S  ERDER   NNVI++GDIASV+P +QQQ K   +I     P  EN+R++
Sbjct  607  TASPIERDEREKVNNVIMIGDIASVKPFVQQQKKRFRVIM----PHGENKRYL  655



>gb|EES98801.1| 5'-AMP-activated protein kinase, beta-1 subunit [Giardia intestinalis 
ATCC 50581]
Length=245

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -1

Query  721  DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYK  548
            + PAT  VT  WN P G  V+ +G F  NW E  P++  H +G  F A + L  G Y YK
Sbjct  16   NDPATVEVTVTWNDPSGSAVYCIGSF-NNWSERVPLQRNH-SGTWF-AVLYLPPGIYQYK  72

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVG  458
            +I++G W  + D    RD  GN NNVI + 
Sbjct  73   FIVDGNWVCAPDQPQCRDNDGNLNNVIQIS  102



>gb|ESU44956.1| 5'-AMP-activated protein kinase, beta subunit [Giardia intestinalis]
Length=245

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -1

Query  721  DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYK  548
            + PAT  VT  WN P G  V+ +G F  NW E  P++  H +G  F A + L  G Y YK
Sbjct  16   NDPATVEVTVTWNDPSGSAVYCIGSF-NNWSERVPLQRNH-SGTWF-AVLYLPPGIYQYK  72

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVG  458
            +I++G W  + D    RD  GN NNVI + 
Sbjct  73   FIVDGNWVCAPDQPQCRDNDGNLNNVIQIS  102



>gb|EFO65042.1| 5'-AMP-activated protein kinase, beta-1 subunit [Giardia lamblia 
P15]
Length=245

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -1

Query  721  DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYK  548
            + PAT  VT  WN P G  V+ +G F  NW E  P++  H +G  F A + L  G Y YK
Sbjct  16   NDPATVEVTVTWNDPNGSAVYCIGSF-NNWTERLPLQRNH-SGTWF-AVLYLPPGIYQYK  72

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVG  458
            +I++G W  + D    RD  GN NNVI + 
Sbjct  73   FIVDGNWVCAPDQPQCRDNDGNLNNVIQIS  102



>gb|ESU36508.1| 5'-AMP-activated protein kinase, beta subunit [Giardia intestinalis]
Length=245

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -1

Query  721  DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYK  548
            + PAT  VT  WN P G  V+ +G F  NW E  P++  H +G  F A + L  G Y YK
Sbjct  16   NDPATVEVTVTWNDPNGSAVYCIGSF-NNWTERLPLQRNH-SGTWF-AVLYLPPGIYQYK  72

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVG  458
            +I++G W  + D    RD  GN NNVI + 
Sbjct  73   FIVDGNWVCAPDQPQCRDNDGNLNNVIQIS  102



>ref|XP_001705549.1| 5'-AMP-activated protein kinase, beta-1 subunit [Giardia lamblia 
ATCC 50803]
 gb|EDO77875.1| 5-AMP-activated protein kinase, beta-1 subunit [Giardia lamblia 
ATCC 50803]
Length=245

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = -1

Query  721  DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYK  548
            + PAT  VT  WN P G  V+ +G F  NW E  P++  H +G  F A + L  G Y YK
Sbjct  16   NDPATVEVTVTWNDPNGSAVYCIGSF-NNWTERLPLQRNH-SGTWF-AVLYLPPGIYQYK  72

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVG  458
            +I++G W  + D    RD  GN NNVI + 
Sbjct  73   FIVDGNWVCAPDQPQCRDNDGNLNNVIQIS  102



>emb|CDW88326.1| UNKNOWN [Stylonychia lemnae]
Length=335

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F WN   G NV L+G F+  W+E I  + K G  F     L +G ++YK+II+G+W+ + 
Sbjct  90   FTWNF-GGQNVMLIGSFS-KWQERI-PMKKMGNEFTLVKALERGIHFYKFIIDGEWKFAP  146

Query  514  DSATERDERGNTNNVIVVGDIASVRPSM  431
            D  T+RD  GN NN I     A V+ S+
Sbjct  147  DQPTQRDNNGNINNFIDTTHYAPVQQSL  174



>ref|XP_004027169.1| hypothetical protein IMG5_188500 [Ichthyophthirius multifiliis]
 gb|EGR27824.1| hypothetical protein IMG5_188500 [Ichthyophthirius multifiliis]
Length=304

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 3/96 (3%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY  551
             + D P  +   F WN   G  V++ G FT NW   ++ + K G  F   V+L    Y Y
Sbjct  30   SKKDQPNLYNTIFKWNF-GGSTVYVTGTFT-NWINHVQ-LQKQGQEFSVCVKLPPDVYQY  86

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASV  443
            K+I++G+WR S D     DE GN NN+I    I  V
Sbjct  87   KFIVDGEWRFSPDDNQSTDENGNINNIIDTTKIKQV  122



>emb|CEJ93127.1| Putative 5'-AMP-activated protein kinase subunit beta-2 [Torrubiella 
hemipterigena]
Length=535

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 5/103 (5%)
 Frame = -1

Query  703  AVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQ  530
            A TF W  P  + V++ G F  NW + ++ + K GP F+  V L  +  K YYK++++  
Sbjct  3    AYTFKWEHP-AEEVYVTGTF-DNWTKSVK-LDKEGPVFQKTVELGTNSDKIYYKFVVDNN  59

Query  529  WRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANII  401
            W  +  S  E D  GN NN +   D+ +  P++     GA  +
Sbjct  60   WTTNESSPKEADHEGNINNFLTTSDLTATLPAISGIAPGATTL  102



>ref|XP_011129375.1| carbohydrate-binding module family 48 protein [Gregarina niphandrodes]
 gb|EZG78270.1| carbohydrate-binding module family 48 protein [Gregarina niphandrodes]
Length=226

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 62/139 (45%), Gaps = 8/139 (6%)
 Frame = -1

Query  703  AVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWR  524
            +  F W    G  VFL G F  +W   ++ V K G  F   + L +GK+ YK++++  W+
Sbjct  72   SCVFTW-AHGGHEVFLTGSF-NDWSARVKMV-KAGHEFVTALELPRGKHSYKFVVDDIWK  128

Query  523  HSTDSATERDERGNTNNVIVVGD-----IASVRPSMQQQTKGANIIKVIERPLTENERFM  359
             + D  T  DE G  NNVI + D        ++P++       +I ++ E         +
Sbjct  129  FAPDQETATDEHGFVNNVIDISDHQHFRCVDLQPTLTNLNFSQDIPELTEYTSDAPAIPL  188

Query  358  LAKAARCIAFSICPIRLAP  302
            L    +C A    P  +AP
Sbjct  189  LFSKVQCPATHPPPPLIAP  207



>ref|WP_039750562.1| hypothetical protein, partial [Hassallia byssoidea]
Length=87

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 2/82 (2%)
 Frame = -1

Query  703  AVTFVWNG-PEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW  527
            AVTF  NG  +   V L GDF  NW E   A+ KT   +E    L+ G Y YK+I++GQW
Sbjct  6    AVTFRLNGHADAHRVILAGDFN-NWNEEQLAMKKTAGGWEVPCVLAPGNYQYKFIVDGQW  64

Query  526  RHSTDSATERDERGNTNNVIVV  461
                 +    ++ G+TN+VI V
Sbjct  65   MTDPLNPHLANQHGHTNSVISV  86



>ref|XP_002365589.1| hypothetical protein TGME49_068960 [Toxoplasma gondii ME49]
 gb|EPT28286.1| 5'-AMP-activated protein kinase subunit beta-1 family protein, 
putative [Toxoplasma gondii ME49]
Length=387

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>gb|KFH16823.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii MAS]
Length=387

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>gb|KFG61441.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii RUB]
Length=387

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>ref|XP_008882289.1| 5'-AMP-activated protein kinase subunit beta-1 family protein, 
putative [Hammondia hammondi]
 gb|KEP66666.1| 5'-AMP-activated protein kinase subunit beta-1 family protein, 
putative [Hammondia hammondi]
Length=387

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>gb|ESS36349.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii VEG]
 gb|KFG52467.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii p89]
 gb|KFH06213.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii VAND]
Length=387

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>gb|EPR64878.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii GT1]
Length=387

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>emb|CCA39620.1| Uncharacterized protein YIL024C [Komagataella pastoris CBS 7435]
Length=189

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 3/78 (4%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG-KYYYKYIINGQWRH  521
            TFVW   E  NV++ G F  NW + I A+ K    F A V L+ G K  +K++++ QW  
Sbjct  6    TFVWPDSEAKNVYVTGTF-DNWSKSI-ALKKKDDLFTATVPLNLGSKIVFKFVVDDQWVV  63

Query  520  STDSATERDERGNTNNVI  467
            S D   E DE+G  NN++
Sbjct  64   SEDEEKETDEQGFLNNIL  81



>gb|KFG39189.1| putative 5'-AMP-activated protein kinase subunit beta-1 family 
protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=387

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G ++YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVEHKIRLNRSGHEFSYIQNLPRGVHHYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>gb|EWS72472.1| 5'-AMP-activated kinase protein [Tetrahymena thermophila SB210]
Length=479

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = -1

Query  694  FVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHS  518
            F W NG   ++V L G F  NW  PI         F+  ++L  G Y YKYI++GQWR S
Sbjct  51   FQWTNG--ANSVQLTGTF-NNWVNPIPLEKVENNCFQVILKLRPGVYQYKYIVDGQWRFS  107

Query  517  TDSATERDERGNTNNVIVVGDI  452
             D  T  DE GN NN+I   +I
Sbjct  108  PDDPTCNDENGNINNLIDTTNI  129



>ref|WP_028831422.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=296

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G+ VF+ G F G WK  I  +H+ G  F     L +GK+ YK++++G+WR S D  T  D
Sbjct  86   GNEVFISGTFNG-WKTKI-PMHRGGNDFTYICSLPRGKHAYKFLVDGEWRFSPDQPTLAD  143

Query  493  ERGNTNNVIVVGDIASVRPSM  431
             +GN NN++   D+ + R ++
Sbjct  144  AQGNVNNLL---DLTNFRSTL  161



>ref|XP_001419967.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98260.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=482

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 46/101 (46%), Gaps = 5/101 (5%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAV---HKTGPR-FEAEVRLSQGKYYYKYIINGQW  527
            F W     +NV L G FT NW E +      H  G R F     L  G + YK+I++GQW
Sbjct  13   FQWTYAGANNVHLCGSFT-NWLETVPMACETHGDGNRVFTVMCDLPPGYHQYKFIVDGQW  71

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANI  404
            RH  + A  +D  GN NN + V       P M    + A +
Sbjct  72   RHDENQAFIQDPLGNVNNWLYVKPAGGATPPMSSAPRTAEM  112



>gb|EJY75483.1| hypothetical protein OXYTRI_03130 [Oxytricha trifallax]
Length=371

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 12/122 (10%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            + F WN   G NV L+G F   W+E I+ + K G  F     L +G + YK+I++  WR 
Sbjct  132  IVFTWNF-GGQNVCLIGSFNK-WQERIQ-MKKNGNEFTLVKTLERGVHTYKFIVDNDWRF  188

Query  520  STDSATERDERGNTNNVIVVGDIASVR--PSMQQQTKGANIIKVIERPLTENERFMLAKA  347
            + D  T RD  GN NN I   + A V   P  Q Q + +       +  T+N+ +  A+A
Sbjct  189  APDQPTCRDSNGNINNFIDTTNYAPVTQAPLTQSQAQPS-------QRNTDNQAYNHAQA  241

Query  346  AR  341
             R
Sbjct  242  QR  243



>ref|XP_006341460.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X4 [Solanum tuberosum]
Length=380

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 4/103 (4%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW  527
            VTF W+   G +VFL G F G W E  P+  V  +   F+  V L  G + YK++++G W
Sbjct  4    VTFTWSH-GGTHVFLCGSFDG-WSEQIPMNLVEDSAAVFQRTVDLPPGYHKYKFLVDGIW  61

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIK  398
            +   D    +DE G  NN++ V +  S+  ++ ++   + ++ 
Sbjct  62   QVDQDQLCVQDEYGAINNLVFVKESVSMPSTLIREDAQSKLVS  104



>ref|XP_003883989.1| hypothetical protein NCLIV_037390 [Neospora caninum Liverpool]
 emb|CBZ53957.1| hypothetical protein NCLIV_037390 [Neospora caninum Liverpool]
Length=383

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
              F W    G NVFL G F G   E    ++++G  F     L +G + YK+I++ QW++
Sbjct  108  CVFTWTH-GGHNVFLTGSFNGWSVENKIRLNRSGHEFSYIQNLPRGVHLYKFIVDDQWKY  166

Query  520  STDSATERDERGNTNNVIVVGDIAS  446
            + D  T+ DE GN NNV+   DI+S
Sbjct  167  APDQQTQTDEHGNVNNVL---DISS  188



>ref|XP_004235851.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Solanum 
lycopersicum]
Length=466

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW  527
            +TF W+   G +VFL G F G W E  P+  V  +   F+  V +  G + YK++++G W
Sbjct  4    LTFTWSH-GGIHVFLCGSFDG-WSEQIPMNLVEGSAAVFQRTVDVPPGYHKYKFLVDGIW  61

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIK  398
            +   D    +DE G  NN++ V D  S+  ++ ++   +N++ 
Sbjct  62   QVDQDQLCVQDEYGAINNLVFVEDSVSMPSALIREDAQSNLVS  104



>ref|XP_001436706.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK69309.1| unnamed protein product [Paramecium tetraurelia]
Length=287

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F WN   G  VF+ G F+  WK   +     G  F   + L +G ++YK+I++G WR S 
Sbjct  51   FKWNF-GGQKVFVAGTFS-QWKTTHQLQRDKGGEFSIVIPLPKGIHHYKFIVDGDWRFSP  108

Query  514  DSATERDERGNTNNVI  467
            D  T  DE GN NNVI
Sbjct  109  DDPTTADEHGNINNVI  124



>ref|XP_006341457.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Solanum tuberosum]
Length=465

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 4/103 (4%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW  527
            VTF W+   G +VFL G F G W E  P+  V  +   F+  V L  G + YK++++G W
Sbjct  4    VTFTWSHG-GTHVFLCGSFDG-WSEQIPMNLVEDSAAVFQRTVDLPPGYHKYKFLVDGIW  61

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIK  398
            +   D    +DE G  NN++ V +  S+  ++ ++   + ++ 
Sbjct  62   QVDQDQLCVQDEYGAINNLVFVKESVSMPSTLIREDAQSKLVS  104



>ref|XP_005712562.1| unnamed protein product [Chondrus crispus]
 emb|CDF32761.1| unnamed protein product [Chondrus crispus]
Length=446

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPR-FEAEVRLSQGKYYYKYIINGQWRHS  518
            F+W+   G +V++ G +  +W+    A+ +T P  F A + L  G + YK+I++G W+HS
Sbjct  47   FIWSF-GGSSVYVTGAW-DDWRVK-AALSRTSPTDFTAVLALPVGTFQYKFIVDGNWKHS  103

Query  517  TDSATERDERGNTNNVIVV  461
                TERD+ GN NN++VV
Sbjct  104  PALPTERDQHGNLNNIVVV  122



>ref|XP_002991568.1| hypothetical protein SELMODRAFT_8799, partial [Selaginella moellendorffii]
 gb|EFJ07322.1| hypothetical protein SELMODRAFT_8799, partial [Selaginella moellendorffii]
Length=79

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (54%), Gaps = 3/80 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W G +   V L GDF   W++ +         F+ + +L+ G Y YK+I++GQW HS 
Sbjct  2    FSWKG-QASEVLLTGDFL-EWQKQVPLEKSPDGTFQIK-QLAPGSYKYKFIVDGQWMHSP  58

Query  514  DSATERDERGNTNNVIVVGD  455
            DS T  D  G  NN ++V +
Sbjct  59   DSPTASDGTGGFNNELIVAE  78



>ref|XP_002898489.1| 5'-AMP-activated protein kinase subunit beta, putative [Phytophthora 
infestans T30-4]
 gb|EEY62966.1| 5'-AMP-activated protein kinase subunit beta, putative [Phytophthora 
infestans T30-4]
Length=285

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NVF+ G F G W +    +H++G  F     L++GK+ YK++++  WR + D  T  D
Sbjct  108  GRNVFITGTFNG-WDKQC-PMHRSGNDFTYIANLTRGKHMYKFVVDDDWRFAPDQLTMAD  165

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D A +
Sbjct  166  VEGNVNNYVDVSDFAPL  182



>ref|XP_009530626.1| hypothetical protein PHYSODRAFT_561976 [Phytophthora sojae]
 gb|EGZ13197.1| hypothetical protein PHYSODRAFT_561976 [Phytophthora sojae]
Length=303

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NVF+ G F G W +    +H++G  F     L++GK+ YK++++  WR + D  T  D
Sbjct  126  GRNVFITGTFNG-WDKQC-PMHRSGNDFTYIANLTRGKHMYKFVVDDDWRFAPDQLTMAD  183

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D A +
Sbjct  184  VEGNVNNYVDVSDFAPL  200



>ref|XP_008908667.1| hypothetical protein PPTG_13942 [Phytophthora parasitica INRA-310]
 gb|ETI42529.1| hypothetical protein F443_12347 [Phytophthora parasitica P1569]
 gb|ETK82553.1| hypothetical protein L915_12068 [Phytophthora parasitica]
 gb|ETL35939.1| hypothetical protein L916_11992 [Phytophthora parasitica]
 gb|ETL89172.1| hypothetical protein L917_11835 [Phytophthora parasitica]
 gb|ETM42428.1| hypothetical protein L914_11906 [Phytophthora parasitica]
 gb|ETN06165.1| hypothetical protein PPTG_13942 [Phytophthora parasitica INRA-310]
 gb|ETO71166.1| hypothetical protein F444_12447 [Phytophthora parasitica P1976]
 gb|ETP12245.1| hypothetical protein F441_12332 [Phytophthora parasitica CJ01A1]
 gb|ETP40374.1| hypothetical protein F442_12264 [Phytophthora parasitica P10297]
Length=307

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NVF+ G F G W +    +H++G  F     L++GK+ YK++++  WR + D  T  D
Sbjct  130  GRNVFITGTFNG-WDKQC-PMHRSGNDFTYIANLTRGKHMYKFVVDDDWRFAPDQLTMAD  187

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D A +
Sbjct  188  VEGNVNNYVDVSDFAPL  204



>ref|XP_007742139.1| hypothetical protein A1O5_03337 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ73576.1| hypothetical protein A1O5_03337 [Cladophialophora psammophila 
CBS 110553]
Length=525

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  PE ++V + G F  +W + ++ + K G  +E EV L +   K +YK+++N QW  
Sbjct  6    FKWPHPEANDVHVTGTF-DDWGKSVK-LDKVGDIWEKEVDLPEADKKIFYKFVVNDQWII  63

Query  520  STDSATERDERGNTNNVIVVGDIASVRPSM  431
              D+  E D RGN NNV++   I   +PSM
Sbjct  64   DPDAPQEDDGRGNVNNVLLPEHI-KPKPSM  92



>ref|XP_001483033.1| hypothetical protein PGUG_04988 [Meyerozyma guilliermondii ATCC 
6260]
Length=619

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = -1

Query  706  HAVTFVWNGPEG-DNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIIN  536
            H   F  + P+G + V L G F  NW + +  V +    FE  V L  S GK  YKY+++
Sbjct  12   HFSVFTNHRPKGPEEVILTGTF-DNWSKSLFLVKQANGSFELTVPLPSSSGKLLYKYVVD  70

Query  535  GQWRHSTDSATERDERGNTNNVIVVGD  455
            G+W+ S D   E+DE G  NNV+   D
Sbjct  71   GEWKLSPDDRIEKDESGIENNVLEESD  97



>gb|EDK40890.2| hypothetical protein PGUG_04988 [Meyerozyma guilliermondii ATCC 
6260]
Length=619

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = -1

Query  706  HAVTFVWNGPEG-DNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIIN  536
            H   F  + P+G + V L G F  NW + +  V +    FE  V L  S GK  YKY+++
Sbjct  12   HFSVFTNHRPKGPEEVILTGTF-DNWSKSLFLVKQANGSFELTVPLPSSSGKLLYKYVVD  70

Query  535  GQWRHSTDSATERDERGNTNNVIVVGD  455
            G+W+ S D   E+DE G  NNV+   D
Sbjct  71   GEWKLSPDDRIEKDESGIENNVLEESD  97



>ref|XP_007926520.1| carbohydrate-binding module family 48 protein [Pseudocercospora 
fijiensis CIRAD86]
 gb|EME83230.1| carbohydrate-binding module family 48 protein [Pseudocercospora 
fijiensis CIRAD86]
Length=679

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQWRH  521
            F W G   D V++ G F  NW + ++ + K     E  V L Q  GK YYK++ +G+W+H
Sbjct  6    FRW-GHRNDVVYVTGTFD-NWSKSVK-LDKKDQVHEKRVNLPQTDGKIYYKFVADGEWKH  62

Query  520  STDSATERDERGNTNNVIVVGDIASVRP  437
               + TE D  GN NNV+   D+  + P
Sbjct  63   DHTAKTETDHEGNVNNVLSPDDLGPIDP  90



>ref|XP_002971727.1| hypothetical protein SELMODRAFT_8796, partial [Selaginella moellendorffii]
 gb|EFJ27476.1| hypothetical protein SELMODRAFT_8796, partial [Selaginella moellendorffii]
Length=79

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 3/80 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W G +   V L GDF   W++ +         F+ + +L+ G Y YK+I++GQW HS 
Sbjct  2    FAWKG-QASEVLLTGDFL-EWQKQVPLEKSPDGTFQIK-QLAPGSYKYKFIVDGQWMHSP  58

Query  514  DSATERDERGNTNNVIVVGD  455
            DS    D  G  NN ++V +
Sbjct  59   DSPMASDGTGGFNNELIVAE  78



>emb|CEF97280.1| 5-AMP-activated protein kinase, beta subunit,interaction domain 
[Ostreococcus tauri]
Length=275

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 4/86 (5%)
 Frame = -1

Query  715  PATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPR-FEAEVRLSQGKYYYKYII  539
            PA   V   W    G++V + G F  NW+   + +HK+G R F   + L  G Y YK+I+
Sbjct  84   PALVPVAINWTQ-GGNSVEVEGSFD-NWQS-RQTLHKSGNREFAIVMSLRPGVYQYKFIV  140

Query  538  NGQWRHSTDSATERDERGNTNNVIVV  461
            +GQW+++ D  T  DE GN NNV+ V
Sbjct  141  DGQWKYAPDQPTMYDEMGNVNNVLEV  166



>ref|XP_002140642.1| hypothetical protein [Cryptosporidium muris RN66]
 gb|EEA06293.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
Length=282

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 13/121 (11%)
 Frame = -1

Query  673  GDNVFLVGDFTG-NWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATER  497
            G+ VF+VG F   N  E I+   + G      V LS+  + YKYI++G+WR+S D   E 
Sbjct  48   GNEVFVVGSFNKWNIDEKIKLC-RNGHDHIIVVELSKDIHCYKYIVDGEWRYSFDDCIET  106

Query  496  DERGNTNNVIVVGDIASVR------PSMQQQTKGANIIK--VIERPLTENERFMLAKAAR  341
            D+ GN NN+I   D+ + R      P+   Q K A+  +   +E P       +L K ++
Sbjct  107  DDNGNVNNII---DLRNYRAPQYFIPNEYYQIKYAHYHQNMPLEYPADAPALPLLLKKSK  163

Query  340  C  338
            C
Sbjct  164  C  164



>emb|CDJ42280.1| Prkab2-prov protein, related [Eimeria tenella]
Length=395

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 6/88 (7%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWK-EPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWR  524
              F W    G  V+L G F  NW  E    ++++G  F     L +G +YYK+I++ QWR
Sbjct  84   CVFTWTH-GGHVVYLTGSFN-NWSVENKFRLNRSGHEFSYIQNLKRGVHYYKFIVDDQWR  141

Query  523  HSTDSATERDERGNTNNVIVVGDIASVR  440
            ++ D  T+ DE GN NNV+   DI+  R
Sbjct  142  YAPDQQTQTDEHGNVNNVL---DISGFR  166



>ref|XP_005764492.1| hypothetical protein EMIHUDRAFT_357467, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD12063.1| hypothetical protein EMIHUDRAFT_357467, partial [Emiliania huxleyi 
CCMP1516]
Length=263

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G +V++ G F   W E I  + ++G      + L  G Y YK+I++ +WR + D  T RD
Sbjct  48   GQSVYVTGSFNA-WGERI-PLRRSGNDCVVCLNLLPGTYQYKFIVDNEWRFAADQPTVRD  105

Query  493  ERGNTNNVIVVGDIAS  446
            E GN NN I V D  S
Sbjct  106  EMGNINNCITVEDQTS  121



>gb|EWS74006.1| 5'-AMP-activated kinase protein [Tetrahymena thermophila SB210]
Length=329

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F WN   G+ V++ G F+ NW   I+ + K G  F   VRL  G + YK+I++G+WR S 
Sbjct  49   FKWNF-GGNTVYVTGTFS-NWVNHIQ-LQKQGQEFSICVRLPPGLHQYKFIVDGEWRFSP  105

Query  514  DSATERDERGNTNNVI  467
            +     DE GN NN+I
Sbjct  106  EDNQTTDENGNINNII  121



>ref|XP_003331575.2| hypothetical protein PGTG_13375 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP87156.2| hypothetical protein PGTG_13375 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=646

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 39/77 (51%), Gaps = 2/77 (3%)
 Frame = -1

Query  688  WNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG-KYYYKYIINGQWRHSTD  512
            W     + V + G F   WK  +    KT  +F A + L  G K  YKY+++G WRH+ +
Sbjct  22   WESSVPERVSIKGSF-DQWKSSLELQKKTSGKFSAPIELEFGSKVSYKYVVDGTWRHNPN  80

Query  511  SATERDERGNTNNVIVV  461
              TE D  GN NNV  V
Sbjct  81   EPTETDSSGNVNNVFQV  97



>ref|XP_005706424.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
 gb|EME29904.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
Length=185

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            FV+     ++V L GD+  NW  PI+  H+ G  +     +  G + +K+I++G+WRHST
Sbjct  77   FVYADGAQEDVLLSGDW-NNWT-PIQMYHEGGGIWSVVTLVPPGTHEFKFIVDGEWRHST  134

Query  514  DSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENE  368
               T   +  + NNV VV    +++P M+  T      K+ E+ LT+++
Sbjct  135  RHPTVGIDEESKNNVRVVKGPPTIQPKMELPT------KISEKDLTDDQ  177



>gb|EHK45363.1| carbohydrate-binding module family 48 protein [Trichoderma atroviride 
IMI 206040]
Length=605

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 44/90 (49%), Gaps = 5/90 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWR  524
            TF W  P  + VF+ G F  NW +    + K G  F+  V L     K YYKY+++G W 
Sbjct  5    TFKWEHP-AEEVFVTGTF-DNWTK-SEQLPKEGDVFQKTVFLKDASQKIYYKYVVDGDWT  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPS  434
             +  S  E D  GN NN I   DI S  P+
Sbjct  62   VNESSPKEADLEGNVNNFITPADILSSDPA  91



>ref|XP_003288810.1| hypothetical protein DICPUDRAFT_153082 [Dictyostelium purpureum]
 gb|EGC34673.1| hypothetical protein DICPUDRAFT_153082 [Dictyostelium purpureum]
Length=339

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W+G  G +V++ G F  NWKE I  ++K+   F     L+ G + YKYI++G+W HST
Sbjct  153  FTWSG-GGKDVYVSGSF-NNWKEKI-PLNKSEKDFTLIYNLTPGVHQYKYIVDGKWIHST  209

Query  514  DSATERDERGNTNNVIVV  461
            +     D +GN  N I V
Sbjct  210  EQPVAADIKGNLLNFIEV  227



>emb|CCI39612.1| unnamed protein product [Albugo candida]
Length=739

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYII  539
            G   +   F W+ P+  +V + G F  NW   I  +H+   +FE  + L  G +++KY +
Sbjct  39   GEGLYPCKFHWSQPDASSVGITGTF-NNWGSQI-PLHRNTTKFEITLFLPAGIHFFKYCV  96

Query  538  NGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIK  398
            +G W++  +     D+ GN NN I V +  S   S   QT    I++
Sbjct  97   DGAWKYDPEIVFAPDQFGNLNNFIRVENAFSQGESTALQTPIKTILR  143



>gb|KIW89308.1| hypothetical protein Z519_10161 [Cladophialophora bantiana CBS 
173.52]
Length=525

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  PE ++V + G F  +W + ++ + K G  +E EV L +   K +YK+++N QW  
Sbjct  6    FKWPHPEANDVHVTGTF-DDWGKSVK-LDKVGDIWEKEVDLPEADKKIFYKFVVNDQWII  63

Query  520  STDSATERDERGNTNNVIVVGDIASVRPSM  431
              ++  E D RGN NNV++   I   +PSM
Sbjct  64   DPEAPQEDDGRGNVNNVLLPEHI-KPKPSM  92



>ref|XP_005539089.1| similar to AKIN beta2 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83053.1| similar to AKIN beta2 [Cyanidioschyzon merolae strain 10D]
Length=540

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (53%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V F W+      V + G F G WK     +H++G  F   + L  G Y YKY+++G+WR+
Sbjct  314  VAFNWHHGAVAGVEVAGSFDG-WKR-RHPLHRSGNAFYILLNLEPGDYQYKYVVDGEWRY  371

Query  520  STDSATERDERGNTNNVIVV  461
            + +    RD  GN NN I V
Sbjct  372  APEQMVARDAHGNVNNFIRV  391



>emb|CCA26507.1| 5'AMPactivated protein kinase subunit beta putative [Albugo laibachii 
Nc14]
Length=802

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F  NW + +  +H++G  F     LS+GK+ YK++++ +WR + D  T  D
Sbjct  610  GRNVCITGTFN-NWSKQM-PMHRSGNDFVYITNLSRGKHAYKFVVDDEWRSAPDQLTVAD  667

Query  493  ERGNTNNVIVVGD  455
              GN NN + V D
Sbjct  668  LDGNVNNYVDVSD  680



>ref|XP_007839909.1| hypothetical protein PFICI_13137 [Pestalotiopsis fici W106-1]
 gb|ETS74653.1| hypothetical protein PFICI_13137 [Pestalotiopsis fici W106-1]
Length=527

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  P    V++ G F G WK+    + K G  FE +V+LS    K YYK++++G W  
Sbjct  6    FKWEHP-ASEVYVTGTFDG-WKK-TEKLEKVGEHFEKQVQLSDASKKIYYKFVVDGNWVT  62

Query  520  STDSATERDERGNTNNVIV  464
               +  E DE GN NNV+ 
Sbjct  63   DHTAHKETDESGNENNVLT  81



>emb|CCI39611.1| unnamed protein product [Albugo candida]
Length=741

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/107 (29%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYII  539
            G   +   F W+ P+  +V + G F  NW   I  +H+   +FE  + L  G +++KY +
Sbjct  41   GEGLYPCKFHWSQPDASSVGITGTFN-NWGSQI-PLHRNTTKFEITLFLPAGIHFFKYCV  98

Query  538  NGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIK  398
            +G W++  +     D+ GN NN I V +  S   S   QT    I++
Sbjct  99   DGAWKYDPEIVFAPDQFGNLNNFIRVENAFSQGESTALQTPIKTILR  145



>gb|KIO30523.1| carbohydrate-binding module family 48 protein [Tulasnella calospora 
MUT 4182]
Length=403

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 56/113 (50%), Gaps = 8/113 (7%)
 Frame = -1

Query  712  ATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVH--KTGPRFEAEVRLSQG-KYYYKYI  542
            +T+   F W GP  + V L G F  NW    R+VH  KT   F A+V+L  G K  YKY+
Sbjct  2    STYDAEFYWFGP-ANEVTLTGSF-DNW---ARSVHMEKTLAGFSAKVKLPYGQKVDYKYV  56

Query  541  INGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERP  383
            ++GQW  + D  T  D +GN NN I+  +     P + +         VI+ P
Sbjct  57   VDGQWAVNEDFPTTYDWQGNINNYIITPNEPEPVPELPKALPTPPPELVIKAP  109



>gb|KIY03054.1| hypothetical protein Z520_01520 [Fonsecaea multimorphosa CBS 
102226]
Length=525

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL-SQGKYYYKYIINGQWRHS  518
            F W  PE ++V + G F  +W + ++ + K G  +E EV L +  K YYK+++N QW   
Sbjct  6    FKWPHPEANDVHVTGTF-DDWGKSVK-LDKVGDIWEKEVDLPTDKKIYYKFVVNDQWIID  63

Query  517  TDSATERDERGNTNNVIVVGDI  452
             ++  E D RGN NNV++  +I
Sbjct  64   PEAPQEDDGRGNVNNVLLPENI  85



>gb|KIW28074.1| hypothetical protein PV07_07758 [Cladophialophora immunda]
Length=533

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  PE ++V + G F  +W + ++ + K G  +E EV L +   K +YK+++N QW  
Sbjct  6    FKWPHPEANDVHVTGTF-DDWGKSVK-LDKVGAIWEKEVDLPKADEKIFYKFVVNDQWII  63

Query  520  STDSATERDERGNTNNVIVVGDI  452
              ++  E D RGN NNV++  +I
Sbjct  64   DPEAPQEDDGRGNVNNVLLPENI  86



>ref|XP_003717962.1| hypothetical protein MGG_00987 [Magnaporthe oryzae 70-15]
 gb|EHA48378.1| hypothetical protein MGG_00987 [Magnaporthe oryzae 70-15]
 gb|ELQ40079.1| hypothetical protein OOU_Y34scaffold00462g33 [Magnaporthe oryzae 
Y34]
 gb|ELQ65075.1| hypothetical protein OOW_P131scaffold00532g10 [Magnaporthe oryzae 
P131]
Length=521

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 5/90 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWR  524
            TF W    G++VF+ G F   WK+ ++ + K G  FE  V L +   K YYK++++GQW 
Sbjct  5    TFKWPN-AGESVFVTGTF-DEWKKTVQ-LDKVGDNFEKTVTLPETTEKIYYKFVVDGQWT  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPS  434
             +  +  E D  G  NNV+   DI    P+
Sbjct  62   VNQAAPKENDASGIENNVLTPEDIIKSAPA  91



>ref|XP_011450447.1| PREDICTED: 5'-AMP-activated protein kinase subunit beta-2-like 
isoform X2 [Crassostrea gigas]
Length=267

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 3/78 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W+G  G  V++ G F  NW++ I  V   G  F   V L +G++ YK++++GQW H  
Sbjct  75   FKWDG-GGKEVYITGTF-NNWQQKIPLVKSHG-DFTTIVDLPEGEHQYKFLVDGQWVHKA  131

Query  514  DSATERDERGNTNNVIVV  461
            +     +++G  NNVI V
Sbjct  132  EEPVVTNDKGTQNNVISV  149



>gb|KFA47214.1| hypothetical protein S40293_06725 [Stachybotrys chartarum IBT 
40293]
Length=561

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 13/118 (11%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFE--AEVRLSQG--KYYYKYIINGQ  530
            TF W+ P  + V++ G F G W + ++ + K G  F+   EV+  +G  K YYKY+++ Q
Sbjct  5    TFKWDQP-AEEVYVTGTFDG-WTKSVK-LDKIGDVFQKTVEVKAPEGASKIYYKYVVDNQ  61

Query  529  WRHSTDSATERDERGNTNNVIVVGDIASVRPS---MQQQTKGANIIKVI-ERPLTENE  368
            W  +  +  E D  GN NN +   D+A+  PS   +   T  +   K+  E+PL ENE
Sbjct  62   WILNESAPKEADHEGNDNNYLSTSDLAA-EPSHAILNNVTADSTTAKLAGEQPL-ENE  117



>ref|XP_008078409.1| hypothetical protein GLAREA_10168 [Glarea lozoyensis ATCC 20868]
 gb|EHL00084.1| putative Signal transduction protein MDG1 [Glarea lozoyensis 
74030]
 gb|EPE34474.1| hypothetical protein GLAREA_10168 [Glarea lozoyensis ATCC 20868]
Length=764

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = -1

Query  703  AVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQ  530
            +  F W+ P  + V++ G F  NW +  + V KTG  FE +V LS    K YYK++++G 
Sbjct  3    SFVFKWDHPASE-VYVTGTFD-NWSKSEKLV-KTGDVFEKDVTLSSAGEKIYYKFVVDGN  59

Query  529  WRHSTDSATERDERGNTNNVIVVGDIASVRP  437
            W     +  E DE GN NNV+    I   +P
Sbjct  60   WVTDHTAPQENDESGNLNNVLTTDRIIKHKP  90



>gb|KEY66748.1| hypothetical protein S7711_06794 [Stachybotrys chartarum IBT 
7711]
Length=561

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 7/88 (8%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFE--AEVRLSQG--KYYYKYIINGQ  530
            TF W+ P  + V++ G F G W + ++ + K G  F+   EV+  +G  K YYKY+++ Q
Sbjct  5    TFKWDQP-AEEVYVTGTFDG-WTKSVK-LDKIGDVFQKTVEVKAPEGASKIYYKYVVDNQ  61

Query  529  WRHSTDSATERDERGNTNNVIVVGDIAS  446
            W  +  +  E D  GN NN +   D+A+
Sbjct  62   WILNESAPKEADHEGNDNNYLSTSDLAA  89



>gb|KFA73266.1| hypothetical protein S40288_08616 [Stachybotrys chartarum IBT 
40288]
Length=561

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 13/118 (11%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFE--AEVRLSQG--KYYYKYIINGQ  530
            TF W+ P  + V++ G F G W + ++ + K G  F+   EV+  +G  K YYKY+++ Q
Sbjct  5    TFKWDQP-AEEVYVTGTFDG-WTKSVK-LDKIGDVFQKTVEVKAPEGASKIYYKYVVDNQ  61

Query  529  WRHSTDSATERDERGNTNNVIVVGDIASVRPS---MQQQTKGANIIKVI-ERPLTENE  368
            W  +  +  E D  GN NN +   D+A+  PS   +   T  +   K+  E+PL ENE
Sbjct  62   WILNESAPKEADHEGNDNNYLSTSDLAA-EPSHAILNNVTADSTTAKLAGEQPL-ENE  117



>gb|EFA86476.1| putative glycoside hydrolase [Polysphondylium pallidum PN500]
Length=374

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 43/85 (51%), Gaps = 5/85 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W G  G  VF+ G F  NWKE I   H     F     L  G + YK+I++G+W HS+
Sbjct  184  FTWAG-GGREVFIAGSF-NNWKEKIPLSHSEK-DFTLIYNLPPGVHQYKFIVDGKWVHSS  240

Query  514  DSATERDERGNTNNVIVV--GDIAS  446
            D     D +GN  N + V   DI+S
Sbjct  241  DQPVAADTKGNLINFVEVKSKDISS  265



>ref|XP_001694419.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02414.1| predicted protein [Chlamydomonas reinhardtii]
Length=298

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  592  FEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVV  461
            FEAEV L  G+Y  K++++G WR ++D  TE DE G TNN+++V
Sbjct  250  FEAEVPLLPGRYRAKFLVDGGWRLASDWPTENDELGETNNILIV  293



>ref|XP_007768135.1| carbohydrate-binding module family 48 protein [Coniophora puteana 
RWD-64-598 SS2]
 gb|EIW82488.1| carbohydrate-binding module family 48 protein [Coniophora puteana 
RWD-64-598 SS2]
Length=409

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 7/82 (9%)
 Frame = -1

Query  706  HAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVH--KTGPRFEAEVRLSQG-KYYYKYIIN  536
            H V+F W      +V L G F   W    R++H  +TG  +E+ V +  G K  YK+I++
Sbjct  5    HEVSFTWPHTNARDVVLTGTF-DKWS---RSIHMSRTGGGYESRVAVPWGEKVAYKFIVD  60

Query  535  GQWRHSTDSATERDERGNTNNV  470
            G+W  S    TERD  GN NNV
Sbjct  61   GRWTTSDQQPTERDRAGNLNNV  82



>gb|EWC45209.1| hypothetical protein DRE_06097 [Drechslerella stenobrocha 248]
Length=598

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 41/86 (48%), Gaps = 2/86 (2%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHS  518
            TF W+ P  D VF+ G F  +WK+  +          + V L   K  YKY+++G W   
Sbjct  7    TFKWSAP-ADEVFVTGSF-DDWKKTEKLAKTVDGTHLSSVELPIEKTTYKYVVDGTWTVD  64

Query  517  TDSATERDERGNTNNVIVVGDIASVR  440
            T    E+D  GN NN ++  DI  V 
Sbjct  65   TSQRIEKDASGNDNNFLLPEDIVPVE  90



>gb|KFA60734.1| hypothetical protein S40285_04717 [Stachybotrys chlorohalonata 
IBT 40285]
Length=589

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 7/88 (8%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFE--AEVRLSQG--KYYYKYIINGQ  530
            TF W+ P  + V++ G F G W + ++ + K G  F+   EV+  +G  K YYKY+++ Q
Sbjct  5    TFKWDQP-AEEVYVTGTFDG-WTKSVK-LDKIGDVFQKTVEVKAPEGASKIYYKYVVDNQ  61

Query  529  WRHSTDSATERDERGNTNNVIVVGDIAS  446
            W  +  +  E D  GN NN +   D+A+
Sbjct  62   WILNESAPKEADHEGNDNNYLSTSDLAT  89



>ref|XP_640809.1| hypothetical protein DDB_G0281089 [Dictyostelium discoideum AX4]
 gb|EAL66841.1| hypothetical protein DDB_G0281089 [Dictyostelium discoideum AX4]
Length=347

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 63/138 (46%), Gaps = 15/138 (11%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W+G  G +V++ G F  NWKE I  + ++   F     L+ G + YKYI++G+W HST
Sbjct  160  FTWSG-GGKDVYVSGSF-NNWKEKI-PLSRSEKDFTLIYNLAPGVHQYKYIVDGKWIHST  216

Query  514  DSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTENERFMLAKAARCI  335
            +     D +GN  N I V +        +  +   N +K+   P     R +  +  +  
Sbjct  217  EQPVAADIKGNLLNFIEVKN--------KDPSNDLNTLKLSSTPPGSYSRTIPEEEVQ--  266

Query  334  AFSICPIRLAPK*RTILL  281
               I P  L P  R  LL
Sbjct  267  --KIPPPSLPPHLRRALL  282



>ref|XP_003054854.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
 gb|EEH60106.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
Length=228

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVR-LSQGKYYYKYIINGQWR  524
            V   WN  +G  V  V     NW+   +A+H++G R  A V+ L  G Y YK+I++G+W+
Sbjct  45   VAINWN--QGGTVVEVEGSFDNWQS-RQALHRSGNREFAVVKMLPPGVYQYKFIVDGEWK  101

Query  523  HSTDSATERDERGNTNNVIVV  461
            ++ D     DE GN NNV+ V
Sbjct  102  YAPDQPAMYDEMGNVNNVLEV  122



>ref|WP_038003049.1| hypothetical protein, partial [Syntrophorhabdus aromaticivorans]
Length=93

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAV--HKTGPRFEAEVRLSQGKYYYKYIINGQW  527
            VTF ++GP+ +  FL GDF  +W    RA+  ++ G R +  + L  G Y YK++I+G W
Sbjct  10   VTFRFHGPDAEKAFLAGDFN-DWNAGTRALKRYEDGTR-KTTISLMPGVYEYKFVIDGDW  67

Query  526  RHSTDSA  506
            RH    A
Sbjct  68   RHDPQCA  74



>gb|EST49374.1| 5'-AMP-activated protein kinase, beta subunit [Spironucleus salmonicida]
Length=240

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 51/98 (52%), Gaps = 8/98 (8%)
 Frame = -1

Query  733  NGRHDGPATHA----VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVR-LS  569
            N +   P+++A    V F W G  G +VF  G F  +W+E I  + +  P      R L 
Sbjct  9    NDQSQLPSSNAPSQLVEFSW-GEGGSSVFFCGSF-NHWRERI-PMQQVQPGVWVGTRELQ  65

Query  568  QGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGD  455
             G Y +K++++GQWR S+     RD  GN NN IVV +
Sbjct  66   PGTYQFKFVVDGQWRCSSGYQNVRDPNGNMNNQIVVSE  103



>emb|CCI49792.1| unnamed protein product [Albugo candida]
Length=328

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F  NW + +  +H++G  F     LS+GK+ YK++++ +WR + D  T  D
Sbjct  136  GRNVCITGTF-NNWSKQM-PMHRSGNDFVYITNLSRGKHAYKFVVDDEWRSAPDQLTVAD  193

Query  493  ERGNTNNVIVVGDI  452
              GN NN + V D 
Sbjct  194  LDGNVNNYVDVSDF  207



>ref|XP_002507310.1| carbohydrate-binding module family 48 protein [Micromonas sp. 
RCC299]
 gb|ACO68568.1| carbohydrate-binding module family 48 protein [Micromonas sp. 
RCC299]
Length=216

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = -1

Query  730  GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVR-LSQGKYY  554
            G  + P    V   W   +G ++  V     NW+   +A+H++G R  A V+ L  G Y 
Sbjct  23   GWPETPTLVPVAISWT--QGGSIVEVEGSFDNWQS-RQALHRSGTREFAIVKMLPPGVYQ  79

Query  553  YKYIINGQWRHSTDSATERDERGNTNNVIVV  461
            YK+I++G+W+++ D     DE GN NNV+ V
Sbjct  80   YKFIVDGEWKYAPDQPAMYDEMGNVNNVLEV  110



>emb|CCA27392.1| 5'AMPactivated protein kinase subunit beta putative [Albugo laibachii 
Nc14]
Length=327

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F  NW + +  +H++G  F     LS+GK+ YK++++ +WR + D  T  D
Sbjct  135  GRNVCITGTF-NNWSKQM-PMHRSGNDFVYITNLSRGKHAYKFVVDDEWRSAPDQLTVAD  192

Query  493  ERGNTNNVIVVGDI  452
              GN NN + V D 
Sbjct  193  LDGNVNNYVDVSDF  206



>gb|EYU33836.1| hypothetical protein MIMGU_mgv1a011535mg [Erythranthe guttata]
Length=278

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -1

Query  637  NWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVG  458
            +WK   R + ++G  F     L  G Y Y++I++GQWRHS D   E+DE GN+ NV+ + 
Sbjct  112  DWKT-RRPLARSGKDFTIMKVLPSGVYQYRFIVDGQWRHSPDQPWEQDESGNSFNVLDLQ  170

Query  457  D  455
            D
Sbjct  171  D  171



>gb|AGH32326.1| 5'-AMP-activated protein kinase catalytic subunit beta-2 [Cellana 
toreuma]
Length=229

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 42/86 (49%), Gaps = 3/86 (3%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYII  539
            GP      F W G  G +VFL G F  NWK  I  V   G  F   V L +G++ YK+ I
Sbjct  28   GPRLLPTVFKWEG-GGKDVFLCGSF-NNWKSKIPLVKSQG-DFYTIVDLPEGEHEYKFYI  84

Query  538  NGQWRHSTDSATERDERGNTNNVIVV  461
            +G W       T+ ++ G  NN++ V
Sbjct  85   DGNWVKDPSEPTKSNQLGTENNIVRV  110



>gb|KEQ76559.1| hypothetical protein M436DRAFT_78313 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=1399

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQWR  524
            TF WN P    V++ GDF  NW + I+ + K G  F   V L   + + +YK++++G W 
Sbjct  5    TFTWNHP-AQEVYVTGDF-DNWSKSIK-LDKNGNSFHKTVTLPGEESRIHYKFVVDGNWT  61

Query  523  HSTDSATERDERGNTNNVI  467
              + +  E D  GN NNV+
Sbjct  62   TDSTARQETDHSGNVNNVV  80



>ref|XP_001745667.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89638.1| predicted protein [Monosiga brevicollis MX1]
Length=324

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            +T  W    G ++ + G F  +W +P++   +    FEA++ L+ G Y YK+I++ +W+H
Sbjct  130  ITVTWTH-GGQDIRIAGTFN-HWGDPVKMTRRPDGVFEAKLLLAPGSYEYKFIVDREWKH  187

Query  520  STDSATERDERGNTNNVIVVG  458
                 T R+  G+ NN++ V 
Sbjct  188  DARLPTLRNSFGSVNNLLQVA  208



>ref|XP_008868724.1| hypothetical protein H310_05711 [Aphanomyces invadans]
 gb|ETW02119.1| hypothetical protein H310_05711 [Aphanomyces invadans]
Length=297

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F G W   +  +H++G  F     L +GK+ YK++++ +WR + D  T  D
Sbjct  122  GRNVCITGTFNG-WSAHV-PMHRSGNDFTYIANLPRGKHAYKFVVDDEWRFAPDQPTVAD  179

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D  S+
Sbjct  180  VDGNINNYVDVSDFTSL  196



>ref|XP_009833767.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV76856.1| hypothetical protein, variant [Aphanomyces astaci]
Length=288

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F G W   +  +H++G  F     L +GK+ YK++++ +WR + D  T  D
Sbjct  111  GRNVCITGTFNG-WSAHV-PMHRSGNDFTYIANLPRGKHAYKFVVDDEWRFAPDQPTVAD  168

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D  S+
Sbjct  169  VDGNINNYVDVSDFTSL  185



>ref|XP_009833768.1| hypothetical protein H257_09292 [Aphanomyces astaci]
 gb|ETV76855.1| hypothetical protein H257_09292 [Aphanomyces astaci]
Length=305

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F G W   +  +H++G  F     L +GK+ YK++++ +WR + D  T  D
Sbjct  128  GRNVCITGTFNG-WSAHV-PMHRSGNDFTYIANLPRGKHAYKFVVDDEWRFAPDQPTVAD  185

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D  S+
Sbjct  186  VDGNINNYVDVSDFTSL  202



>ref|XP_002499707.1| carbohydrate-binding module family 48 protein [Micromonas sp. 
RCC299]
 gb|ACO60965.1| carbohydrate-binding module family 48 protein [Micromonas sp. 
RCC299]
Length=590

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 6/82 (7%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPR----FEAEVRLSQGKYYYKYIINGQW  527
            F+W G  G  V L G FT NW E +    +  P     F     L  G + YK+I++G+W
Sbjct  16   FMW-GYGGKQVHLCGSFT-NWLETVPMAPEPAPNGGSVFAVVCNLPPGYHQYKFIVDGEW  73

Query  526  RHSTDSATERDERGNTNNVIVV  461
            RH  + A  +D  GN NN + V
Sbjct  74   RHDENQAFIQDPLGNVNNWLFV  95



>ref|XP_001416754.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95047.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=272

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 4/86 (5%)
 Frame = -1

Query  715  PATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPR-FEAEVRLSQGKYYYKYII  539
            PA   V   W    G++V + G F  NW+   + +H++G R F   + L  G Y YK+I+
Sbjct  82   PALVPVAINWTQ-GGNSVEVEGSFD-NWQS-RQTLHRSGNREFAIVMSLRPGVYQYKFIV  138

Query  538  NGQWRHSTDSATERDERGNTNNVIVV  461
            +GQW+++ D     DE GN NNV+ V
Sbjct  139  DGQWKYAPDQPAMYDEIGNVNNVLEV  164



>ref|XP_005710291.1| unnamed protein product [Chondrus crispus]
 emb|CDF39997.1| unnamed protein product [Chondrus crispus]
Length=198

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            VTF W+  +  +V + G F   W++ + A+ K   ++    +L+ G Y YK+I++G W +
Sbjct  121  VTFSWSASDASSVKVTGSF-AEWQDTM-ALEKRDGKWTLVKKLTPGTYEYKFIVDGNWWY  178

Query  520  STDSATERDERGNTNNVIVV  461
                 T  D  GN NNVI V
Sbjct  179  DITLPTATDCDGNVNNVITV  198



>ref|XP_001770299.1| predicted protein [Physcomitrella patens]
 gb|EDQ64974.1| predicted protein, partial [Physcomitrella patens]
Length=466

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = -1

Query  694  FVWNGPEGDN-VFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWR  524
            FVW  P G   V+L GDFT  W++  P+  V  +   F+    L+ G + YK+I++G+WR
Sbjct  5    FVW--PHGGRRVYLCGDFT-RWQDTLPLSPVEGSSRVFQVICSLAPGYHTYKFIVDGEWR  61

Query  523  HSTDSATERDERGNTNNVIVV  461
            H    A   +  G  NN +++
Sbjct  62   HDEQQAHMAESNGQVNNWLLI  82



>ref|XP_003081623.1| protein kinase, putative (ISS) [Ostreococcus tauri]
Length=510

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 5/83 (6%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHK----TGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSA  506
            G NV L G FT NW E +    +     G  F     L  G + YK+I++GQWRH  + A
Sbjct  34   GRNVHLCGSFT-NWLETVPMAQEGGNGDGRTFTVMCDLPPGYHQYKFIVDGQWRHDENQA  92

Query  505  TERDERGNTNNVIVVGDIASVRP  437
              +D  GN NN + V     V P
Sbjct  93   FIQDPLGNVNNWLYVKPAEGVTP  115



>gb|ESZ97563.1| carbohydrate-Binding Module family 48 protein [Sclerotinia borealis 
F-4157]
Length=807

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 5/89 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  P  + VF+ G F  NW +  + V KTG  F+ +V+L+    K YYK++++G W  
Sbjct  6    FKWEHP-AEEVFVTGTFD-NWSKSEKLV-KTGQVFKKDVQLANAREKIYYKFVVDGNWVT  62

Query  520  STDSATERDERGNTNNVIVVGDIASVRPS  434
               +  E D  GN NNV+ +  I    P+
Sbjct  63   DHTAPQENDASGNLNNVLTIDRIVKHTPA  91



>emb|CEF99376.1| CBS domain [Ostreococcus tauri]
Length=571

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 5/83 (6%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHK----TGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSA  506
            G NV L G FT NW E +    +     G  F     L  G + YK+I++GQWRH  + A
Sbjct  34   GRNVHLCGSFT-NWLETVPMAQEGGNGDGRTFTVMCDLPPGYHQYKFIVDGQWRHDENQA  92

Query  505  TERDERGNTNNVIVVGDIASVRP  437
              +D  GN NN + V     V P
Sbjct  93   FIQDPLGNVNNWLYVKPAEGVTP  115



>gb|KIW75206.1| hypothetical protein Z517_11979 [Fonsecaea pedrosoi CBS 271.37]
Length=532

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQWRH  521
            F W  PE ++V + G F  +W + ++ + K G  +E EV L  +  K +YK+++N QW  
Sbjct  6    FRWPHPEANDVHVTGTF-DDWGKSVK-LDKVGEIWEKEVDLPVADKKIFYKFVVNDQWII  63

Query  520  STDSATERDERGNTNNVIVVGDI  452
              ++  E D RGN NNV++  +I
Sbjct  64   DPEAPQEDDGRGNVNNVLLPENI  86



>ref|XP_010249337.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=470

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 3/76 (4%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRA--VHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATE  500
            G +VFL G FT  W E IR   +  +G  F+A   L+ G + YK++++G WR +      
Sbjct  12   GQHVFLTGSFT-RWTEHIRMTLMENSGTVFQAIWDLTPGYHQYKFLVDGVWRFNEQEPCV  70

Query  499  RDERGNTNNVIVVGDI  452
             DE G  NN+I V ++
Sbjct  71   TDEYGAVNNIIFVKEL  86



>ref|XP_009263688.1| hypothetical protein FPSE_12296, partial [Fusarium pseudograminearum 
CS3096]
 gb|EKJ67523.1| hypothetical protein FPSE_12296 [Fusarium pseudograminearum CS3096]
Length=470

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 5/90 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQWR  524
            TF W  P  + V++ G F  NW + +R + K G  F   V L   +GK YYK+I++G W 
Sbjct  5    TFKWEHP-AEEVYVTGTF-DNWTKSVR-LEKEGDVFSKTVELKEPEGKIYYKFIVDGNWI  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPS  434
             +  +  E D  GN NN +    I    P+
Sbjct  62   INQSAPNEPDLEGNVNNFVTPDQIVRETPA  91



>gb|KGU37204.1| hypothetical protein MGK_01381 [Candida albicans P57055]
Length=592

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = -1

Query  697  TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQW  527
            TF W  GPE  +V + G F  NW + +  V +T   F  +V L    G   YKY+++G+W
Sbjct  6    TFKWPKGPE--DVIVTGTF-DNWSKSLPLVKQTDGSFSLQVPLPPKAGDVIYKYVVDGEW  62

Query  526  RHSTDSATERDERGNTNNVI  467
            R ++D    +DE G  NN+I
Sbjct  63   RINSDENITKDESGIENNII  82



>ref|XP_005703182.1| 5'-AMP-activated protein kinase, regulatory beta subunit [Galdieria 
sulphuraria]
 gb|EME26662.1| 5'-AMP-activated protein kinase, regulatory beta subunit [Galdieria 
sulphuraria]
Length=341

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G  VF++G F  NW+  +  + ++G  F   + L  G Y YKY ++ +WRH+ +  T  D
Sbjct  143  GMQVFIMGAF-DNWQA-MYPLRRSGNNFYTLLNLEPGVYQYKYYVDNEWRHAPELPTALD  200

Query  493  ERGNTNNVIVVGDIAS  446
              GN NN++ V +  S
Sbjct  201  GMGNLNNIVQVNNFKS  216



>gb|KEQ62310.1| hypothetical protein M437DRAFT_50344 [Aureobasidium melanogenum 
CBS 110374]
Length=788

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQWR  524
            TF WN P    V++ GDF  NW + ++ + K G  F   + L   + + +YK++++G W 
Sbjct  5    TFTWNHP-AQEVYVTGDF-DNWSKSVK-LDKHGDSFRKTITLPGEESRIHYKFVVDGNWT  61

Query  523  HSTDSATERDERGNTNNVI  467
              + +  E D  GN NNV+
Sbjct  62   TDSTAKQETDASGNVNNVV  80



>gb|KHC84808.1| hypothetical protein MGS_01382 [Candida albicans P78042]
Length=660

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = -1

Query  697  TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS--QGKYYYKYIINGQW  527
            TF W  GPE  +V + G F  NW + +  V +T   F  +V L    G   YKY+++G+W
Sbjct  6    TFKWPKGPE--DVIVTGTF-DNWSKSLPLVKQTDGSFSLQVPLPPKAGDVIYKYVVDGEW  62

Query  526  RHSTDSATERDERGNTNNVI  467
            R ++D    +DE G  NN+I
Sbjct  63   RINSDENITKDESGIENNII  82



>ref|XP_010551058.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
 ref|XP_010551059.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
Length=490

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 43/92 (47%), Gaps = 4/92 (4%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW  527
            V F+W    G NV+L G FT  W E  P+  V      F+    L+ G + YK+ ++G+W
Sbjct  24   VPFIWRH-GGRNVYLTGSFT-RWSELVPMSQVEGCPTVFQVICNLAPGYHQYKFFVDGEW  81

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPSM  431
            +H         E G  N V+  G   ++ P M
Sbjct  82   KHDEHLPCTNSEYGIVNTVLASGPSYAMHPQM  113



>gb|EWG40021.1| hypothetical protein FVEG_02602 [Fusarium verticillioides 7600]
Length=833

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 35/110 (32%), Positives = 52/110 (47%), Gaps = 12/110 (11%)
 Frame = -1

Query  715  PATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYI  542
            P   + TF W  P  D V++ G F  NW + ++ + K G  F   V L +  GK YYK+I
Sbjct  154  PVMGSFTFKWEHP-ADEVYVTGTFD-NWTKSVQ-LEKEGNVFSKTVDLKEPEGKIYYKFI  210

Query  541  INGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVI  392
            ++G W  +  +  E D  GN NN I           +  +T GA I+  +
Sbjct  211  VDGNWIINQSAPNEPDLEGNVNNFI-------TPDQLNAETPGAAILNTV  253



>ref|XP_002981436.1| hypothetical protein SELMODRAFT_114544 [Selaginella moellendorffii]
 gb|EFJ17624.1| hypothetical protein SELMODRAFT_114544 [Selaginella moellendorffii]
Length=258

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -1

Query  724  HDGPATHAVTFVWNGPEGDNVFLVGDFTGNW--KEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            H G        VWN   G+NV + G +  NW  ++P++   ++G  F     L  G Y +
Sbjct  65   HGGEKGIPCMIVWNL-GGNNVSIEGSWD-NWSTRQPLQ---RSGKDFSILKLLPAGVYQF  119

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVV  461
            K+ ++G+WRH+ D    +DE GN +N+I V
Sbjct  120  KFFVDGEWRHAPDLPCSKDEAGNVSNLIEV  149



>ref|XP_003050707.1| hypothetical protein NECHADRAFT_104398 [Nectria haematococca 
mpVI 77-13-4]
 gb|EEU44994.1| hypothetical protein NECHADRAFT_104398 [Nectria haematococca 
mpVI 77-13-4]
Length=691

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQWR  524
            TF W  P  D V++ G F  +W + ++ + KTG  F   V L  +  K YYK++++G W 
Sbjct  5    TFKWEHP-ADEVYVTGTF-DDWTKSVK-LEKTGDVFSKTVDLKDASSKIYYKFVVDGNWV  61

Query  523  HSTDSATERDERGNTNNVI  467
             +  +A E D +GN NN +
Sbjct  62   INQSAANEPDTQGNVNNFL  80



>ref|XP_004980982.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Setaria 
italica]
Length=494

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (45%), Gaps = 4/105 (4%)
 Frame = -1

Query  712  ATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRA--VHKTGPRFEAEVRLSQGKYYYKYII  539
            AT    FVW    G  VF+ G FT  W E ++   V      F+A   LS G Y YK+ +
Sbjct  22   ATVPARFVWPY-GGKRVFVSGSFT-RWSEHLQMSPVEGCPSVFQATCSLSPGMYQYKFFV  79

Query  538  NGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANI  404
            +G+WRH     T   E G  N + +  +I  +   +   T G  +
Sbjct  80   DGEWRHDERQPTVSGEYGIVNTLYLTREINQINSVLSPSTPGTRM  124



>gb|EGO01584.1| carbohydrate-binding module family 48 protein [Serpula lacrymans 
var. lacrymans S7.3]
Length=90

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (49%), Gaps = 3/80 (4%)
 Frame = -1

Query  706  HAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG-KYYYKYIINGQ  530
            H V F W G +  +V + G F   W   I    K    F+ +VR+  G K  YK+I++G 
Sbjct  5    HEVNFEWPGMDATDVIVTGTF-DQWSSSIHLT-KDPSSFQGKVRIPWGEKIVYKFIVDGN  62

Query  529  WRHSTDSATERDERGNTNNV  470
            W   +D   E D  GN NNV
Sbjct  63   WVTHSDHPIEADSSGNRNNV  82



>ref|XP_004349217.1| hypothetical protein CAOG_02467 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91314.1| hypothetical protein CAOG_002467 [Capsaspora owczarzaki ATCC 
30864]
Length=240

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 4/81 (5%)
 Frame = -1

Query  676  EGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSAT  503
            EG NV + G +  +W+   P++    TG   +  ++L QG + YK++++GQWR S+   T
Sbjct  123  EGKNVQVSGSY-DDWQSLTPLKRNPATG-FLQTVLQLPQGVHQYKFMVDGQWRCSSYLPT  180

Query  502  ERDERGNTNNVIVVGDIASVR  440
              D RG  NNVI V     V+
Sbjct  181  AHDPRGIENNVIEVCPTLPVK  201



>gb|KGU30630.1| hypothetical protein MG7_01394, partial [Candida albicans P34048]
Length=167

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 5/78 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS--QGKYYYKYIINGQWRH  521
            F   GPE  +V + G F  NW + +  V +T   F  +V L    G   YKY+++G+WR 
Sbjct  2    FRPKGPE--DVIVTGTF-DNWSKSLPLVKQTDGSFSLQVPLPPKAGDVIYKYVVDGEWRI  58

Query  520  STDSATERDERGNTNNVI  467
            ++D    +DE G  NN+I
Sbjct  59   NSDENITKDESGIENNII  76



>gb|KHF98317.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=479

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (45%), Gaps = 6/105 (6%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDN-VFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYK  548
            GP    + FVW  P G   VFL G FT  W E  P+  +      F+    LS G + +K
Sbjct  17   GPLLIPMRFVW--PYGGRRVFLSGSFT-RWLEHIPMSPMEGCPTVFQVICSLSPGYHQFK  73

Query  547  YIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKG  413
            + ++G+WRH        D  G  N + +  +   V PS   +T G
Sbjct  74   FFVDGEWRHDEHQPFVNDNYGIVNTIFIAREPNLVAPSFSTETPG  118



>gb|KDO18831.1| hypothetical protein SPRG_15880 [Saprolegnia parasitica CBS 223.65]
Length=269

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F G W   +  +H++G  F     L +GK+ YK++++ +WR + D  T  D
Sbjct  94   GRNVCITGTFNG-WTTHV-PMHRSGNDFTYIANLPRGKHAYKFVVDDEWRFAPDQPTVAD  151

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D  ++
Sbjct  152  VDGNINNYVDVSDFVAL  168



>ref|XP_009026476.1| hypothetical protein HELRODRAFT_86841 [Helobdella robusta]
 gb|ESN95351.1| hypothetical protein HELRODRAFT_86841 [Helobdella robusta]
Length=216

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 42/88 (48%), Gaps = 9/88 (10%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHS  518
             F W G EG N FL G F  NW   I  V K+   F   + L +G Y YKY+I+ QW   
Sbjct  26   VFRWTG-EGKNCFLSGSF-DNWNSLIPLV-KSVNDFFTIIELPEGTYQYKYLIDNQWMCD  82

Query  517  TDSATERDERGNTNNVIVVGDIASVRPS  434
             +     +  G  NNVI      SVRPS
Sbjct  83   NNQDKVPNSFGTHNNVI------SVRPS  104



>gb|EYB21615.1| hypothetical protein FG05_09887 [Fusarium graminearum]
 emb|CEF75187.1| unnamed protein product [Fusarium graminearum]
Length=681

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 5/90 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQWR  524
            TF W  P  + V++ G F  NW + +R + K G  F   V L +  GK YYK+I++G W 
Sbjct  5    TFKWEHP-AEEVYVTGTF-DNWTKSVR-LEKEGDVFSKTVELKEPEGKIYYKFIVDGNWI  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPS  434
             +  +  E D  GN NN +    I    P+
Sbjct  62   INQSAPNEPDLEGNVNNFVTPDQIVRETPA  91



>ref|XP_008611134.1| hypothetical protein SDRG_07095 [Saprolegnia diclina VS20]
 gb|EQC35384.1| hypothetical protein SDRG_07095 [Saprolegnia diclina VS20]
Length=267

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G NV + G F G W   +  +H++G  F     L +GK+ YK++++ +WR + D  T  D
Sbjct  92   GRNVCITGTFNG-WTTHV-PMHRSGNDFTYIANLPRGKHAYKFVVDDEWRFAPDQPTVAD  149

Query  493  ERGNTNNVIVVGDIASV  443
              GN NN + V D  ++
Sbjct  150  VDGNINNYVDVSDFVAL  166



>gb|KJB26424.1| hypothetical protein B456_004G240500 [Gossypium raimondii]
Length=479

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 46/104 (44%), Gaps = 4/104 (4%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKY  545
            GP    + FVW    G  VFL G FT  W E  P+  +      F+    LS G + +K+
Sbjct  17   GPLLIPMRFVWPY-GGRRVFLSGSFT-RWLEHIPMSPMEGCPTVFQVICSLSPGYHQFKF  74

Query  544  IINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKG  413
             ++G+WRH        D  G  N + +  +   V PS   +T G
Sbjct  75   FVDGEWRHDEHQPFVNDNYGIVNTIFIAREPNLVAPSFNPETPG  118



>ref|XP_007807116.1| hypothetical protein MAC_00776 [Metarhizium acridum CQMa 102]
 gb|EFY92993.1| hypothetical protein MAC_00776 [Metarhizium acridum CQMa 102]
Length=626

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 8/90 (9%)
 Frame = -1

Query  697  TFVWNGPEGD--NVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ----GKYYYKYIIN  536
            TF W  P GD  +V + G F G W + ++ + K G  F+  V  S+     K YYK++++
Sbjct  5    TFKWENPTGDVSDVLVTGSFDG-WTKSVK-LEKQGTSFQKTVSFSEKDASSKIYYKFVVD  62

Query  535  GQWRHSTDSATERDERGNTNNVIVVGDIAS  446
              W  +     E D  GN NN +   D++S
Sbjct  63   NNWTINESYPHEADHEGNVNNFLTPDDLSS  92



>ref|XP_010249336.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=474

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -1

Query  673  GDNVFLVGDFTG---NWKEPIRA--VHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDS  509
            G +VFL G FT     W E IR   +  +G  F+A   L+ G + YK++++G WR +   
Sbjct  12   GQHVFLTGSFTSYMIRWTEHIRMTLMENSGTVFQAIWDLTPGYHQYKFLVDGVWRFNEQE  71

Query  508  ATERDERGNTNNVIVVGDI  452
                DE G  NN+I V ++
Sbjct  72   PCVTDEYGAVNNIIFVKEL  90



>ref|XP_005762051.1| hypothetical protein EMIHUDRAFT_432923, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD09622.1| hypothetical protein EMIHUDRAFT_432923, partial [Emiliania huxleyi 
CCMP1516]
Length=285

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPI--RAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATE  500
            G   ++ G FT   K P+  R  +  G  F+  V L+ G Y YK+I++GQWRH   + T 
Sbjct  31   GKTAYVCGSFTQWQKVPMQWRQSNSGGEWFKV-VDLAPGSYQYKFIVDGQWRHDHTAPTV  89

Query  499  RDERGNTNNVIVV  461
             D  GN NN + +
Sbjct  90   LDNLGNVNNCVTI  102



>gb|KJB26425.1| hypothetical protein B456_004G240500 [Gossypium raimondii]
Length=449

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 46/104 (44%), Gaps = 4/104 (4%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKY  545
            GP    + FVW    G  VFL G FT  W E  P+  +      F+    LS G + +K+
Sbjct  17   GPLLIPMRFVWPY-GGRRVFLSGSFT-RWLEHIPMSPMEGCPTVFQVICSLSPGYHQFKF  74

Query  544  IINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKG  413
             ++G+WRH        D  G  N + +  +   V PS   +T G
Sbjct  75   FVDGEWRHDEHQPFVNDNYGIVNTIFIAREPNLVAPSFNPETPG  118



>emb|CCT68761.1| uncharacterized protein FFUJ_07574 [Fusarium fujikuroi IMI 58289]
Length=695

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 50/104 (48%), Gaps = 12/104 (12%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQWR  524
            TF W  P  D V++ G F  NW + ++ + K G  F   V L +  GK YYK+I++G W 
Sbjct  5    TFKWEHP-ADEVYVTGTF-DNWTKSVQ-LEKEGNVFSKTVDLKEPEGKIYYKFIVDGNWI  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVI  392
             +  +  E D  GN NN I           +  +T GA I+  +
Sbjct  62   INQSAPNEPDLEGNVNNFITPD-------QLNAETPGAAILNTV  98



>gb|EEH08927.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
Length=578

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = -1

Query  712  ATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKT-GPRFEAEVRLSQGKYYYKYIIN  536
            ATH  TF W  P    V++ G F  NW   ++      G R + EV    GK  YK++++
Sbjct  25   ATH--TFQWPDPTASEVYVTGTF-DNWSRSVKLERSANGFRKDVEVPSIGGKILYKFVVD  81

Query  535  GQWRHSTDSATERDERGNTNNVIVVGDIASVRPS  434
            G W+    +  E D   NTNNV++  +I  + P+
Sbjct  82   GAWKIDPAALQEDDGHNNTNNVLLRQNIKKLPPT  115



>gb|ERT03000.1| hypothetical protein HMPREF1624_01304 [Sporothrix schenckii ATCC 
58251]
Length=997

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS--QGKYYYKYIINGQWRHSTDSATE  500
            G+ VF+ G F  NW + ++ + K G  F+  V L     K YYK++++G+W     +  E
Sbjct  224  GNEVFVTGTFD-NWSKSVQ-LKKVGDVFQNTVELGNISKKIYYKFVVDGEWVLDPAAPKE  281

Query  499  RDERGNTNNVIVVGDI  452
            +DE GN NNV+   +I
Sbjct  282  KDEEGNVNNVLTPENI  297



>ref|XP_011073279.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=470

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATE  500
            G  VFL G F G W E  P+  V  +   F+  + L  G Y YK++++G WR       +
Sbjct  12   GHQVFLSGSFNG-WSERMPMFLVEGSENIFQRIIDLPPGCYQYKFLVDGTWRADQQQICD  70

Query  499  RDERGNTNNVIVV  461
             DE G  NN+++V
Sbjct  71   LDEYGTMNNIVLV  83



>gb|AEB14420.1| glycoside hydrolase family 13 domain protein [Treponema succinifaciens 
DSM 2489]
Length=119

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY-YKYIINGQWR  524
            VTF ++ P   NV L GDFT NW+   + + K G  F     +S+     YK+IING W 
Sbjct  34   VTFSYSHPSAKNVLLAGDFT-NWQSGAKTMKKEGDTFVYRKVVSEKSVLTYKFIINGNWM  92

Query  523  HSTDS-ATERDERGNTNNVIVV  461
               ++ AT  D  G  N V+ V
Sbjct  93   TDKNAPATTDDGFGGKNGVVDV  114



>gb|EPE08216.1| carbohydrate-binding module family 48 protein [Ophiostoma piceae 
UAMH 11346]
Length=637

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = -1

Query  697  TFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQW  527
            +FV+  P   + V++ G F G W +  + + K    F+  V+L  +  K YYK++++G+W
Sbjct  3    SFVFTWPNAAEEVYVTGTFDG-WSKSAK-LEKVDGIFQKAVQLEDASSKIYYKFVVDGEW  60

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPS  434
               T +  E+DE GN NNV+   +I +  P+
Sbjct  61   VVDTAAPNEKDESGNINNVLTPENIVASIPA  91



>gb|EGU80254.1| hypothetical protein FOXB_09181 [Fusarium oxysporum Fo5176]
Length=668

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 50/104 (48%), Gaps = 12/104 (12%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQWR  524
            TF W  P  D V++ G F  NW + ++ + K G  F   V L +  GK YYK+I++G W 
Sbjct  5    TFKWEHP-ADEVYVTGTF-DNWTKSVQ-LEKEGNVFSKTVDLKEPEGKIYYKFIVDGNWI  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVI  392
             +  +  E D  GN NN I           +  +T GA I+  +
Sbjct  62   INQSAPNEPDLEGNVNNFITPD-------QLNTETPGAAILNTV  98



>gb|EMT63763.1| 5'-AMP-activated protein kinase subunit beta-2 [Fusarium oxysporum 
f. sp. cubense race 4]
Length=695

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 50/104 (48%), Gaps = 12/104 (12%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQWR  524
            TF W  P  D V++ G F  NW + ++ + K G  F   V L +  GK YYK+I++G W 
Sbjct  5    TFKWEHP-ADEVYVTGTF-DNWTKSVQ-LEKEGNVFSKTVDLKEPEGKIYYKFIVDGNWI  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVI  392
             +  +  E D  GN NN I           +  +T GA I+  +
Sbjct  62   INQSAPNEPDLEGNVNNFITPD-------QLNTETPGAAILNTV  98



>gb|ENH62746.1| 5'-AMP-activated protein kinase subunit beta-2 [Fusarium oxysporum 
f. sp. cubense race 1]
Length=695

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 50/104 (48%), Gaps = 12/104 (12%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQWR  524
            TF W  P  D V++ G F  NW + ++ + K G  F   V L +  GK YYK+I++G W 
Sbjct  5    TFKWEHP-ADEVYVTGTF-DNWTKSVQ-LEKEGNVFSKTVDLKEPEGKIYYKFIVDGNWI  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVI  392
             +  +  E D  GN NN I           +  +T GA I+  +
Sbjct  62   INQSAPNEPDLEGNVNNFITPDQ-------LNTETPGAAILNTV  98



>gb|KIH86792.1| hypothetical protein SPBR_08110 [Sporothrix brasiliensis 5110]
Length=786

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = -1

Query  703  AVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ--GKYYYKYIINGQ  530
            +  F+W    G+ VF+ G F  NW + ++ + K G  F+  V L     K YYK++++G+
Sbjct  3    SFVFIWPNA-GNEVFVTGTFD-NWSKSVQ-LKKVGDVFQNTVELGNISKKIYYKFVVDGE  59

Query  529  WRHSTDSATERDERGNTNNVIVVGDIAS  446
            W     +  E+DE GN NNV+   +I +
Sbjct  60   WVLDPAAPKEKDEEGNVNNVLTPENIVA  87



>dbj|GAM25701.1| hypothetical protein SAMD00019534_088760 [Acytostelium subglobosum 
LB1]
Length=329

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 40/78 (51%), Gaps = 3/78 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W+G  G  V++ G F  NWKE I   H     F     L  G + YK+I++G+W HS+
Sbjct  140  FTWSG-GGKEVYIAGSF-NNWKEKIPLSHSEK-DFTLIYNLPPGVHQYKFIVDGKWVHSS  196

Query  514  DSATERDERGNTNNVIVV  461
            +     D +GN  N + V
Sbjct  197  EQPVAADTKGNLINFVEV  214



>ref|WP_041612028.1| hypothetical protein [Treponema succinifaciens]
Length=113

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY-YKYIINGQWR  524
            VTF ++ P   NV L GDFT NW+   + + K G  F     +S+     YK+IING W 
Sbjct  28   VTFSYSHPSAKNVLLAGDFT-NWQSGAKTMKKEGDTFVYRKVVSEKSVLTYKFIINGNWM  86

Query  523  HSTDS-ATERDERGNTNNVIVV  461
               ++ AT  D  G  N V+ V
Sbjct  87   TDKNAPATTDDGFGGKNGVVDV  108



>ref|XP_005837329.1| hypothetical protein GUITHDRAFT_135491 [Guillardia theta CCMP2712]
 gb|EKX50349.1| hypothetical protein GUITHDRAFT_135491 [Guillardia theta CCMP2712]
Length=232

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (53%), Gaps = 1/78 (1%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            + F W+      V++VG F+ NW+  IR   +    +   V++  G + YK+I++G+WR 
Sbjct  44   IAFRWHHGAQREVYVVGSFS-NWQTKIRLTREDDGSYGTVVQIVPGIHQYKFIVDGEWRC  102

Query  520  STDSATERDERGNTNNVI  467
            + D     D  GN NN I
Sbjct  103  AQDQPRCLDSVGNENNCI  120



>gb|EKG12152.1| hypothetical protein MPH_10716 [Macrophomina phaseolina MS6]
Length=785

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 14/139 (10%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWR  524
            TF W  P  D V++ G F  +W + ++ V ++G  FE  V+L +   K  YK++++G W 
Sbjct  5    TFRWEHP-ADEVYVTGTF-DDWAKSVKLV-RSGDVFEKTVQLPRNDEKVLYKFVVDGNWT  61

Query  523  HSTDSATERDERGNTNNVIVVGD---------IASVRPSMQQQTKGANIIKVIERPLTEN  371
             ST +  E D  G  NNV++  D         ++S  P        A   K   +P    
Sbjct  62   TSTQAPQEDDGHGIYNNVLLPTDFSLSPSARIMSSAAPDSTTAELAAEQPKETPKPEDVP  121

Query  370  ERFMLAKAARCIAFSICPI  314
              F+   A    +FS+ PI
Sbjct  122  GGFIETPANELQSFSVNPI  140



>ref|XP_003058117.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
 gb|EEH58068.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
Length=508

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 40/82 (49%), Gaps = 6/82 (7%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPR----FEAEVRLSQGKYYYKYIINGQW  527
            FVW    G  V L G FT NW E +    +  P     F     L  G + YK+I++G+W
Sbjct  16   FVWAY-GGKQVHLCGSFT-NWLETVPMAIEPNPTGGEVFAVVCNLPPGYHQYKFIVDGEW  73

Query  526  RHSTDSATERDERGNTNNVIVV  461
            RH  + A  +D  GN NN + V
Sbjct  74   RHDENQAFIQDPLGNVNNWLFV  95



>gb|KDP23504.1| hypothetical protein JCGZ_23337 [Jatropha curcas]
Length=472

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 4/109 (4%)
 Frame = -1

Query  724  HDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYY  551
            HD      + FVW    G +VFL G FTG W E  P+  V      F+    L+ G + Y
Sbjct  10   HDNTGVVPMRFVWPY-GGRSVFLSGSFTG-WTEHIPMSPVEGCPTVFQVVCSLTPGYHQY  67

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANI  404
            K+ ++G+WRH     +     G  N V +  +   V   +  +T G+N+
Sbjct  68   KFFVDGEWRHDEHQQSVSGNYGVVNTVFLPREPDMVPSIVNPETSGSNM  116



>gb|ESX02089.1| hypothetical protein HPODL_04849 [Ogataea parapolymorpha DL-1]
Length=158

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 2/81 (2%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST  515
            F W   +   V++ G F  NW +  + + KTG  F   V L   K  +K++++ QW  S 
Sbjct  8    FEWLSSDAKQVYVTGSFD-NWSKTCQ-LDKTGVGFAKVVELPFEKIVFKFVVDNQWYTSD  65

Query  514  DSATERDERGNTNNVIVVGDI  452
            +   E DE GN NNV+   D+
Sbjct  66   NDKKEYDECGNLNNVLYPDDL  86



>gb|EPS61685.1| hypothetical protein M569_13109, partial [Genlisea aurea]
Length=245

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -1

Query  673  GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD  494
            G +V L G +  +WK   + + ++G  F   + L  G Y Y+++++G WRHSTD   E+D
Sbjct  68   GTDVALEGSW-DDWKS-RKPLQRSGKDFTVMMVLPSGVYRYRFVVDGHWRHSTDQPWEQD  125

Query  493  ERGNTNNVI  467
              GN  N++
Sbjct  126  YSGNAYNIL  134



>gb|KHJ31897.1| putative carbohydrate-binding module family 48 protein [Erysiphe 
necator]
Length=515

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 10/118 (8%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL--SQGKYYYKYIINGQWRH  521
            F W  P  + V++ G F  +W +  R + KT   F  EV L  +  K YYK++++G W  
Sbjct  12   FKWEHP-AEEVYVTGSF-DDWSKSER-LSKTNNIFAKEVVLPIASDKIYYKFVVDGNWVT  68

Query  520  STDSATERDERGNTNNVIVVGDIASVRPS----MQQQTKGANIIKVIER-PLTENERF  362
               +  E DE GN NNV+ V  I  + P     M   T  +  + +  + PL  N+++
Sbjct  69   DHTAPQENDELGNLNNVLTVDKITILPPESVGIMSGVTADSTTVSMAGKVPLVTNQKY  126



>ref|XP_001588089.1| hypothetical protein SS1G_10535 [Sclerotinia sclerotiorum 1980]
 gb|EDN94661.1| hypothetical protein SS1G_10535 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=712

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 5/83 (6%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  P  + VF+ G F  NW +  + V KTG  F+ +V+L+    K YYK++++G W  
Sbjct  6    FKWEHP-AEEVFVTGTF-DNWSKSEKLV-KTGDVFQKDVQLANAGEKIYYKFVVDGNWVT  62

Query  520  STDSATERDERGNTNNVIVVGDI  452
               +  E D  GN NNV+    I
Sbjct  63   DHTAPQENDASGNLNNVLTTDRI  85



>gb|KIR45750.1| hypothetical protein I312_05112 [Cryptococcus gattii CA1280]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>gb|KGB76162.1| hypothetical protein CNBG_2000 [Cryptococcus gattii R265]
 gb|KIR34938.1| hypothetical protein I352_02193 [Cryptococcus gattii MMRL2647]
 gb|KIR70077.1| hypothetical protein I310_06058 [Cryptococcus gattii CA1014]
 gb|KIS00194.1| hypothetical protein L804_02843 [Cryptococcus gattii 2001/935-1]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>gb|KIR58333.1| hypothetical protein I314_05959 [Cryptococcus gattii CA1873]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>ref|XP_001023105.2| Protein kinase domain containing protein [Tetrahymena thermophila]
Length=907

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -1

Query  598  PRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDI  452
            P +E   +L  G Y YKYI++GQWR S D  T  DE GN NN+I   +I
Sbjct  595  PVYELIWKLRPGVYQYKYIVDGQWRFSPDDPTCNDENGNINNLIDTTNI  643



>gb|KIR28443.1| hypothetical protein I309_02748 [Cryptococcus gattii LA55]
 gb|KIR93926.1| hypothetical protein I304_02614 [Cryptococcus gattii CBS 10090]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>ref|XP_003194559.1| SNF1-related kinase complex anchoring protein SIP1 [Cryptococcus 
gattii WM276]
 gb|ADV22772.1| SNF1-related kinase complex anchoring protein SIP1, putative 
[Cryptococcus gattii WM276]
 gb|KIR52393.1| hypothetical protein I315_04993 [Cryptococcus gattii Ru294]
 gb|KIR82760.1| hypothetical protein I306_00025 [Cryptococcus gattii EJB2]
 gb|KIY32351.1| hypothetical protein I305_05310 [Cryptococcus gattii E566]
 gb|KJE04645.1| hypothetical protein I311_01444 [Cryptococcus gattii NT-10]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>gb|KIR37920.1| hypothetical protein I313_06293 [Cryptococcus gattii Ram5]
 gb|KIY56800.1| hypothetical protein I307_03911 [Cryptococcus gattii 99/473]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>gb|AFR95838.1| hypothetical protein CNAG_06553 [Cryptococcus neoformans var. 
grubii H99]
Length=509

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VPIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>ref|XP_006968126.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR45941.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETR99008.1| hypothetical protein M419DRAFT_102911 [Trichoderma reesei RUT 
C-30]
Length=598

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 44/90 (49%), Gaps = 5/90 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWR  524
            TF W  P  + VF+ G F  NW +  + V K G  F+  V L     K Y+KY+++G W 
Sbjct  5    TFKWEHP-AEEVFVTGTF-DNWTKSEQLV-KVGDVFQKTVPLKDASQKIYFKYVVDGNWT  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPS  434
             +  +  E D  GN NN I   DI    P+
Sbjct  62   VNESAPKEADHEGNINNFITPEDILQSDPA  91



>ref|XP_006414362.1| hypothetical protein EUTSA_v10025902mg [Eutrema salsugineum]
 gb|ESQ55815.1| hypothetical protein EUTSA_v10025902mg [Eutrema salsugineum]
Length=204

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = -1

Query  637  NWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVG  458
            NWK   R + ++G  F     L  G Y Y++I++GQWRH+ +    RD+ GNT N++ + 
Sbjct  38   NWKTRSR-LQRSGKDFTIMKVLPSGVYEYRFIVDGQWRHAPELPLARDDAGNTFNILDLQ  96

Query  457  D  455
            D
Sbjct  97   D  97



>ref|XP_006357642.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-2-like 
[Solanum tuberosum]
Length=289

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  613  VHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGDI  452
            + +T   F     L  G Y+Y++I++GQWR++ D   ERD+ GN  NV+ + DI
Sbjct  127  LQRTDKDFTVMKVLPSGVYHYRFIVDGQWRYAPDLPCERDDTGNVFNVLDLQDI  180



>ref|XP_006650929.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Oryza brachyantha]
Length=487

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 4/96 (4%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            FVW    G  V+L G FT  W E  P+  V      F+A   LS G + YK+ ++G+WRH
Sbjct  20   FVWPY-GGKRVYLTGSFT-RWTEHLPMSPVEGCPTVFQAICNLSPGIHQYKFCVDGEWRH  77

Query  520  STDSATERDERGNTNNVIVVGDIASVRPSMQQQTKG  413
                 T   + G  N++ + G+   +   +   T G
Sbjct  78   DERQPTITGDYGVVNSICLTGNFDQLSTILSPSTPG  113



>gb|EHK26537.1| carbohydrate-binding module family 48 protein [Trichoderma virens 
Gv29-8]
Length=506

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (48%), Gaps = 5/90 (6%)
 Frame = -1

Query  697  TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWR  524
            TF W  P  + VF+ G F  NW +    + K G  F+  V L     K Y+KY+++G W 
Sbjct  5    TFKWEHP-AEEVFVTGTF-DNWTK-SEQLAKEGDVFQKTVALKDASQKIYFKYVVDGNWT  61

Query  523  HSTDSATERDERGNTNNVIVVGDIASVRPS  434
             +  +  E D  GN NN I   DI    P+
Sbjct  62   VNESAPKEADHEGNVNNFITPEDILKSDPA  91



>ref|NP_001266176.1| Tau2 [Solanum lycopersicum]
 gb|AFJ92923.1| Tau2 [Solanum lycopersicum]
Length=272

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 10/99 (10%)
 Frame = -1

Query  676  EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATER  497
            EG ++ + G +  NWK     + ++G  F     L  G Y Y++I++GQWR S D    +
Sbjct  93   EGKDIAVEGSW-DNWKS-RNILQRSGKDFTILKVLPSGVYQYRFIVDGQWRCSPDLPCVQ  150

Query  496  DERGNTNNVIVVGD--------IASVRPSMQQQTKGANI  404
            DE GNT N++ V D        I+   P +   +  +N+
Sbjct  151  DEAGNTYNILDVKDYVPEDIESISGFEPPLSPDSSYSNL  189



>ref|XP_571430.1| SNF1-related kinase complex anchoring protein SIP1 [Cryptococcus 
neoformans var. neoformans JEC21]
 ref|XP_774861.1| hypothetical protein CNBF0260 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20214.1| hypothetical protein CNBF0260 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44123.1| SNF1-related kinase complex anchoring protein SIP1, putative 
[Cryptococcus neoformans var. neoformans JEC21]
Length=509

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -1

Query  700  VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH  521
            V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct  255  VQIQWNG-GGRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC  312

Query  520  STDSATERDERGNTNNVIVV  461
            S   +T  D+ G   N I V
Sbjct  313  SKQISTAVDDDGTLVNWIEV  332



>ref|XP_007375905.1| hypothetical protein SPAPADRAFT_61690 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW32629.1| hypothetical protein SPAPADRAFT_61690 [Spathaspora passalidarum 
NRRL Y-27907]
Length=489

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 12/102 (12%)
 Frame = -1

Query  697  TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGK--YYYKYIINGQW  527
            TF W +GP+  +V + G F  NW E I  V +    F  EV  +       YKY+++G W
Sbjct  4    TFKWPSGPQ--DVVVTGSFV-NWTENIPLVKQADGSFSLEVPFASSTEPILYKYVVDGVW  60

Query  526  RHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANII  401
            + S D    +D+ G  NN++ V D+ ++       TK  +II
Sbjct  61   QASQDEKITKDDSGIENNILDVDDLKALS------TKAKSII  96



>ref|XP_002969965.1| hypothetical protein SELMODRAFT_170984 [Selaginella moellendorffii]
 gb|EFJ29089.1| hypothetical protein SELMODRAFT_170984 [Selaginella moellendorffii]
Length=270

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = -1

Query  724  HDGPATHAVTFVWNGPEGDNVFLVGDFTGNW--KEPIRAVHKTGPRFEAEVRLSQGKYYY  551
            H G        VW+   G+NV + G +  NW  ++P++   ++G  F     L  G Y +
Sbjct  77   HGGEKGIPCMIVWSL-GGNNVSIEGSWD-NWSTRQPLQ---RSGKDFSILKLLPAGVYQF  131

Query  550  KYIINGQWRHSTDSATERDERGNTNNVIVV  461
            K+ ++G+WRH+ D +  +DE GN +N+I V
Sbjct  132  KFFVDGEWRHAPDLSCSKDEAGNVSNLIEV  161



>gb|KJB68531.1| hypothetical protein B456_010G248900 [Gossypium raimondii]
Length=211

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 9/86 (10%)
 Frame = -1

Query  637  NWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVG  458
            NWK  I  + + G  F     L  G Y Y++I++GQWR++ D    +D  GN NN++ + 
Sbjct  45   NWKTRI-PLQRCGKDFTIMKVLPSGVYQYRFIVDGQWRYAPDLPWAQDGTGNANNILDLQ  103

Query  457  D--------IASVRPSMQQQTKGANI  404
            D        I+S  P +  ++  +N+
Sbjct  104  DYVPEDIESISSFEPPLSPESSYSNL  129



>ref|XP_007798524.1| putative carbohydrate-binding module family 48 protein [Eutypa 
lata UCREL1]
 gb|EMR62394.1| putative carbohydrate-binding module family 48 protein [Eutypa 
lata UCREL1]
Length=519

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 6/89 (7%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG--KYYYKYIINGQWRH  521
            F W  P  D V++ G F  +WK+  + + K G  FE  V L     K YYK++++G W  
Sbjct  6    FKWAHPASD-VYVTGTF-DDWKKSEK-LEKVGEHFEKTVVLPDASKKIYYKFVVDGNWVT  62

Query  520  STDSATERDERGNTNNVIVVGDIASVRPS  434
               +  E DE GN NN++    I +V P+
Sbjct  63   DPTAPKETDESGNENNLLEPAQI-TVEPT  90



>ref|XP_003955317.1| hypothetical protein KAFR_0A07480 [Kazachstania africana CBS 
2517]
 emb|CCF56182.1| hypothetical protein KAFR_0A07480 [Kazachstania africana CBS 
2517]
Length=236

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 50/97 (52%), Gaps = 8/97 (8%)
 Frame = -1

Query  694  FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQ------GKYYYKYIING  533
            F W G  G+ V L G F  NW + I         F  ++   +      GK ++K+I++G
Sbjct  8    FNWCGSAGE-VILTGTF-DNWGQSITLDKINDELFSKKLEFPKEKAALDGKIFFKFIVDG  65

Query  532  QWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQ  422
            +W+ S +   E D++GN NN ++V D+   +  ++++
Sbjct  66   EWKTSGNYNVETDDKGNLNNFLLVEDLTKQKIKIKRR  102



>ref|XP_009620191.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-2-like 
[Nicotiana tomentosiformis]
Length=285

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 2/74 (3%)
 Frame = -1

Query  676  EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATER  497
            EG  V + G +  NWK  +  + K+G  F     L  G Y Y++I++GQWR S D    +
Sbjct  107  EGKEVVVEGSWD-NWKSRM-PLQKSGKDFTILKVLPSGVYQYRFIVDGQWRCSPDMPCIQ  164

Query  496  DERGNTNNVIVVGD  455
            DE GN  N++ V D
Sbjct  165  DEAGNAYNLLDVKD  178



>ref|XP_010875993.1| PREDICTED: 5'-AMP-activated protein kinase subunit beta-1-like 
isoform X4 [Esox lucius]
Length=260

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 50/114 (44%), Gaps = 5/114 (4%)
 Frame = -1

Query  718  GPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYII  539
            GP      F W G  G  VFL G F  NW   I  + ++   F A V L +G++ YK+ +
Sbjct  63   GPLDRPTVFRWTG-NGKEVFLSGSF-NNWANKI-PLTRSQNNFVAIVDLPEGEHQYKFYV  119

Query  538  NGQWRHSTDSATERDERGNTNNVIVVG--DIASVRPSMQQQTKGANIIKVIERP  383
            +G W H  +     ++ G  NN+I V   D       M    K ++I  +   P
Sbjct  120  DGTWTHDPNEPVVTNQLGTVNNIIQVKKTDFEVFDALMVDSLKCSDISDMSSSP  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485