BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018J08

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011040004.1|  PREDICTED: serine-threonine kinase receptor-...    197   3e-59   Populus euphratica
ref|XP_002298116.1|  transducin family protein                          196   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011035638.1|  PREDICTED: serine-threonine kinase receptor-...    196   6e-59   Populus euphratica
ref|XP_002303265.1|  transducin family protein                          195   2e-58   Populus trichocarpa [western balsam poplar]
gb|KJB70541.1|  hypothetical protein B456_011G079800                    191   2e-58   Gossypium raimondii
ref|XP_008337419.1|  PREDICTED: serine-threonine kinase receptor-...    191   2e-58   
ref|XP_010098976.1|  Serine-threonine kinase receptor-associated ...    194   4e-58   Morus notabilis
ref|XP_002529368.1|  serine-threonine kinase receptor-associated ...    193   8e-58   Ricinus communis
gb|KCW68994.1|  hypothetical protein EUGRSUZ_F02555                     190   1e-57   Eucalyptus grandis [rose gum]
ref|XP_008785422.1|  PREDICTED: serine-threonine kinase receptor-...    192   1e-57   Phoenix dactylifera
gb|KJB70542.1|  hypothetical protein B456_011G079800                    191   2e-57   Gossypium raimondii
ref|XP_004515599.1|  PREDICTED: serine-threonine kinase receptor-...    192   2e-57   Cicer arietinum [garbanzo]
gb|KCW68995.1|  hypothetical protein EUGRSUZ_F02555                     191   2e-57   Eucalyptus grandis [rose gum]
ref|XP_007154947.1|  hypothetical protein PHAVU_003G160500g             192   2e-57   Phaseolus vulgaris [French bean]
ref|XP_008385958.1|  PREDICTED: serine-threonine kinase receptor-...    190   2e-57   
ref|XP_010688097.1|  PREDICTED: serine-threonine kinase receptor-...    192   3e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP32349.1|  hypothetical protein JCGZ_13274                         192   3e-57   Jatropha curcas
gb|KHG15168.1|  Serine-threonine kinase receptor-associated             191   3e-57   Gossypium arboreum [tree cotton]
ref|XP_008792113.1|  PREDICTED: serine-threonine kinase receptor-...    191   3e-57   Phoenix dactylifera
gb|KEH37967.1|  Serine/Threonine kinase receptor-associated-like ...    192   3e-57   Medicago truncatula
ref|XP_008464982.1|  PREDICTED: serine-threonine kinase receptor-...    192   4e-57   Cucumis melo [Oriental melon]
ref|XP_004167839.1|  PREDICTED: serine-threonine kinase receptor-...    192   4e-57   
ref|XP_004146293.1|  PREDICTED: serine-threonine kinase receptor-...    191   4e-57   Cucumis sativus [cucumbers]
gb|KJB70540.1|  hypothetical protein B456_011G079800                    191   5e-57   Gossypium raimondii
ref|XP_002517562.1|  serine-threonine kinase receptor-associated ...    191   5e-57   Ricinus communis
ref|XP_003524526.1|  PREDICTED: serine-threonine kinase receptor-...    191   5e-57   Glycine max [soybeans]
gb|KGN65408.1|  hypothetical protein Csa_1G418250                       191   6e-57   Cucumis sativus [cucumbers]
gb|KHN27398.1|  Serine-threonine kinase receptor-associated protein     191   6e-57   Glycine soja [wild soybean]
ref|XP_010061947.1|  PREDICTED: serine-threonine kinase receptor-...    191   7e-57   Eucalyptus grandis [rose gum]
ref|XP_003549786.1|  PREDICTED: serine-threonine kinase receptor-...    191   7e-57   Glycine max [soybeans]
gb|KCW68993.1|  hypothetical protein EUGRSUZ_F02555                     189   9e-57   Eucalyptus grandis [rose gum]
ref|XP_007202311.1|  hypothetical protein PRUPE_ppa008052mg             190   1e-56   Prunus persica
ref|XP_006451011.1|  hypothetical protein CICLE_v10008796mg             190   1e-56   Citrus clementina [clementine]
ref|XP_009374067.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_010249966.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008337340.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   
ref|XP_004287375.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   Fragaria vesca subsp. vesca
ref|XP_009347464.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_008385948.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   
ref|XP_008343948.1|  PREDICTED: serine-threonine kinase receptor-...    190   1e-56   
ref|XP_010254304.1|  PREDICTED: serine-threonine kinase receptor-...    190   2e-56   Nelumbo nucifera [Indian lotus]
gb|KJB13091.1|  hypothetical protein B456_002G056400                    188   2e-56   Gossypium raimondii
gb|KHG01497.1|  Serine-threonine kinase receptor-associated             189   3e-56   Gossypium arboreum [tree cotton]
gb|ACU23446.1|  unknown                                                 189   3e-56   Glycine max [soybeans]
ref|XP_010654727.1|  PREDICTED: serine-threonine kinase receptor-...    189   3e-56   Vitis vinifera
gb|KJB54108.1|  hypothetical protein B456_009G020900                    189   3e-56   Gossypium raimondii
ref|XP_002285272.1|  PREDICTED: serine-threonine kinase receptor-...    189   3e-56   Vitis vinifera
ref|XP_009402893.1|  PREDICTED: serine-threonine kinase receptor-...    189   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537966.1|  PREDICTED: serine-threonine kinase receptor-...    186   5e-56   Tarenaya hassleriana [spider flower]
ref|XP_011081111.1|  PREDICTED: serine-threonine kinase receptor-...    188   6e-56   Sesamum indicum [beniseed]
gb|AFK46987.1|  unknown                                                 188   6e-56   Lotus japonicus
ref|XP_010925262.1|  PREDICTED: serine-threonine kinase receptor-...    188   7e-56   Elaeis guineensis
ref|XP_008242709.1|  PREDICTED: serine-threonine kinase receptor-...    188   8e-56   Prunus mume [ume]
gb|KJB13093.1|  hypothetical protein B456_002G056400                    188   9e-56   Gossypium raimondii
gb|AFK34417.1|  unknown                                                 187   1e-55   Medicago truncatula
gb|KDO52916.1|  hypothetical protein CISIN_1g018784mg                   185   1e-55   Citrus sinensis [apfelsine]
gb|KDO52917.1|  hypothetical protein CISIN_1g018784mg                   185   1e-55   Citrus sinensis [apfelsine]
ref|XP_006465395.1|  PREDICTED: serine-threonine kinase receptor-...    185   1e-55   
ref|XP_007013329.1|  Transducin/WD40 repeat-like superfamily prot...    187   2e-55   
ref|XP_002284993.1|  PREDICTED: serine-threonine kinase receptor-...    187   2e-55   Vitis vinifera
ref|XP_010537963.1|  PREDICTED: serine-threonine kinase receptor-...    186   2e-55   Tarenaya hassleriana [spider flower]
gb|KHG21144.1|  Serine-threonine kinase receptor-associated             187   2e-55   Gossypium arboreum [tree cotton]
ref|XP_006854996.1|  hypothetical protein AMTR_s00052p00205770          187   2e-55   Amborella trichopoda
gb|EYU21599.1|  hypothetical protein MIMGU_mgv1a009096mg                187   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_002438635.1|  hypothetical protein SORBIDRAFT_10g023300          187   2e-55   Sorghum bicolor [broomcorn]
gb|AGT15994.1|  hypothetical protein SHCRBa_159_J23_F_580               187   2e-55   Saccharum hybrid cultivar R570
emb|CDO98105.1|  unnamed protein product                                187   3e-55   Coffea canephora [robusta coffee]
ref|XP_011072259.1|  PREDICTED: serine-threonine kinase receptor-...    187   3e-55   Sesamum indicum [beniseed]
ref|NP_001142332.1|  LOC100274502                                       186   3e-55   Zea mays [maize]
ref|XP_010545787.1|  PREDICTED: serine-threonine kinase receptor-...    186   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_007023961.1|  Transducin/WD40 repeat-like superfamily protein    186   4e-55   
ref|XP_004965966.1|  PREDICTED: serine-threonine kinase receptor-...    186   5e-55   Setaria italica
ref|XP_006427174.1|  hypothetical protein CICLE_v10025975mg             184   5e-55   
gb|KDO52915.1|  hypothetical protein CISIN_1g018784mg                   186   5e-55   Citrus sinensis [apfelsine]
ref|XP_006465394.1|  PREDICTED: serine-threonine kinase receptor-...    186   7e-55   Citrus sinensis [apfelsine]
ref|NP_001288531.1|  uncharacterized protein LOC103629787               185   7e-55   Zea mays [maize]
ref|XP_007013330.1|  Transducin/WD40 repeat-like superfamily prot...    184   7e-55   
gb|KDP37150.1|  hypothetical protein JCGZ_06206                         185   1e-54   Jatropha curcas
ref|XP_002885098.1|  transducin family protein                          185   1e-54   
ref|NP_001046249.1|  Os02g0205400                                       184   2e-54   
ref|XP_006427175.1|  hypothetical protein CICLE_v10025975mg             184   2e-54   Citrus clementina [clementine]
gb|ACG31749.1|  serine-threonine kinase receptor-associated protein     184   2e-54   Zea mays [maize]
ref|XP_010914940.1|  PREDICTED: serine-threonine kinase receptor-...    184   2e-54   Elaeis guineensis
ref|XP_006305313.1|  hypothetical protein CARUB_v10009691mg             184   3e-54   Capsella rubella
ref|XP_010465533.1|  PREDICTED: serine-threonine kinase receptor-...    184   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010487393.1|  PREDICTED: serine-threonine kinase receptor-...    184   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006341669.1|  PREDICTED: serine-threonine kinase receptor-...    184   6e-54   Solanum tuberosum [potatoes]
emb|CDP03398.1|  unnamed protein product                                183   6e-54   Coffea canephora [robusta coffee]
gb|AFW87112.1|  serine-threonine kinase receptor-associated protein     186   6e-54   
ref|XP_003563679.1|  PREDICTED: serine-threonine kinase receptor-...    183   6e-54   Brachypodium distachyon [annual false brome]
emb|CDY61819.1|  BnaC06g41840D                                          182   7e-54   Brassica napus [oilseed rape]
gb|EYU24671.1|  hypothetical protein MIMGU_mgv1a010043mg                182   8e-54   Erythranthe guttata [common monkey flower]
ref|XP_002891712.1|  transducin family protein                          182   8e-54   
ref|NP_849800.1|  transducin/WD-40 repeat-containing protein            182   9e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392876.1|  hypothetical protein EUTSA_v10011626mg             182   9e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010500889.1|  PREDICTED: serine-threonine kinase receptor-...    182   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009602512.1|  PREDICTED: serine-threonine kinase receptor-...    183   9e-54   Nicotiana tomentosiformis
ref|NP_566519.1|  transducin/WD40 domain-containing protein             182   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563978.1|  transducin/WD40 repeat-like superfamily protein       182   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890105.1|  transducin family protein                          182   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_009147669.1|  PREDICTED: serine-threonine kinase receptor-...    182   2e-53   Brassica rapa
ref|XP_006305259.1|  hypothetical protein CARUB_v10009632mg             182   2e-53   Capsella rubella
emb|CDX89958.1|  BnaA10g01240D                                          182   2e-53   
emb|CDY39650.1|  BnaC05g11790D                                          181   2e-53   Brassica napus [oilseed rape]
gb|EPS74468.1|  hypothetical protein M569_00279                         181   2e-53   Genlisea aurea
gb|EMS49047.1|  Serine-threonine kinase receptor-associated protein     181   3e-53   Triticum urartu
ref|XP_010497185.1|  PREDICTED: serine-threonine kinase receptor-...    181   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009148941.1|  PREDICTED: serine-threonine kinase receptor-...    181   3e-53   Brassica rapa
ref|XP_009144818.1|  PREDICTED: serine-threonine kinase receptor-...    181   4e-53   Brassica rapa
ref|XP_010476637.1|  PREDICTED: serine-threonine kinase receptor-...    181   4e-53   Camelina sativa [gold-of-pleasure]
emb|CDY40132.1|  BnaC06g05570D                                          181   4e-53   Brassica napus [oilseed rape]
ref|XP_004235719.1|  PREDICTED: serine-threonine kinase receptor-...    181   4e-53   Solanum lycopersicum
ref|XP_009388533.1|  PREDICTED: serine-threonine kinase receptor-...    181   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ97958.1|  predicted protein                                      181   5e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006298067.1|  hypothetical protein CARUB_v10014111mg             180   6e-53   Capsella rubella
ref|XP_009770768.1|  PREDICTED: serine-threonine kinase receptor-...    179   6e-53   Nicotiana sylvestris
ref|XP_006656206.1|  PREDICTED: serine-threonine kinase receptor-...    180   7e-53   Oryza brachyantha
ref|NP_001057997.1|  Os06g0598900                                       180   7e-53   
gb|EEC80916.1|  hypothetical protein OsI_23591                          179   7e-53   Oryza sativa Indica Group [Indian rice]
dbj|BAD32940.1|  putative WD-40 repeat protein                          180   8e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010503217.1|  PREDICTED: serine-threonine kinase receptor-...    180   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006406945.1|  hypothetical protein EUTSA_v10021071mg             180   1e-52   Eutrema salsugineum [saltwater cress]
gb|EMT15935.1|  hypothetical protein F775_06783                         180   2e-52   
ref|XP_009770767.1|  PREDICTED: serine-threonine kinase receptor-...    178   2e-52   Nicotiana sylvestris
ref|XP_006647058.1|  PREDICTED: serine-threonine kinase receptor-...    179   2e-52   Oryza brachyantha
gb|KEH23437.1|  3-ketoacyl-CoA synthase                                 186   2e-52   Medicago truncatula
ref|XP_009760123.1|  PREDICTED: serine-threonine kinase receptor-...    179   2e-52   Nicotiana sylvestris
gb|KJB64820.1|  hypothetical protein B456_010G066700                    179   2e-52   Gossypium raimondii
emb|CDY55992.1|  BnaA09g56870D                                          179   2e-52   Brassica napus [oilseed rape]
ref|XP_009596072.1|  PREDICTED: serine-threonine kinase receptor-...    179   2e-52   Nicotiana tomentosiformis
dbj|BAJ92707.1|  predicted protein                                      179   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009596073.1|  PREDICTED: serine-threonine kinase receptor-...    179   3e-52   Nicotiana tomentosiformis
gb|KFK38907.1|  hypothetical protein AALP_AA3G176400                    179   3e-52   Arabis alpina [alpine rockcress]
ref|XP_002451748.1|  hypothetical protein SORBIDRAFT_04g007180          178   4e-52   Sorghum bicolor [broomcorn]
ref|XP_009596074.1|  PREDICTED: serine-threonine kinase receptor-...    178   4e-52   Nicotiana tomentosiformis
ref|XP_006416902.1|  hypothetical protein EUTSA_v10008159mg             178   4e-52   Eutrema salsugineum [saltwater cress]
emb|CDY62165.1|  BnaA05g35670D                                          178   5e-52   Brassica napus [oilseed rape]
emb|CDX81717.1|  BnaC08g38840D                                          178   5e-52   
ref|XP_009596070.1|  PREDICTED: serine-threonine kinase receptor-...    179   6e-52   Nicotiana tomentosiformis
ref|XP_009117826.1|  PREDICTED: serine-threonine kinase receptor-...    177   7e-52   Brassica rapa
gb|KJB27111.1|  hypothetical protein B456_004G278600                    176   8e-52   Gossypium raimondii
ref|XP_009596071.1|  PREDICTED: serine-threonine kinase receptor-...    178   8e-52   Nicotiana tomentosiformis
ref|XP_004951509.1|  PREDICTED: serine-threonine kinase receptor-...    177   1e-51   Setaria italica
dbj|BAE46565.1|  putative WD-40 repeat protein                          177   1e-51   Nicotiana glutinosa
ref|XP_010542265.1|  PREDICTED: serine-threonine kinase receptor-...    177   1e-51   Tarenaya hassleriana [spider flower]
gb|EMT09457.1|  hypothetical protein F775_27621                         177   1e-51   
gb|KHG29669.1|  Serine-threonine kinase receptor-associated             176   1e-51   Gossypium arboreum [tree cotton]
ref|XP_010459083.1|  PREDICTED: serine-threonine kinase receptor-...    176   4e-51   Camelina sativa [gold-of-pleasure]
gb|KFK35774.1|  hypothetical protein AALP_AA4G034300                    173   4e-50   Arabis alpina [alpine rockcress]
ref|XP_008785435.1|  PREDICTED: serine-threonine kinase receptor-...    152   4e-42   Phoenix dactylifera
ref|XP_001756882.1|  predicted protein                                  148   2e-40   
ref|XP_002977277.1|  hypothetical protein SELMODRAFT_151778             143   1e-38   Selaginella moellendorffii
ref|XP_002992164.1|  hypothetical protein SELMODRAFT_186588             143   1e-38   Selaginella moellendorffii
ref|XP_001777192.1|  predicted protein                                  142   5e-38   
gb|AFK43194.1|  unknown                                                 134   1e-36   Medicago truncatula
ref|XP_007023909.1|  Transducin/WD40 repeat-like superfamily protein    121   4e-32   
emb|CAN67314.1|  hypothetical protein VITISV_014120                     122   2e-30   Vitis vinifera
gb|ABR25578.1|  serine-threonine kinase receptor-associated protein     116   6e-30   Oryza sativa Indica Group [Indian rice]
emb|CEF99303.1|  G-protein beta WD-40 repeat                            109   3e-26   Ostreococcus tauri
ref|XP_003055628.1|  predicted protein                                  106   3e-25   Micromonas pusilla CCMP1545
ref|XP_003081517.1|  WD40 repeat protein (ISS)                          109   4e-25   
ref|XP_001419915.1|  predicted protein                                  104   2e-24   Ostreococcus lucimarinus CCE9901
gb|KIZ04267.1|  serine-threonine kinase receptor-associated protein     103   3e-24   Monoraphidium neglectum
ref|XP_007510202.1|  predicted protein                                  103   6e-24   Bathycoccus prasinos
ref|XP_005650326.1|  WD40 repeat-like protein                           103   8e-24   Coccomyxa subellipsoidea C-169
ref|XP_010537967.1|  PREDICTED: serine-threonine kinase receptor-...  97.4    2e-22   
ref|XP_002503507.1|  predicted protein                                95.1    5e-21   Micromonas commoda
ref|XP_006385489.1|  hypothetical protein POPTR_0003s05820g           89.4    7e-19   
ref|XP_637742.1|  WD40 repeat-containing protein                      89.0    8e-19   Dictyostelium discoideum AX4
emb|CAF96754.1|  unnamed protein product                              87.8    3e-18   Tetraodon nigroviridis
gb|ACO09706.1|  Serine-threonine kinase receptor-associated protein   87.0    5e-18   Osmerus mordax
ref|NP_956598.1|  serine-threonine kinase receptor-associated pro...  86.7    7e-18   Danio rerio [leopard danio]
ref|XP_010882092.1|  PREDICTED: serine-threonine kinase receptor-...  85.9    1e-17   Esox lucius
ref|XP_007577214.1|  PREDICTED: serine-threonine kinase receptor-...  85.9    1e-17   Poecilia formosa
ref|XP_004564824.1|  PREDICTED: serine-threonine kinase receptor-...  85.5    2e-17   
ref|XP_004564827.1|  PREDICTED: serine-threonine kinase receptor-...  85.1    3e-17   Maylandia zebra
ref|XP_004564826.1|  PREDICTED: serine-threonine kinase receptor-...  85.1    3e-17   Maylandia zebra
ref|XP_001691265.1|  hypothetical protein CHLREDRAFT_128295           84.7    3e-17   Chlamydomonas reinhardtii
ref|XP_008399465.1|  PREDICTED: serine-threonine kinase receptor-...  84.7    3e-17   Poecilia reticulata
ref|XP_006633224.1|  PREDICTED: serine-threonine kinase receptor-...  84.3    4e-17   Lepisosteus oculatus
gb|AAK01368.1|  serine-threonine kinase receptor-associated protein   84.0    6e-17   Carassius gibelio [gibel carp]
ref|XP_010740062.1|  PREDICTED: serine-threonine kinase receptor-...  83.6    8e-17   Larimichthys crocea [croceine croaker]
ref|XP_005454109.1|  PREDICTED: serine-threonine kinase receptor-...  83.2    1e-16   
emb|CDQ67406.1|  unnamed protein product                              83.2    1e-16   Oncorhynchus mykiss
ref|XP_008314236.1|  PREDICTED: serine-threonine kinase receptor-...  82.8    1e-16   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005849411.1|  hypothetical protein CHLNCDRAFT_143924           82.0    3e-16   Chlorella variabilis
ref|XP_011498271.1|  PREDICTED: serine-threonine kinase receptor-...  81.3    5e-16   Ceratosolen solmsi marchali
ref|XP_003402993.1|  PREDICTED: serine-threonine kinase receptor-...  81.3    6e-16   Bombus terrestris [large earth bumblebee]
ref|XP_010885258.1|  PREDICTED: serine-threonine kinase receptor-...  81.3    6e-16   Esox lucius
ref|XP_003487985.1|  PREDICTED: serine-threonine kinase receptor-...  81.3    6e-16   Bombus impatiens
ref|XP_001361095.1|  GA17804                                          80.5    1e-15   Drosophila pseudoobscura pseudoobscura
ref|XP_004082930.1|  PREDICTED: serine-threonine kinase receptor-...  80.1    2e-15   Oryzias latipes [Japanese rice fish]
ref|XP_008288513.1|  PREDICTED: serine-threonine kinase receptor-...  79.7    2e-15   Stegastes partitus
ref|XP_008288505.1|  PREDICTED: serine-threonine kinase receptor-...  79.7    3e-15   Stegastes partitus
ref|XP_005179105.1|  PREDICTED: serine-threonine kinase receptor-...  79.0    3e-15   Musca domestica
ref|XP_010773038.1|  PREDICTED: serine-threonine kinase receptor-...  79.3    3e-15   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001959831.1|  GF11838                                          79.3    3e-15   Drosophila ananassae
ref|XP_005179104.1|  PREDICTED: serine-threonine kinase receptor-...  79.0    4e-15   Musca domestica
gb|KDD74316.1|  hypothetical protein H632_c1406p0                     78.2    5e-15   Helicosporidium sp. ATCC 50920
ref|XP_006006111.1|  PREDICTED: serine-threonine kinase receptor-...  78.6    6e-15   Latimeria chalumnae
ref|XP_004360523.1|  WD40 repeat-containing protein                   78.6    6e-15   Cavenderia fasciculata
gb|EXX68237.1|  Tif34p                                                77.8    1e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_396504.1|  PREDICTED: serine-threonine kinase receptor-ass...  77.8    1e-14   Apis mellifera [bee]
ref|XP_001986592.1|  GH20440                                          77.8    1e-14   Drosophila grimshawi
ref|NP_001279558.1|  serine/threonine kinase receptor associated ...  77.8    1e-14   Callorhinchus milii [Australian ghost shark]
gb|ESA22835.1|  hypothetical protein GLOINDRAFT_342473                77.8    1e-14   
gb|EFA79493.1|  WD40 repeat-containing protein                        77.4    1e-14   Heterostelium album PN500
ref|XP_003294375.1|  WD40 repeat-containing protein                   77.0    1e-14   Dictyostelium purpureum
ref|XP_003972671.1|  PREDICTED: serine-threonine kinase receptor-...  77.0    2e-14   Takifugu rubripes [tiger puffer]
ref|XP_008544371.1|  PREDICTED: serine-threonine kinase receptor-...  77.0    2e-14   Microplitis demolitor
ref|XP_001624518.1|  predicted protein                                75.9    2e-14   Nematostella vectensis
ref|XP_001976425.1|  GG20020                                          76.6    3e-14   Drosophila erecta
ref|XP_005805514.1|  PREDICTED: serine-threonine kinase receptor-...  76.6    3e-14   
ref|XP_011270254.1|  hypothetical protein CAOG_08643                  76.3    3e-14   Capsaspora owczarzaki ATCC 30864
ref|XP_003705564.1|  PREDICTED: serine-threonine kinase receptor-...  75.9    5e-14   Megachile rotundata
ref|NP_611804.1|  wing morphogenesis defect, isoform A                75.9    6e-14   Drosophila melanogaster
ref|XP_011335793.1|  PREDICTED: serine-threonine kinase receptor-...  75.9    6e-14   Ooceraea biroi
ref|XP_011052618.1|  PREDICTED: serine-threonine kinase receptor-...  75.9    6e-14   Acromyrmex echinatior
ref|NP_001090526.1|  serine/threonine kinase receptor associated ...  75.1    7e-14   Xenopus laevis [clawed frog]
gb|KFM64458.1|  Serine-threonine kinase receptor-associated protein   75.5    8e-14   Stegodyphus mimosarum
ref|XP_002074661.1|  GK23046                                          75.1    1e-13   Drosophila willistoni
gb|KDR13003.1|  Serine-threonine kinase receptor-associated protein   75.5    1e-13   Zootermopsis nevadensis
ref|XP_969569.1|  PREDICTED: serine-threonine kinase receptor-ass...  75.1    1e-13   Tribolium castaneum [rust-red flour beetle]
ref|XP_007527681.1|  PREDICTED: serine-threonine kinase receptor-...  74.7    2e-13   Erinaceus europaeus [common hedgehog]
ref|XP_004525970.1|  PREDICTED: serine-threonine kinase receptor-...  73.6    4e-13   Ceratitis capitata [medfly]
ref|XP_011263567.1|  PREDICTED: serine-threonine kinase receptor-...  73.6    4e-13   Camponotus floridanus
ref|XP_011190917.1|  PREDICTED: serine-threonine kinase receptor-...  73.6    4e-13   Zeugodacus cucurbitae [melon fruit fly]
ref|NP_001087814.1|  serine/threonine kinase receptor associated ...  73.6    4e-13   Xenopus laevis [clawed frog]
ref|XP_011150584.1|  PREDICTED: serine-threonine kinase receptor-...  73.6    4e-13   Harpegnathos saltator
ref|XP_002059888.1|  GJ14989                                          73.6    4e-13   Drosophila virilis
gb|EPQ08116.1|  Serine-threonine kinase receptor-associated protein   72.8    5e-13   Myotis brandtii
ref|XP_011207556.1|  PREDICTED: serine-threonine kinase receptor-...  72.4    6e-13   Bactrocera dorsalis [papaya fruit fly]
dbj|GAM26537.1|  hypothetical protein SAMD00019534_097120             72.4    6e-13   Acytostelium subglobosum LB1
ref|XP_011207555.1|  PREDICTED: serine-threonine kinase receptor-...  72.4    9e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_006084353.1|  PREDICTED: serine-threonine kinase receptor-...  72.8    9e-13   Myotis lucifugus
ref|NP_001120495.1|  serine/threonine kinase receptor associated ...  72.4    1e-12   Xenopus tropicalis [western clawed frog]
gb|ENN71163.1|  hypothetical protein YQE_12093                        72.0    1e-12   Dendroctonus ponderosae
ref|XP_002732021.1|  PREDICTED: serine-threonine kinase receptor-...  72.0    1e-12   Saccoglossus kowalevskii
ref|XP_002004424.1|  GI19623                                          72.0    2e-12   Drosophila mojavensis
ref|XP_004460360.1|  PREDICTED: serine-threonine kinase receptor-...  72.0    2e-12   Dasypus novemcinctus
ref|XP_001600320.1|  PREDICTED: serine-threonine kinase receptor-...  71.6    2e-12   Nasonia vitripennis
ref|XP_004460359.1|  PREDICTED: serine-threonine kinase receptor-...  72.0    2e-12   Dasypus novemcinctus
ref|XP_006505894.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    2e-12   
ref|XP_011396442.1|  Serine-threonine kinase receptor-associated ...  71.6    2e-12   Auxenochlorella protothecoides
ref|XP_011156221.1|  PREDICTED: serine-threonine kinase receptor-...  71.6    2e-12   Solenopsis invicta [imported red fire ant]
ref|XP_006773325.1|  PREDICTED: serine-threonine kinase receptor-...  72.0    2e-12   Myotis davidii
gb|EFZ20290.1|  hypothetical protein SINV_00798                       71.6    2e-12   
ref|XP_011301387.1|  PREDICTED: serine-threonine kinase receptor-...  71.2    3e-12   Fopius arisanus
ref|XP_003749912.2|  PREDICTED: serine-threonine kinase receptor-...  70.5    3e-12   Rattus norvegicus [brown rat]
ref|XP_007196085.1|  PREDICTED: serine-threonine kinase receptor-...  71.6    3e-12   Balaenoptera acutorostrata scammoni
ref|XP_002949849.1|  hypothetical protein VOLCADRAFT_80852            70.9    3e-12   Volvox carteri f. nagariensis
ref|XP_007196086.1|  PREDICTED: serine-threonine kinase receptor-...  71.2    3e-12   Balaenoptera acutorostrata scammoni
ref|XP_007942645.1|  PREDICTED: serine-threonine kinase receptor-...  70.1    3e-12   Orycteropus afer afer
ref|XP_005253351.1|  PREDICTED: serine-threonine kinase receptor-...  70.1    4e-12   Homo sapiens [man]
gb|ERL83460.1|  hypothetical protein D910_00452                       72.4    4e-12   Dendroctonus ponderosae
ref|XP_004611421.1|  PREDICTED: serine-threonine kinase receptor-...  70.5    4e-12   Sorex araneus [Eurasian shrew]
gb|EMP35054.1|  Serine-threonine kinase receptor-associated protein   69.7    4e-12   Chelonia mydas [green seaturtle]
ref|XP_004693302.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    4e-12   Condylura cristata
ref|XP_005866835.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    4e-12   
ref|XP_007060631.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    5e-12   
ref|XP_006866087.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    5e-12   Chrysochloris asiatica
ref|XP_004900757.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    5e-12   
gb|EFX76037.1|  hypothetical protein DAPPUDRAFT_306319                70.5    5e-12   Daphnia pulex
ref|XP_003934620.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    5e-12   Saimiri boliviensis boliviensis
ref|NP_035629.2|  serine-threonine kinase receptor-associated pro...  70.9    6e-12   Mus musculus [mouse]
gb|AAC98300.1|  serine-threonine kinase receptor-associated protein   70.9    6e-12   Mus musculus [mouse]
ref|XP_007105805.1|  PREDICTED: serine-threonine kinase receptor-...  70.5    6e-12   
ref|XP_007105804.1|  PREDICTED: serine-threonine kinase receptor-...  70.5    6e-12   
dbj|BAC36834.1|  unnamed protein product                              70.5    6e-12   Mus musculus [mouse]
gb|EHB13154.1|  Serine-threonine kinase receptor-associated protein   70.9    6e-12   Heterocephalus glaber [naked mole rat]
ref|XP_003405722.1|  PREDICTED: serine-threonine kinase receptor-...  70.5    7e-12   Loxodonta africana [African bush elephant]
ref|XP_010212611.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    8e-12   Tinamus guttatus
ref|XP_001092419.2|  PREDICTED: serine-threonine kinase receptor-...  69.7    9e-12   
gb|KGL77017.1|  Serine-threonine kinase receptor-associated protein   69.7    1e-11   Tinamus guttatus
ref|XP_008138676.1|  PREDICTED: serine-threonine kinase receptor-...  70.1    1e-11   Eptesicus fuscus
gb|EFB27992.1|  hypothetical protein PANDA_007277                     69.3    1e-11   Ailuropoda melanoleuca
ref|XP_005072957.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    1e-11   
ref|XP_006738772.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   Leptonychotes weddellii
ref|NP_001015567.1|  serine-threonine kinase receptor-associated ...  69.7    1e-11   Bos taurus [bovine]
ref|XP_009423197.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_007942644.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
gb|ELR47822.1|  Serine-threonine kinase receptor-associated protein   69.7    1e-11   
ref|XP_005207035.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_004387406.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_003355612.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_008513820.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
dbj|BAA75544.1|  WD-40 repeat protein                                 69.7    1e-11   
ref|XP_543790.1|  PREDICTED: serine-threonine kinase receptor-ass...  69.7    1e-11   
ref|XP_006192161.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_003265599.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_010614344.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_004435470.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_001497523.3|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
gb|AAX36803.1|  serine/threonine kinase receptor associated protein   69.7    1e-11   
ref|XP_008588001.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_002918764.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|XP_002712677.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    1e-11   
ref|NP_009109.3|  serine-threonine kinase receptor-associated pro...  69.7    1e-11   
ref|XP_008065722.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
ref|XP_002752244.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
gb|AAX32050.1|  serine/threonine kinase receptor associated protein   69.3    2e-11   
ref|XP_003906114.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
ref|XP_004713826.1|  PREDICTED: serine-threonine kinase receptor-...  68.9    2e-11   
ref|XP_005287566.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
ref|NP_001272106.1|  uncharacterized protein LOC101926115             69.3    2e-11   
ref|XP_007965964.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
dbj|BAG60258.1|  unnamed protein product                              69.3    2e-11   
ref|XP_009009309.1|  hypothetical protein HELRODRAFT_184835           68.9    2e-11   
ref|XP_006130331.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    2e-11   
ref|XP_006130330.1|  PREDICTED: serine-threonine kinase receptor-...  68.9    2e-11   
ref|XP_004281156.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
ref|XP_005379078.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    2e-11   
ref|XP_005379079.1|  PREDICTED: serine-threonine kinase receptor-...  68.9    2e-11   
ref|XP_008473381.1|  PREDICTED: serine-threonine kinase receptor-...  68.9    3e-11   
gb|ETE62118.1|  Serine-threonine kinase receptor-associated protein   68.9    3e-11   
ref|NP_001011969.1|  serine-threonine kinase receptor-associated ...  68.6    3e-11   
gb|KFH62158.1|  hypothetical protein MVEG_11797                       68.2    3e-11   
ref|XP_008854253.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    3e-11   
ref|XP_005108804.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    3e-11   
ref|XP_004407033.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    3e-11   
ref|XP_006167390.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    4e-11   
gb|KFV79686.1|  Serine-threonine kinase receptor-associated protein   68.2    4e-11   
ref|XP_005072956.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    4e-11   
gb|EGW07522.1|  Serine-threonine kinase receptor-associated protein   67.8    4e-11   
ref|XP_010196813.1|  PREDICTED: serine-threonine kinase receptor-...  67.8    4e-11   
ref|XP_004636879.1|  PREDICTED: serine-threonine kinase receptor-...  67.8    4e-11   
ref|XP_002155180.2|  PREDICTED: serine-threonine kinase receptor-...  68.2    4e-11   
ref|XP_005761541.1|  hypothetical protein EMIHUDRAFT_428205           67.8    4e-11   
gb|EHH20553.1|  hypothetical protein EGK_03430                        68.2    5e-11   
gb|KFP30380.1|  Serine-threonine kinase receptor-associated protein   67.8    5e-11   
ref|XP_005954904.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    5e-11   
gb|AAV38848.1|  unr-interacting protein                               68.2    5e-11   
ref|XP_002823033.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    5e-11   
emb|CAB66626.1|  hypothetical protein                                 68.2    5e-11   
ref|XP_006888543.1|  PREDICTED: serine-threonine kinase receptor-...  67.8    5e-11   
ref|XP_003265600.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    5e-11   
ref|XP_009670239.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    5e-11   
ref|XP_007639831.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    5e-11   
ref|XP_010001239.1|  PREDICTED: serine-threonine kinase receptor-...  67.4    5e-11   
ref|XP_006976563.1|  PREDICTED: serine-threonine kinase receptor-...  67.8    6e-11   
ref|XP_004626155.1|  PREDICTED: serine-threonine kinase receptor-...  67.8    6e-11   
gb|KFW77589.1|  Serine-threonine kinase receptor-associated protein   67.4    6e-11   
ref|XP_002120914.1|  PREDICTED: serine-threonine kinase receptor-...  67.4    6e-11   
gb|KFU93601.1|  Serine-threonine kinase receptor-associated protein   67.4    7e-11   
ref|XP_008918070.1|  PREDICTED: serine-threonine kinase receptor-...  67.4    7e-11   
gb|EOB03138.1|  Serine-threonine kinase receptor-associated protein   66.6    7e-11   
ref|XP_009986298.1|  PREDICTED: serine-threonine kinase receptor-...  67.0    8e-11   
gb|KFZ52756.1|  Serine-threonine kinase receptor-associated protein   67.0    9e-11   
gb|KFV02551.1|  Serine-threonine kinase receptor-associated protein   67.0    9e-11   
ref|XP_005364593.1|  PREDICTED: serine-threonine kinase receptor-...  67.0    1e-10   
ref|XP_006030930.1|  PREDICTED: serine-threonine kinase receptor-...  67.0    1e-10   
ref|XP_005017139.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    1e-10   
ref|XP_008642236.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    1e-10   
ref|NP_001006247.2|  serine-threonine kinase receptor-associated ...  67.0    1e-10   
ref|XP_007423037.1|  PREDICTED: serine-threonine kinase receptor-...  67.0    1e-10   
ref|XP_007454678.1|  PREDICTED: serine-threonine kinase receptor-...  67.0    1e-10   
ref|XP_003386567.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    1e-10   
ref|XP_010283534.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_009647020.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_009498489.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_009469303.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
emb|CAG31560.1|  hypothetical protein RCJMB04_7p19                    67.0    1e-10   
ref|XP_009960882.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
gb|KFO54453.1|  Serine-threonine kinase receptor-associated protein   66.6    1e-10   
ref|XP_009941306.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_005234771.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_003470485.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    1e-10   
ref|XP_010300389.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_010160441.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_010150775.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    1e-10   
ref|XP_002192073.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    1e-10   
ref|XP_009941305.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
gb|KFW96058.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFO10719.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFV93538.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
ref|XP_008504145.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_005425359.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_003226007.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
ref|XP_007128060.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
ref|XP_009871765.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_005481923.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
gb|KFR03659.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFQ43384.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFV39167.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFR17334.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFQ66986.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
ref|XP_009093405.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
ref|XP_005481924.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
ref|XP_009093404.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
gb|KFP77957.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFM07331.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
ref|XP_010402481.1|  PREDICTED: serine-threonine kinase receptor-...  66.6    2e-10   
gb|KFP46563.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
ref|XP_005040456.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
gb|KFZ45992.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFP10993.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFV69096.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
ref|XP_009927393.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_010564424.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_010078294.1|  PREDICTED: serine-threonine kinase receptor-...  65.9    2e-10   
ref|XP_009568933.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_005148197.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
gb|ELU00352.1|  hypothetical protein CAPTEDRAFT_229092                65.9    2e-10   
gb|EMC81744.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
gb|KFV00111.1|  Serine-threonine kinase receptor-associated protein   65.9    2e-10   
ref|XP_009901096.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
ref|XP_001363811.1|  PREDICTED: serine-threonine kinase receptor-...  66.2    2e-10   
gb|KFO70957.1|  Serine-threonine kinase receptor-associated protein   66.2    2e-10   
ref|XP_004932595.1|  PREDICTED: serine-threonine kinase receptor-...  65.1    3e-10   
ref|XP_009072405.1|  PREDICTED: serine-threonine kinase receptor-...  65.5    3e-10   
ref|XP_011434029.1|  PREDICTED: serine-threonine kinase receptor-...  64.3    3e-10   
ref|XP_003771228.1|  PREDICTED: serine-threonine kinase receptor-...  65.9    3e-10   
gb|KFP70262.1|  Serine-threonine kinase receptor-associated protein   65.5    3e-10   
gb|EIE82147.1|  hypothetical protein RO3G_06852                       65.5    3e-10   
gb|EKC40117.1|  Serine-threonine kinase receptor-associated protein   63.9    4e-10   
ref|XP_004664503.1|  PREDICTED: serine-threonine kinase receptor-...  65.5    4e-10   
ref|XP_009697962.1|  PREDICTED: LOW QUALITY PROTEIN: serine-threo...  65.1    4e-10   
ref|XP_011448524.1|  PREDICTED: serine-threonine kinase receptor-...  64.3    4e-10   
ref|XP_011114217.1|  hypothetical protein H072_8512                   65.1    5e-10   
ref|XP_010188075.1|  PREDICTED: serine-threonine kinase receptor-...  65.1    5e-10   
emb|CEP16447.1|  hypothetical protein                                 65.1    5e-10   
gb|KFQ24876.1|  Serine-threonine kinase receptor-associated protein   65.1    5e-10   
gb|EPB83379.1|  hypothetical protein HMPREF1544_09854                 64.7    6e-10   
ref|XP_004588235.1|  PREDICTED: serine-threonine kinase receptor-...  64.7    8e-10   
ref|XP_002607713.1|  hypothetical protein BRAFLDRAFT_82840            64.3    8e-10   
dbj|GAN06900.1|  Ser/Thr kinase receptor associated protein           63.9    1e-09   
ref|XP_009059987.1|  hypothetical protein LOTGIDRAFT_182822           63.5    1e-09   
emb|CEG64490.1|  hypothetical protein RMATCC62417_01451               62.8    2e-09   
emb|CEG82446.1|  hypothetical protein RMATCC62417_16515               62.8    2e-09   
ref|XP_001652721.1|  AAEL007382-PA                                    63.5    2e-09   
emb|CEG82445.1|  hypothetical protein RMATCC62417_16515               62.8    2e-09   
emb|CEG64489.1|  hypothetical protein RMATCC62417_01451               62.8    3e-09   
gb|EHJ68792.1|  putative serine-threonine kinase receptor-associa...  62.4    4e-09   
ref|XP_005835567.1|  hypothetical protein GUITHDRAFT_86025            62.4    5e-09   
ref|XP_001950349.1|  PREDICTED: serine-threonine kinase receptor-...  62.0    7e-09   
gb|EKC28284.1|  Serine-threonine kinase receptor-associated protein   63.2    7e-09   
emb|CCJ29855.1|  unnamed protein product                              60.5    2e-08   
ref|XP_001868161.1|  serine-threonine kinase receptor-associated ...  60.5    2e-08   
gb|EHB01677.1|  Serine-threonine kinase receptor-associated protein   60.5    2e-08   
ref|XP_002988251.1|  hypothetical protein SELMODRAFT_269383           60.1    3e-08   
gb|ETN67896.1|  serine-threonine kinase receptor-associated protein   59.7    5e-08   
emb|CCX05695.1|  Similar to Serine-threonine kinase receptor-asso...  58.5    8e-08   
ref|XP_001995045.1|  GH22937                                          58.5    1e-07   
ref|XP_003740623.1|  PREDICTED: serine-threonine kinase receptor-...  58.5    1e-07   
ref|XP_001997773.1|  GH23517                                          57.8    2e-07   
ref|XP_001995044.1|  GH22852                                          57.8    2e-07   
ref|XP_007875269.1|  hypothetical protein PNEG_03206                  57.4    3e-07   
gb|KFB48346.1|  AGAP005029-PA-like protein                            57.4    3e-07   
gb|ETO24358.1|  hypothetical protein RFI_12799                        58.2    3e-07   
ref|XP_004333795.1|  WD domain containing protein                     57.0    6e-07   
gb|KGB80355.1|  serine/threonine kinase receptor associated protein   56.2    7e-07   
gb|KIR37578.1|  serine-threonine kinase receptor-associated protein   56.2    7e-07   
gb|KIR83390.1|  serine-threonine kinase receptor-associated protein   56.2    8e-07   
gb|KIR57708.1|  serine-threonine kinase receptor-associated protein   56.2    8e-07   
gb|AFR93022.1|  serine-threonine kinase receptor-associated protein   56.2    8e-07   
ref|XP_003192460.1|  serine/threonine kinase receptor associated ...  56.2    8e-07   
gb|KIR44979.1|  serine-threonine kinase receptor-associated protein   56.2    8e-07   
ref|XP_001688468.1|  AGAP005029-PA                                    55.8    1e-06   
ref|XP_794772.3|  PREDICTED: serine-threonine kinase receptor-ass...  55.5    1e-06   
ref|XP_002898038.1|  WD domain-containing protein, putative           55.5    1e-06   
ref|WP_008664877.1|  repeat-containing protein                        56.2    1e-06   
ref|XP_002049293.1|  GJ21510                                          55.1    1e-06   
ref|XP_568762.1|  serine/threonine kinase receptor associated pro...  55.5    2e-06   
gb|AAT01224.1|  katanin p80 subunit PF15p                             55.8    2e-06   
ref|XP_001697423.1|  katanin p80 subunit                              55.8    2e-06   
gb|EWC48094.1|  hypothetical protein DRE_02673                        54.7    2e-06   
ref|WP_008656498.1|  repeat protein                                   55.1    3e-06   
gb|EJT48331.1|  serine/threonine kinase receptor associated protein   54.3    3e-06   
gb|ETO10818.1|  WD-40 repeat protein                                  54.3    3e-06   
ref|XP_002017719.1|  GL17153                                          53.9    4e-06   
ref|XP_002006738.1|  GI18425                                          53.9    5e-06   
ref|XP_009777666.1|  PREDICTED: eukaryotic translation initiation...  53.5    5e-06   
ref|WP_007327858.1|  hypothetical protein                             54.3    5e-06   
gb|ACO12171.1|  Serine-threonine kinase receptor-associated protein   53.5    6e-06   
ref|WP_007335384.1|  hypothetical protein                             54.3    6e-06   
ref|XP_009629813.1|  PREDICTED: eukaryotic translation initiation...  53.5    6e-06   
ref|WP_011120678.1|  hypothetical protein                             54.3    6e-06   
ref|WP_007335521.1|  protein containing planctomycete cytochrome ...  54.3    6e-06   
ref|XP_009777665.1|  PREDICTED: eukaryotic translation initiation...  53.5    6e-06   
gb|AFK49343.1|  unknown                                               51.2    6e-06   
ref|XP_010522453.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  53.9    7e-06   
ref|XP_004250371.1|  PREDICTED: eukaryotic translation initiation...  53.1    7e-06   
ref|XP_002063973.1|  GK15619                                          53.5    7e-06   
gb|ETI37286.1|  hypothetical protein F443_16714                       53.1    8e-06   
ref|XP_001757566.1|  predicted protein                                53.1    8e-06   
gb|ETM37382.1|  hypothetical protein L914_16063                       53.1    9e-06   
ref|XP_008911963.1|  hypothetical protein PPTG_15500                  53.1    9e-06   
gb|KIM32040.1|  hypothetical protein M408DRAFT_327394                 52.8    9e-06   
ref|XP_005718524.1|  Translation initiation factor eIF3, subunit I    52.8    9e-06   
ref|XP_010111947.1|  Eukaryotic translation initiation factor 3 s...  53.1    9e-06   
ref|XP_009389562.1|  PREDICTED: eukaryotic translation initiation...  52.8    1e-05   
ref|XP_004492932.1|  PREDICTED: eukaryotic translation initiation...  52.8    1e-05   
ref|XP_004489218.1|  PREDICTED: eukaryotic translation initiation...  52.8    1e-05   
ref|XP_006351166.1|  PREDICTED: eukaryotic translation initiation...  52.8    1e-05   
ref|XP_011125340.1|  hypothetical protein AOL_s00112g8                52.4    1e-05   
gb|KDD75202.1|  hypothetical protein H632_c812p0                      52.4    1e-05   
ref|XP_008728113.1|  hypothetical protein G647_05564                  52.4    1e-05   
ref|XP_002138769.1|  GA24983                                          52.0    2e-05   
gb|KIJ82644.1|  myosin kinase                                         52.8    2e-05   
gb|ERT05158.1|  WD domain, G-beta repeat protein                      52.8    2e-05   



>ref|XP_011040004.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Populus euphratica]
Length=350

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+FG  F+AGG
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGG  247



>ref|XP_002298116.1| transducin family protein [Populus trichocarpa]
 gb|EEE82921.1| transducin family protein [Populus trichocarpa]
Length=350

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCADIGGVRLWDIRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+FG  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGG  247



>ref|XP_011035638.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Populus euphratica]
Length=350

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCADIGGVRLWDIRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+FG  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGG  247



>ref|XP_002303265.1| transducin family protein [Populus trichocarpa]
 gb|EEE78244.1| transducin family protein [Populus trichocarpa]
Length=350

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKLGNKFVAGG  247



>gb|KJB70541.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=228

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA PR++D  PGS+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTS
Sbjct  22   RLDAAPREVDNSPGSIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTS  81

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  82   AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGG  136



>ref|XP_008337419.1| PREDICTED: serine-threonine kinase receptor-associated protein-like, 
partial [Malus domestica]
Length=230

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  13   RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  72

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  73   SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  127



>ref|XP_010098976.1| Serine-threonine kinase receptor-associated protein [Morus notabilis]
 gb|EXB76278.1| Serine-threonine kinase receptor-associated protein [Morus notabilis]
Length=350

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDLGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCTVESASLEPKYGNKFIAGG  247



>ref|XP_002529368.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
 gb|EEF33035.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
Length=350

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DGS+VKFWDAN F LVKSYDMPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTCDGSTVKFWDANHFGLVKSYDMPCTVESASLEPKYGNKFIAGG  247



>gb|KCW68994.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=265

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGG  247



>ref|XP_008785422.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Phoenix dactylifera]
Length=343

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGG  247



>gb|KJB70542.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70543.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70544.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70545.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=296

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA PR++D  PGS+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTS
Sbjct  90   RLDAAPREVDNSPGSIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTS  149

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  150  AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGG  204



>ref|XP_004515599.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cicer arietinum]
Length=353

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++D  PGSVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  133  RPDAPPKEVDKSPGSVRSVAWLHSDQTILSSCTDKGGVRLWDVRTGKIVQTLDTKSPMTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPCNVESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFIAGG  247



>gb|KCW68995.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=308

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  90   RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  149

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G  FIAGG
Sbjct  150  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGG  204



>ref|XP_007154947.1| hypothetical protein PHAVU_003G160500g [Phaseolus vulgaris]
 gb|ESW26941.1| hypothetical protein PHAVU_003G160500g [Phaseolus vulgaris]
Length=353

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP+FG  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKFGNKFVAGG  247



>ref|XP_008385958.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=274

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  248



>ref|XP_010688097.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Beta vulgaris subsp. vulgaris]
Length=352

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+R+ ++VRTL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDIGGVRLWDVRNGQIVRTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG+SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTCDGTSVKFWDANYFGLVKSYEMPCTVESASLEPKYGNKFVAGG  247



>gb|KDP32349.1| hypothetical protein JCGZ_13274 [Jatropha curcas]
Length=350

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSCSD  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCSDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DGS+VKFWDAN F LVKSY+MPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTCDGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGNKFIAGG  247



>gb|KHG15168.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=339

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA PR++D  PGSVRTVAWLH+DQTILSSCSDTSGVRLWDLRS ++V+TL++KS VTS
Sbjct  133  RLDAAPREVDNSPGSVRTVAWLHSDQTILSSCSDTSGVRLWDLRSGKIVQTLESKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGNKFIAGG  247



>ref|XP_008792113.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Phoenix dactylifera]
Length=343

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGG  247



>gb|KEH37967.1| Serine/Threonine kinase receptor-associated-like protein [Medicago 
truncatula]
Length=351

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++D  PGSVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  133  RPDAPPKEVDKSPGSVRSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPCNVESASLEP+FG  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFVAGG  247



>ref|XP_008464982.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis melo]
 ref|XP_008464983.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis melo]
Length=353

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGG  247



>ref|XP_004167839.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis sativus]
Length=353

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGG  247



>ref|XP_004146293.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis sativus]
Length=353

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGG  247



>gb|KJB70540.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=339

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA PR++D  PGS+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTS
Sbjct  133  RLDAAPREVDNSPGSIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGG  247



>ref|XP_002517562.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
 gb|EEF44726.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
Length=336

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+++  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVNSSPGSIRTVAWLHSDQTILSSCTDMGGVRLWDIRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNVESASLEPKLGNKFVAGG  247



>ref|XP_003524526.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Glycine max]
Length=352

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGG  247



>gb|KGN65408.1| hypothetical protein Csa_1G418250 [Cucumis sativus]
Length=366

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  146  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  205

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G  FIAGG
Sbjct  206  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGG  260



>gb|KHN27398.1| Serine-threonine kinase receptor-associated protein [Glycine 
soja]
Length=352

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGG  247



>ref|XP_010061947.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Eucalyptus grandis]
 gb|KCW68992.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=351

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGG  247



>ref|XP_003549786.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Glycine max]
 gb|KHN15128.1| Serine-threonine kinase receptor-associated protein [Glycine 
soja]
Length=352

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC +ES SLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTIESVSLEPKYGNKFVAGG  247



>gb|KCW68993.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=304

 Score =   189 bits (481),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGG  247



>ref|XP_007202311.1| hypothetical protein PRUPE_ppa008052mg [Prunus persica]
 gb|EMJ03510.1| hypothetical protein PRUPE_ppa008052mg [Prunus persica]
Length=347

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  247



>ref|XP_006451011.1| hypothetical protein CICLE_v10008796mg [Citrus clementina]
 ref|XP_006475776.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Citrus sinensis]
 gb|ESR64251.1| hypothetical protein CICLE_v10008796mg [Citrus clementina]
 gb|KDO80363.1| hypothetical protein CISIN_1g018860mg [Citrus sinensis]
Length=349

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILS+C+D  GVRLWD+RS E+V+TL+TKS VTS
Sbjct  133  RPDAPPREVDRSPGSVRTVAWLHSDQTILSTCTDMGGVRLWDVRSGEIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC +ESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTIESASLEPKYGNKFVAGG  247



>ref|XP_009374067.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
Length=351

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  248



>ref|XP_010249966.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nelumbo nucifera]
Length=350

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWDLRS ++++TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDMGGVRLWDLRSGQIIQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+V+FWDAN F LVKSY+MPC VESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVRFWDANHFALVKSYNMPCTVESASLEPKLGNKFIAGG  247



>ref|XP_008337340.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
 ref|XP_008352271.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=351

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  248



>ref|XP_004287375.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Fragaria vesca subsp. vesca]
Length=357

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VES SLEP+FG  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESVSLEPKFGNKFIAGG  247



>ref|XP_009347464.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
 ref|XP_009348196.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
Length=349

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  248



>ref|XP_008385948.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=352

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  248



>ref|XP_008343948.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=352

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGG  248



>ref|XP_010254304.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nelumbo nucifera]
Length=353

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TLDTKS VTS
Sbjct  133  RPDAPPREVDRSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLDTKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS VKFWDAN F LVKSY+MPC VESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSMVKFWDANHFTLVKSYNMPCTVESASLEPKHGNKFIAGG  247



>gb|KJB13091.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
 gb|KJB13092.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
Length=307

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R D  PRQ+D  PGS+RTVAWLH+DQ ILSSC+DT+GVRLWDLRS ++V+TL+TKS VTS
Sbjct  90   RLDEQPRQVDNSPGSIRTVAWLHSDQMILSSCTDTNGVRLWDLRSGKIVQTLETKSPVTS  149

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  150  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGG  204



>gb|KHG01497.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=349

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYNMPCTVESASLEPKYGNKFVAGG  247



>gb|ACU23446.1| unknown [Glycine max]
Length=352

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQ ILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQAILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGG  247



>ref|XP_010654727.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Vitis vinifera]
Length=356

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+++  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+R+ ++V TL+TKS VTS
Sbjct  143  RPDAPPREVENSPGSIRTVAWLHSDQTILSSCTDNGGVRLWDVRTGKIVHTLETKSPVTS  202

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADG++VKFWDAN + LVKSY+MPCN+ESASLEP+FG  FIAGG
Sbjct  203  AEVSQDGRYITTADGTTVKFWDANHYGLVKSYNMPCNMESASLEPKFGNKFIAGG  257



>gb|KJB54108.1| hypothetical protein B456_009G020900 [Gossypium raimondii]
Length=349

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN + LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYNMPCTVESASLEPKYGNKFVAGG  247



>ref|XP_002285272.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Vitis vinifera]
 emb|CBI36243.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+++  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+R+ ++V TL+TKS VTS
Sbjct  133  RPDAPPREVENSPGSIRTVAWLHSDQTILSSCTDNGGVRLWDVRTGKIVHTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADG++VKFWDAN + LVKSY+MPCN+ESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGTTVKFWDANHYGLVKSYNMPCNMESASLEPKFGNKFIAGG  247



>ref|XP_009402893.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Musa acuminata subsp. malaccensis]
Length=347

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+ID  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREIDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKDGNKFVAGG  247



>ref|XP_010537966.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Tarenaya hassleriana]
Length=259

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+ID  PGS+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTS
Sbjct  90   RPDAPPREIDKSPGSIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTS  149

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGS+VKFWDAN F LVKSY+MPC+VESASLEP+ G+ FIAGG
Sbjct  150  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYEMPCSVESASLEPKKGETFIAGG  204



>ref|XP_011081111.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Sesamum indicum]
Length=340

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+I+  PGSVRT+AWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RPDAPPREIEKSPGSVRTLAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVK YDMPC +ESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKRYDMPCIMESASLEPKFGNKFIAGG  247



>gb|AFK46987.1| unknown [Lotus japonicus]
Length=350

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGIIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI TADGS+VKFWDAN + +VKSYDMPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYIITADGSTVKFWDANYYGMVKSYDMPCTVESASLEPKYGNKFVAGG  247



>ref|XP_010925262.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Elaeis guineensis]
Length=343

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             PDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  HPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKLGNRFIAGG  247



>ref|XP_008242709.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Prunus mume]
Length=347

 Score =   188 bits (477),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSY++PC VESASLEP+FG  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNIPCTVESASLEPKFGNKFIAGG  247



>gb|KJB13093.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
 gb|KJB13094.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
Length=350

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R D  PRQ+D  PGS+RTVAWLH+DQ ILSSC+DT+GVRLWDLRS ++V+TL+TKS VTS
Sbjct  133  RLDEQPRQVDNSPGSIRTVAWLHSDQMILSSCTDTNGVRLWDLRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGG  247



>gb|AFK34417.1| unknown [Medicago truncatula]
Length=351

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++D  PGSV +VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  133  RPDAPPKEVDKSPGSVTSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG YITTADGS+VKFWDAN + LVKSYDMPCNVESASLEP+FG  F+AGG
Sbjct  193  VEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFVAGG  247



>gb|KDO52916.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=268

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGG  247



>gb|KDO52917.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=264

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGG  247



>ref|XP_006465395.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Citrus sinensis]
Length=268

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++    GS+RTVAWLH DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHGDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGG  247



>ref|XP_007013329.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30948.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=349

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            PDAPPR++D  PGSVRTVAW+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSA
Sbjct  134  PDAPPREVDKSPGSVRTVAWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSA  193

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            EVS DG YITTADGS+VKFWDAN F LVKS++MPC VESASLEP++G  F+AGG
Sbjct  194  EVSLDGRYITTADGSTVKFWDANHFGLVKSHNMPCTVESASLEPKYGNKFVAGG  247



>ref|XP_002284993.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Vitis vinifera]
 emb|CBI28146.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+T SSVTS
Sbjct  133  RPDAPPREVDNSPGSVRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETNSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI TADGSSVKFWDAN F LVKSY MPC VESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYIITADGSSVKFWDANHFGLVKSYKMPCTVESASLEPKNGDKFIAGG  247



>ref|XP_010537963.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Tarenaya hassleriana]
Length=302

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+ID  PGS+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTS
Sbjct  133  RPDAPPREIDKSPGSIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGS+VKFWDAN F LVKSY+MPC+VESASLEP+ G+ FIAGG
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYEMPCSVESASLEPKKGETFIAGG  247



>gb|KHG21144.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=350

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA PRQ+D  PGS+RTVAWLH+DQ ILSSC++T+GVRLWDLRS ++V+TL+TKS VTS
Sbjct  133  RLDAQPRQVDNSPGSIRTVAWLHSDQMILSSCTETNGVRLWDLRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G  FIAGG
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGG  247



>ref|XP_006854996.1| hypothetical protein AMTR_s00052p00205770 [Amborella trichopoda]
 gb|ERN16463.1| hypothetical protein AMTR_s00052p00205770 [Amborella trichopoda]
Length=351

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             P+APPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++VRTLDTKS VTS
Sbjct  133  HPEAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSAKIVRTLDTKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADG +VKFWDAN F LVKSY MPC VESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGCTVKFWDANHFGLVKSYTMPCTVESASLEPKLGNKFVAGG  247



>gb|EYU21599.1| hypothetical protein MIMGU_mgv1a009096mg [Erythranthe guttata]
Length=353

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPPR+++  PGSVRT+AWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RSDAPPRELEKSPGSVRTIAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCVVESASLEPKYGNKFIAGG  247



>ref|XP_002438635.1| hypothetical protein SORBIDRAFT_10g023300 [Sorghum bicolor]
 gb|EER90002.1| hypothetical protein SORBIDRAFT_10g023300 [Sorghum bicolor]
Length=340

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  247



>gb|AGT15994.1| hypothetical protein SHCRBa_159_J23_F_580 [Saccharum hybrid cultivar 
R570]
Length=340

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  247



>emb|CDO98105.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDAPPR++   PGSVRT+AWLH+DQ+ILSSC+D  GVRLWD+RS ++VRTL+TKS+VTS
Sbjct  133  QPDAPPREVHDSPGSVRTLAWLHSDQSILSSCTDIGGVRLWDVRSGKIVRTLETKSAVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS DG YITT DGS+VKFWDAN F LV+SYDMPCN+ESASLEPRFG  F+AGG
Sbjct  193  TEVSHDGRYITTVDGSTVKFWDANHFGLVRSYDMPCNMESASLEPRFGNKFVAGG  247



>ref|XP_011072259.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Sesamum indicum]
Length=349

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+I+  PGSVRTVAWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RPDAPPREIEKSPGSVRTVAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+V FWDAN F LVKSYDMPC VESASLEP++G  FIA G
Sbjct  193  AEVSQDGRYITTADGSTVTFWDANHFGLVKSYDMPCIVESASLEPKYGNKFIASG  247



>ref|NP_001142332.1| LOC100274502 [Zea mays]
 gb|ACF88209.1| unknown [Zea mays]
 gb|AFW87111.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=340

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  247



>ref|XP_010545787.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
Length=341

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPPR++D  PGS+RTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+T+SSVTS
Sbjct  133  RLDAPPREVDKSPGSIRTVTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETESSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKFGNKFVAGG  247



>ref|XP_007023961.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY26583.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=351

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGS+RTVAWLH+DQTILSSC+DTSGVRLWDLRS ++V+TL+TKS VTS
Sbjct  133  RPDALPREVGNSPGSIRTVAWLHSDQTILSSCTDTSGVRLWDLRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY MPCNVESASLEP+ G   IAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYYMPCNVESASLEPKHGNKLIAGG  247



>ref|XP_004965966.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Setaria italica]
Length=339

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  134  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  194  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  248



>ref|XP_006427174.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
 gb|ESR40414.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
Length=268

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDASPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVKSY+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKSYNMPCNTESASLEPKLGNIFIAGG  247



>gb|KDO52915.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=350

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGG  247



>ref|XP_006465394.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Citrus sinensis]
Length=350

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++    GS+RTVAWLH DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHGDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGG  247



>ref|NP_001288531.1| uncharacterized protein LOC103629787 [Zea mays]
 gb|ACN35648.1| unknown [Zea mays]
 gb|AFW76434.1| hypothetical protein ZEAMMB73_231124 [Zea mays]
Length=341

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+S+TS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASITS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  247



>ref|XP_007013330.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY30949.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=303

 Score =   184 bits (468),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DAPPR++D  PGSVRTVAW+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAE
Sbjct  89   DAPPREVDKSPGSVRTVAWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAE  148

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            VS DG YITTADGS+VKFWDAN F LVKS++MPC VESASLEP++G  F+AGG
Sbjct  149  VSLDGRYITTADGSTVKFWDANHFGLVKSHNMPCTVESASLEPKYGNKFVAGG  201



>gb|KDP37150.1| hypothetical protein JCGZ_06206 [Jatropha curcas]
Length=350

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DAPPR++   PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAE
Sbjct  135  DAPPREVGSSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDIRSGKIVQTLETKSPVTSAE  194

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            VS+DG YITTADGS+VKFWDAN F LVKSY+MPCN ESASLEP+FG  F+AGG
Sbjct  195  VSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNTESASLEPKFGNKFVAGG  247



>ref|XP_002885098.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61357.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP +ID  PGS+RT+AWLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTLAWLHGDQTILSSCTDIGGVRLWDMRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  247



>ref|NP_001046249.1| Os02g0205400 [Oryza sativa Japonica Group]
 dbj|BAD16018.1| putative serine-threonine kinase receptor-associated protein 
[Oryza sativa Japonica Group]
 dbj|BAD38438.1| putative serine-threonine kinase receptor-associated protein 
[Oryza sativa Japonica Group]
 dbj|BAF08163.1| Os02g0205400 [Oryza sativa Japonica Group]
 gb|EEC72710.1| hypothetical protein OsI_06306 [Oryza sativa Indica Group]
 gb|EEE56531.1| hypothetical protein OsJ_05825 [Oryza sativa Japonica Group]
Length=342

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR+ID  PGSVRTVAWLH+DQ+ILS C+D  GVRLWD+RS ++ +TL+TK++VTS
Sbjct  133  RPDAAPREIDKSPGSVRTVAWLHSDQSILSCCTDMGGVRLWDVRSGKIAQTLETKATVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI TADGSSVKFWDAN F LVKSY+MPCNVESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMPCNVESASLEPKYGNKFIAGG  247



>ref|XP_006427175.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
 gb|ESR40415.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
Length=350

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDASPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F LVKSY+MPCN ESASLEP+ G  FIAGG
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKSYNMPCNTESASLEPKLGNIFIAGG  247



>gb|ACG31749.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=340

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ + V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKNVQTLETKASVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  247



>ref|XP_010914940.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Elaeis guineensis]
Length=344

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             PDA PR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  HPDASPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKIGNRFIAGG  247



>ref|XP_006305313.1| hypothetical protein CARUB_v10009691mg [Capsella rubella]
 gb|EOA38211.1| hypothetical protein CARUB_v10009691mg [Capsella rubella]
Length=332

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP++I   PGS+RTV WLH+D+TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEIGNSPGSIRTVEWLHSDKTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANSFGLLKSYDMPCNVESASLEPKLGNSFIAGG  242



>ref|XP_010465533.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=341

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP +ID  PGS+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTVTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  247



>ref|XP_010487393.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=342

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP +ID  PGS+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTVTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  247



>ref|XP_006341669.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Solanum tuberosum]
Length=356

 Score =   184 bits (466),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+ID  PGSVRTVAWLH+DQTILSS  D  G+RLWD+RS +VV+ L+TK  VTS
Sbjct  133  RPDAPPREIDSSPGSVRTVAWLHSDQTILSSSGDAGGLRLWDVRSGKVVQILETKFPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKS+D+PC VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSHDLPCKVESASLEPKFGNRFIAGG  247



>emb|CDP03398.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+R+ +VV TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRTGKVVETLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+A G
Sbjct  193  AEVSQDGRYITTADGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGFKFVAAG  247



>gb|AFW87112.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=484

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGG  247



>ref|XP_003563679.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brachypodium distachyon]
Length=340

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSC+D  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGSVRTVAWLHSDQSILSSCTDMGGVRLWDVRSGKIVQTLETKAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G  FI GG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFITGG  247



>emb|CDY61819.1| BnaC06g41840D [Brassica napus]
Length=330

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ WLH+DQTIL+SC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILTSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSYDMPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGG  247



>gb|EYU24671.1| hypothetical protein MIMGU_mgv1a010043mg [Erythranthe guttata]
Length=324

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPD  P +I+  PGSVRT+ WLH DQTIL SC+D SGVRLWD+R+ ++VRTL+TKSSVTS
Sbjct  133  RPDVGPTEIEKSPGSVRTLTWLHTDQTILGSCTDMSGVRLWDVRTGKIVRTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCIVESASLEPKFGNKFIAGG  247



>ref|XP_002891712.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67971.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGG  247



>ref|NP_849800.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 ref|NP_175682.2| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AAD55591.1|AC008016_1 Similar to gb|AJ010025 unr-interacting protein from Homo sapiens 
and contains 3 PF|00400 WD40 domains. EST gb|T45021 comes 
from this gene [Arabidopsis thaliana]
 gb|AAP37674.1| At1g52730 [Arabidopsis thaliana]
 dbj|BAE99937.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20036.1| AT1G52730 [Arabidopsis thaliana]
 gb|AEE32845.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AEE32846.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=343

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGG  247



>ref|XP_006392876.1| hypothetical protein EUTSA_v10011626mg [Eutrema salsugineum]
 gb|ESQ30162.1| hypothetical protein EUTSA_v10011626mg [Eutrema salsugineum]
Length=343

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGG  247



>ref|XP_010500889.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
 ref|XP_010462123.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
 ref|XP_010479792.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=343

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGG  247



>ref|XP_009602512.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   183 bits (464),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPPR+ID  PGSVRTVAWLH+DQT+LSS  D  G+RLWD+RS +VV+TL+TK  VTS
Sbjct  133  RLDAPPREIDSSPGSVRTVAWLHSDQTLLSSSGDAGGLRLWDVRSGKVVQTLETKFPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSYD+PC VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDLPCKVESASLEPKFGNRFIAGG  247



>ref|NP_566519.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB02292.1| WD-40 repeat protein-like [Arabidopsis thaliana]
 gb|AAN72058.1| expressed protein [Arabidopsis thaliana]
 gb|AAO30083.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE75702.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=341

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP +ID  PGS+RT+ WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTLTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  247



>ref|NP_563978.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AAD39675.1|AC007591_40 Strong similarity to gb|AF096285 serine-threonine kinase receptor-associated 
protein from Mus musculus and contains 5 PF|00400 
WD40, G-beta repeat domains. EST gb|F14050 comes from 
this gene [Arabidopsis thaliana]
 gb|AAM61168.1| Similar to unr-interacting protein and contains WD40 domains 
[Arabidopsis thaliana]
 gb|AAN41335.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29327.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=333

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V TL+TKS VTS
Sbjct  128  RPDAPPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVHTLETKSPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDA  F L+KSYDMPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDAKNFGLLKSYDMPCNVESASLEPKHGNTFIAGG  242



>ref|XP_002890105.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66364.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V TL+TKS VTS
Sbjct  128  RPDAPPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVHTLETKSPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDA  F L+KSYDMPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDAKNFGLLKSYDMPCNVESASLEPKHGNTFIAGG  242



>ref|XP_009147669.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Brassica rapa]
 emb|CDY62196.1| BnaA06g01530D [Brassica napus]
Length=337

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGSVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSVRTLTWLHSDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGG  247



>ref|XP_006305259.1| hypothetical protein CARUB_v10009632mg [Capsella rubella]
 gb|EOA38157.1| hypothetical protein CARUB_v10009632mg [Capsella rubella]
Length=343

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F L+KSYDMPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLLKSYDMPCNIESASLEPKSGEKFVAGG  247



>emb|CDX89958.1| BnaA10g01240D [Brassica napus]
Length=341

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGSVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSVRTLTWLHSDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGG  247



>emb|CDY39650.1| BnaC05g11790D [Brassica napus]
Length=335

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPD PP+++ G PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDVPPKEVGGSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F L+KSY+MPCN+ESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYEMPCNIESASLEPKHGNTFIAGG  242



>gb|EPS74468.1| hypothetical protein M569_00279, partial [Genlisea aurea]
Length=306

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA PR+I+  PGSVR + WLH+DQTIL SC+DT GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RLDATPREIEKSPGSVRALTWLHSDQTILGSCTDTGGVRLWDVRTGSIVRTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCIVESASLEPKYGNKFVAGG  247



>gb|EMS49047.1| Serine-threonine kinase receptor-associated protein [Triticum 
urartu]
Length=320

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  111  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  170

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G  FI GG
Sbjct  171  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGG  225



>ref|XP_010497185.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP++I   PG +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEIGNSPGLIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYDMPCNVESASLEPKHGNTFIAGG  242



>ref|XP_009148941.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Brassica rapa]
 emb|CDY36565.1| BnaA06g10180D [Brassica napus]
Length=335

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F L+KSY+MPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYEMPCNVESASLEPKHGNTFIAGG  242



>ref|XP_009144818.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brassica rapa]
Length=330

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA P ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAAPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGEKFVAGG  247



>ref|XP_010476637.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP++I   PG +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEIGNSPGLIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYDMPCNVESASLEPKHGNTFIAGG  242



>emb|CDY40132.1| BnaC06g05570D [Brassica napus]
Length=341

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGSVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++++TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSVRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIMQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGG  247



>ref|XP_004235719.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Solanum lycopersicum]
Length=356

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+ID  PGSVRTVAWLH+DQTILSS  D  G+RLWD+R+ +VV+ L+TK  VTS
Sbjct  133  RPDAPPREIDSSPGSVRTVAWLHSDQTILSSSGDAGGLRLWDVRTGKVVQILETKFPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKS+++PC VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSHELPCKVESASLEPKFGNRFIAGG  247



>ref|XP_009388533.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            PDAPPR+ID  PGS+RTVAWLH+DQTILSSC+D  GVRLWD++S ++V+TL+TKS VTSA
Sbjct  134  PDAPPREIDKSPGSIRTVAWLHSDQTILSSCTDMGGVRLWDVKSGKIVQTLETKSPVTSA  193

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            EVS+DG YITTADGS+VKFWDAN F L+KSY+M C VESASLEP+ G  F+AGG
Sbjct  194  EVSQDGRYITTADGSTVKFWDANHFGLIKSYNMSCTVESASLEPKDGNKFVAGG  247



>dbj|BAJ97958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92033.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G  FI GG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGG  247



>ref|XP_006298067.1| hypothetical protein CARUB_v10014111mg [Capsella rubella]
 gb|EOA30965.1| hypothetical protein CARUB_v10014111mg [Capsella rubella]
Length=341

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA P +ID  PGS+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDASPTEIDKSPGSIRTVTWLHGDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  247



>ref|XP_009770768.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Nicotiana sylvestris]
Length=299

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  88   RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  147

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  148  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  202



>ref|XP_006656206.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oryza brachyantha]
Length=343

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G  FI GG
Sbjct  193  AEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGG  247



>ref|NP_001057997.1| Os06g0598900 [Oryza sativa Japonica Group]
 dbj|BAF19911.1| Os06g0598900 [Oryza sativa Japonica Group]
Length=342

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G  FI GG
Sbjct  193  AEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGG  247



>gb|EEC80916.1| hypothetical protein OsI_23591 [Oryza sativa Indica Group]
Length=302

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  90   RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  149

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +EVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G  FI GG
Sbjct  150  SEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGG  204



>dbj|BAD32940.1| putative WD-40 repeat protein [Oryza sativa Japonica Group]
 gb|EAZ37546.1| hypothetical protein OsJ_21874 [Oryza sativa Japonica Group]
Length=345

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G  FI GG
Sbjct  193  AEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGG  247



>ref|XP_010503217.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=341

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP +ID  PGS+RTV WLH DQTILS C+D  GVRLWD+RS ++V+TL+TKS  TS
Sbjct  133  RLDAPPTEIDKSPGSIRTVTWLHGDQTILSFCTDIGGVRLWDVRSGKIVQTLETKSPATS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  247



>ref|XP_006406945.1| hypothetical protein EUTSA_v10021071mg [Eutrema salsugineum]
 gb|ESQ48398.1| hypothetical protein EUTSA_v10021071mg [Eutrema salsugineum]
Length=342

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP +ID  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASL+P+ G  F+AGG
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLDPKSGNKFVAGG  247



>gb|EMT15935.1| hypothetical protein F775_06783 [Aegilops tauschii]
Length=367

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  156  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  215

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G  FI GG
Sbjct  216  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGG  270



>ref|XP_009770767.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Nicotiana sylvestris]
Length=301

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  90   RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  149

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  150  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  204



>ref|XP_006647058.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oryza brachyantha]
Length=344

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR+ID  PGSVRTVAWLH+DQ+ILS C+D  GVRLWD+RS ++V+TL+T + VTS
Sbjct  133  RPDAAPREIDKSPGSVRTVAWLHSDQSILSCCTDMGGVRLWDVRSGKIVQTLETNAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI TADGSSVKFWDAN F LVKSY+M CNVESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMSCNVESASLEPKYGNKFIAGG  247



>gb|KEH23437.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=762

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA P+++D  PGSVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  546  RPDATPKEVDKSPGSVRSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTS  605

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFW AN + LVKSYDMPCNVESASLEP+FG  F+AGG
Sbjct  606  AEVSQDGCYITTADGSTVKFWYANHYGLVKSYDMPCNVESASLEPKFGNKFVAGG  660



>ref|XP_009760123.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nicotiana sylvestris]
Length=355

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPPR+ID  PGSVRTVAWLH+DQT+LSS  D  G+RLWD+RS +VV+TL+TK  VTS
Sbjct  133  RIDAPPREIDSSPGSVRTVAWLHSDQTLLSSSGDAGGLRLWDVRSGKVVQTLETKFPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSYD+ C VESASLEP+FG  FIAGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDLSCKVESASLEPKFGNRFIAGG  247



>gb|KJB64820.1| hypothetical protein B456_010G066700 [Gossypium raimondii]
Length=346

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             P+AP R++D  PGSVRTV+W+H+DQT+LSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  HPEAPLREVDKSPGSVRTVSWMHSDQTLLSSCTDMGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADG++VKFWDA+ F LVKSY+MPC VESASLEP++G  FIAGG
Sbjct  193  AEVSQDGRYITTADGATVKFWDADHFGLVKSYNMPCTVESASLEPKYGNKFIAGG  247



>emb|CDY55992.1| BnaA09g56870D [Brassica napus]
Length=336

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+R+ ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEVGTPPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRNDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGG  242



>ref|XP_009596072.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X3 [Nicotiana tomentosiformis]
Length=363

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  122  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  181

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  182  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  236



>dbj|BAJ92707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G  F  GG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFFTGG  247



>ref|XP_009596073.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X4 [Nicotiana tomentosiformis]
Length=341

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  134  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  194  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  248



>gb|KFK38907.1| hypothetical protein AALP_AA3G176400 [Arabis alpina]
Length=349

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP + D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++ +TL+TKS VTS
Sbjct  134  RLDAPPTEFDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIEQTLETKSPVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G  F+AGG
Sbjct  194  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGG  248



>ref|XP_002451748.1| hypothetical protein SORBIDRAFT_04g007180 [Sorghum bicolor]
 gb|EES04724.1| hypothetical protein SORBIDRAFT_04g007180 [Sorghum bicolor]
Length=341

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR+ID  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDATPREIDKSPGSVRTVTWLHSDQTILSSCADLGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITT DGSSVKFWDAN F LVKSY+MPC VESASLEP  G  F+ GG
Sbjct  193  AEVSQDGRFITTTDGSSVKFWDANHFGLVKSYNMPCAVESASLEPNCGNKFVTGG  247



>ref|XP_009596074.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X5 [Nicotiana tomentosiformis]
Length=340

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  133  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  247



>ref|XP_006416902.1| hypothetical protein EUTSA_v10008159mg [Eutrema salsugineum]
 gb|ESQ35255.1| hypothetical protein EUTSA_v10008159mg [Eutrema salsugineum]
Length=332

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA P+++   PGS+RTV WLH+D TILSSC+DT  VRLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAAPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDVRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS DG YITTADGSSVKFWDAN F L+KSY+MPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSHDGRYITTADGSSVKFWDANNFGLLKSYEMPCNVESASLEPKHGNTFIAGG  242



>emb|CDY62165.1| BnaA05g35670D [Brassica napus]
Length=330

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DA   ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAAATEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGEKFVAGG  247



>emb|CDX81717.1| BnaC08g38840D [Brassica napus]
Length=336

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+T   VTS
Sbjct  128  RPDAPPKEVGTPPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETTFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGG  242



>ref|XP_009596070.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=375

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  134  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  193

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  194  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  248



>ref|XP_009117826.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brassica rapa]
Length=336

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+R+ ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEVGTPPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRNDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI+TADGSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGG
Sbjct  188  AEVSQDGRYISTADGSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGG  242



>gb|KJB27111.1| hypothetical protein B456_004G278600 [Gossypium raimondii]
Length=303

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++D  PGSVRTV+W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+T+SSVTS
Sbjct  133  RPDAVPREVDKSPGSVRTVSWMHSDQTILSSCTDMGGVRLWDVRSGKIVKTLETESSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI TADGS+VK WDAN F LV+ Y+MPC VESASLEP +G  FIAGG
Sbjct  193  AEVSQDGRYIMTADGSTVKIWDANHFGLVRRYNMPCTVESASLEPIYGNKFIAGG  247



>ref|XP_009596071.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Nicotiana tomentosiformis]
Length=374

 Score =   178 bits (452),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  133  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  247



>ref|XP_004951509.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Setaria italica]
Length=341

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR+I+  P SVRTV WLH+DQTILS+CSD  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAAPREIEKSPSSVRTVTWLHSDQTILSTCSDMGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITT DGSSVKFWDAN + LVKSY+MPC VESASLEP++G  F+ GG
Sbjct  193  AEVSQDGRFITTTDGSSVKFWDANHYGLVKSYNMPCAVESASLEPKYGNKFVTGG  247



>dbj|BAE46565.1| putative WD-40 repeat protein [Nicotiana glutinosa]
Length=336

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  133  RPDAAPREVAMTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G  F+AGG
Sbjct  193  AEVSQDGCYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGG  247



>ref|XP_010542265.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
 ref|XP_010542266.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
Length=343

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RTV WLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  RLDAPPGEVDKSPGSIRTVTWLHSDQTILSSCTDIGGVRLWDVRSGRIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGS+VKFWDAN F LVKSY+MPC VESASLE + G  F+AGG
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLETKSGNKFVAGG  247



>gb|EMT09457.1| hypothetical protein F775_27621 [Aegilops tauschii]
Length=340

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PD  P+++D  PGSVRTVAWLHNDQTILSSC+DT GVRLWD+RS ++V+TL+TK  VTS
Sbjct  133  KPDVAPKELDKSPGSVRTVAWLHNDQTILSSCTDTGGVRLWDVRSEKIVQTLETKGPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM   VESASLEP+ G  FIAGG
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSFIVESASLEPKSGSKFIAGG  247



>gb|KHG29669.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=303

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             PDA PR++D  PGSVRTV+W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  HPDALPREVDKSPGSVRTVSWMHSDQTILSSCTDMGGVRLWDVRSGDIVKTLETKSSVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGS+V  WDAN F LV+ Y+MPC VESASLEP +G  FIAGG
Sbjct  193  AEVSQDGRYITTADGSTVNIWDANHFGLVRRYNMPCTVESASLEPIYGNKFIAGG  247



>ref|XP_010459083.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP++I   PG +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RLDAPPKEIGNSPGLIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVSRDG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+    FIAGG
Sbjct  188  AEVSRDGRYITTADGSSVKFWDANNFGLLKSYDMPCNVESASLEPKHENTFIAGG  242



>gb|KFK35774.1| hypothetical protein AALP_AA4G034300 [Arabis alpina]
Length=345

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            R DAPP ++D  PGS+RT+ +LH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTYLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YI TADGS+VKFWDAN F LVKS+DMPC +ESASLEP+ G+ F+AGG
Sbjct  193  AEVSQDGRYIITADGSTVKFWDANHFGLVKSFDMPCTIESASLEPKSGEKFVAGG  247



>ref|XP_008785435.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Phoenix dactylifera]
Length=322

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 84/115 (73%), Gaps = 21/115 (18%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GV                     S
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGV---------------------S  171

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+FG  FIAGG
Sbjct  172  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGG  226



>ref|XP_001756882.1| predicted protein [Physcomitrella patens]
 gb|EDQ78113.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGS-VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  169
            RPDAPP  ++  P + +R   W H+DQTILSS +D  GVR+WD+R+  VVRTLDTKSS T
Sbjct  133  RPDAPPTLLESKPETPIRAAVWHHSDQTILSSSNDIGGVRVWDVRTKSVVRTLDTKSSCT  192

Query  168  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            S EVSRDG YITTADG++VKFWDAN F LVKSY MP  VESASL P  GK FIAGG
Sbjct  193  SVEVSRDGRYITTADGNTVKFWDANHFGLVKSYSMPRPVESASLFPSRGK-FIAGG  247



>ref|XP_002977277.1| hypothetical protein SELMODRAFT_151778 [Selaginella moellendorffii]
 gb|EFJ21886.1| hypothetical protein SELMODRAFT_151778 [Selaginella moellendorffii]
Length=342

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA P +++G   ++R+  W H+DQTILSSC+DT  VRLWD+R+   VR L+TKS  TS
Sbjct  133  RPDAAPTEMEGLTSTIRSAVWHHSDQTILSSCNDTGSVRLWDVRTKTTVRQLETKSPCTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVSRDG YITTADG+SVKFWDAN F +VKS+ M   +ESASL P  GK F+AGG
Sbjct  193  VEVSRDGRYITTADGNSVKFWDANHFGMVKSFTMARPMESASLYPALGK-FVAGG  246



>ref|XP_002992164.1| hypothetical protein SELMODRAFT_186588 [Selaginella moellendorffii]
 gb|EFJ06819.1| hypothetical protein SELMODRAFT_186588 [Selaginella moellendorffii]
Length=342

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA P +++G   ++R+  W H+DQTILSSC+DT  VRLWD+R+   VR L+TKS  TS
Sbjct  133  RPDAAPTEMEGLTSTIRSAVWHHSDQTILSSCNDTGSVRLWDVRTKTTVRQLETKSPCTS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVSRDG YITTADG+SVKFWDAN F +VKS+ M   +ESASL P  GK F+AGG
Sbjct  193  VEVSRDGRYITTADGNSVKFWDANHFGMVKSFTMARPMESASLYPALGK-FVAGG  246



>ref|XP_001777192.1| predicted protein [Physcomitrella patens]
 gb|EDQ57972.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGS-VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  169
            RPDAPP  ++  P + +R   W H+DQTILSS +D  G+R+WD+R+  VVRTLDTKSS T
Sbjct  133  RPDAPPTLLECSPETPIRAAVWHHSDQTILSSSNDIGGLRVWDVRTKSVVRTLDTKSSCT  192

Query  168  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            S EVSRDG YITTA G++V FWDAN F LVKSY MP  VESASL P  GK FIAGG
Sbjct  193  SVEVSRDGRYITTAHGNTVNFWDANHFGLVKSYTMPRPVESASLFPSKGK-FIAGG  247



>gb|AFK43194.1| unknown [Medicago truncatula]
Length=185

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -3

Query  237  GVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPC  58
            GVRLWD+R+ ++V+TLDTKS +TSAEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC
Sbjct  3    GVRLWDVRTGKIVQTLDTKSPMTSAEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPC  62

Query  57   NVESASLEPRFGKXFIAGG  1
            NVESASLEP+FG  F+AGG
Sbjct  63   NVESASLEPKFGNKFVAGG  81



>ref|XP_007023909.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY26531.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=157

 Score =   121 bits (304),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  LWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVE  49
            LWDLRS ++V+TL+TKS VTSAEVS+DG +ITTADGS+VKFWDAN F LVKSY MPC+VE
Sbjct  2    LWDLRSGKIVQTLETKSPVTSAEVSQDGRHITTADGSNVKFWDANHFALVKSYYMPCSVE  61

Query  48   SASLEPRFGKXFIAGG  1
            SASLEP+ G  FIAGG
Sbjct  62   SASLEPKHGNKFIAGG  77



>emb|CAN67314.1| hypothetical protein VITISV_014120 [Vitis vinifera]
Length=426

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -3

Query  237  GVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPC  58
            GV LWD+RS ++V+TL+T SSVTSAEVS+DG YI TADGSSVKFWDAN F LVKSY MPC
Sbjct  247  GVGLWDVRSGKIVQTLETNSSVTSAEVSQDGRYIITADGSSVKFWDANHFGLVKSYKMPC  306

Query  57   NVESASLEPRFGKXFIAGG  1
             VESASLEP+ G  FIAGG
Sbjct  307  TVESASLEPKNGDKFIAGG  325



>gb|ABR25578.1| serine-threonine kinase receptor-associated protein [Oryza sativa 
Indica Group]
Length=167

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  RSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASL  37
            RS ++ +TL+TK++VTSAEVS+DG YI TADGSSVKFWDAN F LVKSY+MPCNVESASL
Sbjct  1    RSGKIAQTLETKATVTSAEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMPCNVESASL  60

Query  36   EPRFGKXFIAGG  1
            EP++G  FIAGG
Sbjct  61   EPKYGNKFIAGG  72



>emb|CEF99303.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=299

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P  + G   S++T +++HND+ ILSSC++  G+R+WD+R+  VV TL T+S V S
Sbjct  129  KPEADPYAMAGHASSIKTASFIHNDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS DG ++TTADG  V FWD   F  ++ + M   VESAS+  +  K F+AGG
Sbjct  189  IEVSADGKHMTTADGKDVTFWDLQNFSKIQKWTMEYEVESASVSLKHRK-FVAGG  242



>ref|XP_003055628.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=302

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DAPP ++ G P  +RT  +   D  I+SSC+D  G+R+WD+R+  VV TL T + VTS E
Sbjct  130  DAPPYEMQGSPSQIRTAQFTAEDTLIVSSCADDPGIRVWDVRTNTVVTTLGTDTPVTSIE  189

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            ++ +G YITTADG +V F+DA  F  VK + MP  VESAS+  +  + F+AGG
Sbjct  190  ITENGRYITTADGKNVTFFDAMTFTPVKKWTMPYEVESASVCVKH-ERFVAGG  241



>ref|XP_003081517.1| WD40 repeat protein (ISS) [Ostreococcus tauri]
Length=627

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P  + G   S++T +++HND+ ILSSC++  G+R+WD+R+  VV TL T+S V S
Sbjct  457  KPEADPYAMAGHASSIKTASFIHNDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMS  516

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS DG ++TTADG  V FWD   F  ++ + M   VESAS+  +  K F+AGG
Sbjct  517  IEVSADGKHMTTADGKDVTFWDLQNFSKIQKWTMEYEVESASVSLKHRK-FVAGG  570



>ref|XP_001419915.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98208.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=299

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P  + G    ++T +++ ND+ ILSSC++  G+R+WD+R+  VV TL T+S V S
Sbjct  129  KPEAEPYAMAGSASQIKTASFIANDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS DG  +TTADG  V FWD   F  V+ + M   VESAS+  +  K F+AGG
Sbjct  189  IEVSADGKNMTTADGKDVTFWDLQNFSKVQKWTMEYEVESASVSLKH-KKFVAGG  242



>gb|KIZ04267.1| serine-threonine kinase receptor-associated protein [Monoraphidium 
neglectum]
Length=294

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA P+Q+ G    +R V W+H D  +L++  DT G+ +WD+RS  +V+TL T++ VTS
Sbjct  135  RPDAAPQQLSGAAKGIRNVVWVHGDSLVLTTQQDTPGLDVWDVRSGSIVQTLATEAPVTS  194

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E++ DG ++TT DG++++FWD    R  K +     VE+AS  P  G+    GG
Sbjct  195  VELTFDGRFLTTTDGATIRFWDVGALREAKQHKAAYPVEAASYCPAKGRFACGGG  249



>ref|XP_007510202.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18547.1| predicted protein [Bathycoccus prasinos]
Length=323

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = -3

Query  333  PPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVS  154
            P  ++ G P  ++T  ++ ND+ ILSSCSD   +R+WD R+  +  TL T+++VTS E+S
Sbjct  156  PMSELTGAPSQIKTARYICNDELILSSCSDNPDLRVWDARTGIIATTLKTENAVTSIEIS  215

Query  153  RDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             DG YITTADG +V  WD   FR ++++ M  N+ESAS+  + GK F+ GG
Sbjct  216  EDGKYITTADGKNVTLWDVGSFRPMETWKMKYNMESASVCMKEGK-FVCGG  265



>ref|XP_005650326.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25782.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            + D+ P  +   P  +R  AW  ND  +L+S +D  G+ +WD+R+  +V+TL T   VTS
Sbjct  132  KMDSEPATVRDVPDKIRCAAWHQNDALLLTSYTDQPGIGVWDIRTAGLVKTLATGKEVTS  191

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S+DG YIT+ADG+ V+FWD  +   +K +  P +VESAS  P  G+ F+AGG
Sbjct  192  IEISQDGRYITSADGTEVRFWDGERLEPIKVFSQPYSVESASFCPEKGR-FVAGG  245



>ref|XP_010537967.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X3 [Tarenaya hassleriana]
Length=207

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR+ID  PGS+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTS
Sbjct  133  RPDAPPREIDKSPGSIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTS  192

Query  165  AE  160
            AE
Sbjct  193  AE  194



>ref|XP_002503507.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64765.1| predicted protein [Micromonas sp. RCC299]
Length=300

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DA P  + G P  +RT  +   D  I+SSC+D  G+R+WD+R+  +V TL T S VTS E
Sbjct  133  DAEPYVMQGSPSQIRTAQFTAEDTLIMSSCADDKGIRVWDVRTNTIVTTLGTDSPVTSIE  192

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            ++ DG YITTADG +V F+DA  F  V    M   VESAS+  +    F+AGG
Sbjct  193  ITDDGRYITTADGKTVTFFDAMTFTPVWKRTMGYEVESASVCIK-NDVFVAGG  244



>ref|XP_006385489.1| hypothetical protein POPTR_0003s05820g [Populus trichocarpa]
 gb|ERP63286.1| hypothetical protein POPTR_0003s05820g [Populus trichocarpa]
Length=298

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 56/115 (49%), Gaps = 52/115 (45%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GV                      
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGV----------------------  170

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
                                          SYDMPCNVESASLEP+ G  F+AGG
Sbjct  171  ------------------------------SYDMPCNVESASLEPKLGNKFVAGG  195



>ref|XP_637742.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q54LT8.1|STRAP_DICDI RecName: Full=Serine-threonine kinase receptor-associated protein; 
AltName: Full=WD40 repeat-containing protein strap [Dictyostelium 
discoideum]
 gb|EAL64253.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=293

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  169
            RP+ P  QI G   +++T  W +HND  +LS   D   +R+WDLRS   V +L  KSS+T
Sbjct  128  RPNDPLLQISGHTNTIKTATWSVHNDDIVLSGGLDEV-IRIWDLRSGTQV-SLCAKSSIT  185

Query  168  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            S E S+D  ++ T  G+ V FWDA  F  +K Y +P +V  ASL P   K FIAGG
Sbjct  186  SMEFSKDRRFLVTTAGNEVTFWDAQSFYPLKVYSLPFDVNCASLHPDNSK-FIAGG  240



>emb|CAF96754.1| unnamed protein product [Tetraodon nigroviridis]
Length=338

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DA P++I G   +++   W +ND+ ILS+  D + +RLWD RS E V+TL   +SV+S E
Sbjct  142  DAAPQEIAGHTSAIKKALWCNNDKQILSAAEDKT-IRLWDGRSMEEVKTLSFNTSVSSME  200

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
               DG  +    G ++ F+DA    L+KS D P  + SASL P     F+AGG
Sbjct  201  YMADGEILVITYGKTIAFYDALSLDLIKSVDAPAPINSASLHPE-KDFFVAGG  252



>gb|ACO09706.1| Serine-threonine kinase receptor-associated protein [Osmerus 
mordax]
Length=344

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G   +++   W +ND+ ILS+  D + VRLWD  S E VRTL    SV+S
Sbjct  145  KPEAEPQEIPGHTSAIKKALWCNNDKQILSAADDKT-VRLWDRNSTEAVRTLSFDMSVSS  203

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+K+ D P ++ SASL P   + F+AGG
Sbjct  204  MEYIPDGEVLVITYGKTIAFYNALSLDLIKTVDAPASIHSASLHPD-KEFFVAGG  257



>ref|NP_956598.1| serine-threonine kinase receptor-associated protein [Danio rerio]
 gb|AAH49525.1| Serine/threonine kinase receptor associated protein [Danio rerio]
 gb|AAH65428.1| Serine/threonine kinase receptor associated protein [Danio rerio]
Length=329

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 69/115 (60%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  + E V+TL   +SV+S
Sbjct  131  KPEAEPQEIAGHTSAIKKALWCNNDQQILSAADDKT-IRLWDKNTNEAVKTLSFDASVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A+   L+K+ D P ++ SASL P     F+AGG
Sbjct  190  MEYIPDGETLVITYGRTIAFYNAHSLDLIKTVDAPASIHSASLHPD-KDFFVAGG  243



>ref|XP_010882092.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Esox lucius]
Length=329

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 70/115 (61%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P++I G  G+++   W +ND+ ILS+  D + VRLWD  S EVV++L  ++SV+S
Sbjct  131  KPDAEPQEIAGHSGAIKKALWCNNDKHILSAADDRT-VRLWDRSSAEVVKSLSFEASVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +   +    G ++ F++A    L+K+ D P ++ SASL P     F+AGG
Sbjct  190  MEYMPEEEILVVTYGKTISFFNALSLDLIKTVDAPASIHSASLHPD-KDFFVAGG  243



>ref|XP_007577214.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Poecilia formosa]
Length=329

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P++I G   +++   W +ND  ILS+  D + VRLWD RS E V+TL   +SV+S
Sbjct  131  KPDAAPQEIAGHSSAIKKSLWCNNDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  190  MEYLADGEILVITYGKTIAFYNALSLDLIKTVEAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_004564824.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Maylandia zebra]
 ref|XP_004564825.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Maylandia zebra]
Length=345

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSM  190

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_004564827.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X4 [Maylandia zebra]
 ref|XP_005730245.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pundamilia nyererei]
 ref|XP_005940646.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Haplochromis burtoni]
 ref|XP_006808414.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Neolamprologus brichardi]
 ref|XP_006808415.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Neolamprologus brichardi]
Length=329

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSM  190

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_004564826.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X3 [Maylandia zebra]
Length=343

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSM  190

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_001691265.1| hypothetical protein CHLREDRAFT_128295 [Chlamydomonas reinhardtii]
 gb|EDP04998.1| predicted protein [Chlamydomonas reinhardtii]
Length=307

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (62%), Gaps = 1/115 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P A P ++      +R+V ++ ND TI+ S  D  G+ ++D+RS + V+T+DT + VTS
Sbjct  131  KPAAEPLKLPPAHSGIRSVNFIQNDNTIICSYVDKPGLGVYDVRSLQHVQTIDTSAPVTS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D  +ITTA+GS V+ ++      VKS+ MP   ESASL     + F+AGG
Sbjct  191  IEISFDQQHITTAEGSHVRVFEVGSLNQVKSHRMPAPAESASL-CWAKRKFVAGG  244



>ref|XP_008399465.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Poecilia reticulata]
Length=329

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P++I G   +++   W +ND  ILS+  D + VRLWD RS E V+TL   +SV+S
Sbjct  131  KPDAAPQEIAGHSSAIKKSLWCNNDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L++  + P ++ SASL P     F+AGG
Sbjct  190  MEYLADGEILVITYGKTIAFYNALSLDLIQMVEAPASINSASLHPE-KDFFVAGG  243



>ref|XP_006633224.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Lepisosteus oculatus]
Length=329

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P++I G   +++   W ++D  ILS+  D + VRLWD  S EVV+TL    SV+S
Sbjct  131  KPDAEPQEITGHTSAIKKALWCNDDTQILSAADDKT-VRLWDRNSMEVVKTLSFDISVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G ++ F++A    L+K+ D P ++ SASL P     F+AGG
Sbjct  190  MEYIPEGEILVITYGKTIAFYNALSLDLIKTVDTPASINSASLHPE-KDFFVAGG  243



>gb|AAK01368.1| serine-threonine kinase receptor-associated protein [Carassius 
gibelio]
Length=329

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G   +++   W +NDQ ILS+  D + VRLWD  + E V+T    +SV+S
Sbjct  131  KPEAEPQEIAGHTSAIKKALWCNNDQQILSAADDKT-VRLWDKNTKEAVKTPSFDASVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F+ A+   L+K+ D P ++ SASL P     F+AGG
Sbjct  190  MEYIPDGEILVITYGRTIAFYKAHSLDLIKTVDAPASIHSASLHPE-KDFFVAGG  243



>ref|XP_010740062.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Larimichthys crocea]
Length=329

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             PDA P++I G   +++   W +ND+ ILS+  D + +RLWD  S + V+TL   +SV+S
Sbjct  131  NPDAAPQEIAGHTSAIKKALWYNNDKQILSAAEDKT-IRLWDRSSMQEVKTLTFDTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+KS + P  + SASL P     F+AGG
Sbjct  190  MEYMTDGDILVITYGKTIAFYNALSLDLIKSVEAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_005454109.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oreochromis niloticus]
Length=350

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S + V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMQEVKTLTFDTSVSSM  190

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            E   DG  +    G ++ F++A    ++K+ + P  + SASL P     F+AGG
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLEMIKTVEAPAPINSASLHPE-KDFFVAGG  243



>emb|CDQ67406.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ64442.1| unnamed protein product [Oncorhynchus mykiss]
Length=331

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G   +++   W +ND  ILS+  D + VRLWD  S EVV+ L    SV+S
Sbjct  131  KPEAEPQEITGHTSAIKKALWCNNDTQILSAADDKT-VRLWDRNSTEVVKQLSFDMSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    ++K+ D P ++ SASL P     F+AGG
Sbjct  190  MEYIPDGEVLVITYGKTIAFYNALSLDMIKTVDAPASIHSASLHPD-KDFFVAGG  243



>ref|XP_008314236.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cynoglossus semilaevis]
Length=329

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  342  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  163
            PD  P++I G   +++   W ++D+ ILS+  D + +RLWD  S EVV+TL   +SV+S 
Sbjct  132  PDTAPQEIAGHTSAIKKALWCNDDKQILSAAEDKT-IRLWDRNSTEVVKTLTFDASVSSM  190

Query  162  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  191  EYMADGEILVITYGKTIAFYNALSLDLIKAVEAPAPISSASLHPE-KDFFVAGG  243



>ref|XP_005849411.1| hypothetical protein CHLNCDRAFT_143924 [Chlorella variabilis]
 gb|EFN57309.1| hypothetical protein CHLNCDRAFT_143924 [Chlorella variabilis]
Length=337

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = -3

Query  345  RPDAPPR-------QIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLD  187
            RPDA P        Q+     ++R   W+ ++Q +L S  D   V +WD+R  EV R+L 
Sbjct  137  RPDAAPTGEWGAEGQLSKAQDNIRVTHWIGDNQLLLVSYLDKPNVDVWDVRMGEVARSLG  196

Query  186  TKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMP-CNVESASLEPRFGKXFI  10
            ++ +VTS EV+  G YI TADG  V F DA  F LVKS+      VESAS  P  G+ F+
Sbjct  197  SQGTVTSIEVTPCGRYIVTADGKQVDFRDAASFDLVKSHACEGYEVESASFAPERGR-FV  255

Query  9    AGG  1
             GG
Sbjct  256  TGG  258



>ref|XP_011498271.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Ceratosolen solmsi marchali]
Length=330

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V++  ND T+L SC++   +R+WD  + + +R LD +S   S
Sbjct  132  KPEAEPQIFSGHTSGLRHVSFYEND-TLLVSCAEDKTMRVWDRHNGKEIRNLDFQSVPRS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG  ITT   + V FWD+ +   ++ + +P  V SASL P     FI GG
Sbjct  191  MEVSKDGSIITTTHSNIVTFWDSKELTKLREFTVPTQVNSASLHPD-NSVFICGG  244



>ref|XP_003402993.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombus terrestris]
Length=330

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P+   G    +R V + +ND T L +C D   +R+WD +S + VR LD  +   S
Sbjct  132  KPDATPQVFSGHKNGIRHVTFFNND-TALITCGDDKTLRVWDRKSGQEVRRLDFPAIPNS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVSRDG+ ITT   + V FW++ +   ++ Y  P  + SASL P     F+ GG
Sbjct  191  MEVSRDGNIITTTHSNIVTFWNSRELTKLREYTAPTQMNSASLHPDC-SIFVCGG  244



>ref|XP_010885258.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Esox lucius]
Length=331

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G   +++   W +ND  ILS+  D + VRLWD  S  VV+ L    SV+S
Sbjct  131  KPEAEPQEITGHTSAIKKALWCNNDTQILSAADDKT-VRLWDRTSTAVVKQLSFDMSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+K+ D P ++ SASL P     F+AGG
Sbjct  190  MEYIPDGEVLVITYGKTIAFYNALSLDLIKTVDAPASIHSASLHPD-KDFFVAGG  243



>ref|XP_003487985.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombus impatiens]
Length=330

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P+   G    +R V + +ND T L +C D   +R+WD +S + VR LD  +   S
Sbjct  132  KPDAAPQVFSGHKSGIRHVTFFNND-TALITCGDDKTLRVWDRKSGQEVRRLDFPAIPNS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVSRDG+ ITT   + V FW++ +   ++ Y  P  + SASL P     F+ GG
Sbjct  191  MEVSRDGNIITTTHSNIVTFWNSRELTKLREYTAPTQMNSASLHPDC-SIFVCGG  244



>ref|XP_001361095.1| GA17804 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002018243.1| GL17603 [Drosophila persimilis]
 gb|EAL25671.1| GA17804 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW36082.1| GL17603 [Drosophila persimilis]
Length=328

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +  G  G+++   +  +D+ I+S+  D + VRLWD  +   V+ L   S   S
Sbjct  134  QPEAKPEEYSGHAGAIKRALFCRDDKCIVSAAEDKT-VRLWDRMTGIEVQRLQFNSHPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+SRD H +T A GSS+ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISRDNHILTIAHGSSISFWEVDTLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>ref|XP_004082930.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Oryzias latipes]
Length=329

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DA P++I G   +++   W ++D+ ILS+  D + +RLWD  S E V+TL   +SV+S E
Sbjct  133  DAAPQEIAGHGAAIKKALWCNDDKQILSAADDKT-IRLWDRTSMEEVKTLTFNTSVSSME  191

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
               DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  192  YMADGEILVITYGKTIAFYNALSLELIKTAEAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_008288513.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Stegastes partitus]
Length=329

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             P+A P++I G   +++   W +ND+ ILS+ +D   +RLW+  S E V+TL   +SV+S
Sbjct  131  NPEAAPQEIAGHTSAIKKALWCNNDKQILSA-ADDKTIRLWNRSSMEEVKTLTFDTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  190  MEYVADGEIVVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPD-KDFFVAGG  243



>ref|XP_008288505.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Stegastes partitus]
Length=357

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             P+A P++I G   +++   W +ND+ ILS+ +D   +RLW+  S E V+TL   +SV+S
Sbjct  131  NPEAAPQEIAGHTSAIKKALWCNNDKQILSA-ADDKTIRLWNRSSMEEVKTLTFDTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  190  MEYVADGEIVVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPD-KDFFVAGG  243



>ref|XP_005179105.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Musca domestica]
Length=289

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P A P    G  G+++   +  ND+ I+S+  D + VRLWD  S   V+ L   ++  S
Sbjct  95   QPQAEPEMYSGHGGAIKQALFCRNDKCIISAAEDKT-VRLWDRLSGNEVQRLTFPNNPNS  153

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T A G+S+ FWD    + +K   +P NV SASL P     F+ GG
Sbjct  154  LEISADNHILTVAHGTSISFWDVESLKKLKEVKVPTNVSSASLHPD-KHVFVCGG  207



>ref|XP_010773038.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Notothenia coriiceps]
Length=329

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             P+A P++I G   +++   W +ND+ ILS+  D + +RLWD  S E V+ L   ++V+S
Sbjct  131  NPEAAPQEIAGHTSAIKKALWCNNDKQILSAADDKT-IRLWDRSSMEEVKQLKFDTAVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   DG  +    G ++ F++A    L+K+ D P  + SASL P     F+AGG
Sbjct  190  MEYLADGEILVITYGKTIGFYNALSLDLIKTVDAPAPINSASLHPD-KDFFVAGG  243



>ref|XP_001959831.1| GF11838 [Drosophila ananassae]
 gb|EDV36653.1| GF11838 [Drosophila ananassae]
Length=328

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +  G  GS++   +   D+ I+S+  D + VRLWD  +   V+ L   ++  S
Sbjct  134  QPNAQPEEYAGHTGSIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFPNNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+SRD H +T A GSSV FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISRDNHILTIAHGSSVSFWEIDTMKKLKEVKVPTNVSSASLHPD-KHVFVCGG  246



>ref|XP_005179104.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Musca domestica]
Length=327

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P A P    G  G+++   +  ND+ I+S+  D + VRLWD  S   V+ L   ++  S
Sbjct  133  QPQAEPEMYSGHGGAIKQALFCRNDKCIISAAEDKT-VRLWDRLSGNEVQRLTFPNNPNS  191

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T A G+S+ FWD    + +K   +P NV SASL P     F+ GG
Sbjct  192  LEISADNHILTVAHGTSISFWDVESLKKLKEVKVPTNVSSASLHPD-KHVFVCGG  245



>gb|KDD74316.1| hypothetical protein H632_c1406p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=252

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 3/117 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RP+A P  +   P S+R   W+H++  +L   +   GV +WDLRS  VVRTL+T+ +V S
Sbjct  92   RPEAEPSAMPLAPDSIRGACWVHDNSALLVHYASRPGVDVWDLRSGGVVRTLETRGAVGS  151

Query  165  AEVSRDGHYITTADGSSVKFWDANQF--RLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             + S DG  +  ADG  V+F +   F    V +      VESA+L P  G  ++AGG
Sbjct  152  VDASADGRSVVVADGQEVRFLNGRTFDCAAVLAPGGCTAVESAALGP-LGNVWVAGG  207



>ref|XP_006006111.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Latimeria chalumnae]
Length=329

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +I G   +++   W + D+ ILS+  D + VRLWD ++   V+TL+  +SV+S
Sbjct  131  KPEAEPEEISGHTSAIKKALWCNGDEQILSAADDKT-VRLWDRKTMTEVKTLNFGTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E    G  +    G  + F+ A    L+KS+D P  + S SL P     F+AGG
Sbjct  190  MEYIPGGEILVITYGKVIAFYHAQSLDLIKSFDAPAPINSTSLHPE-KDFFVAGG  243



>ref|XP_004360523.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG22672.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
Length=334

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 65/116 (56%), Gaps = 4/116 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  169
             P  P  ++ G  G ++   W ++ND  +LS  +D   +R+WDLRS +   T+  K+ ++
Sbjct  128  NPTEPIFKVSGHNGMIKCALWSVYNDDCVLSGGADEV-IRIWDLRS-QNKMTICAKAPIS  185

Query  168  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            S E S+D   + T  G+ V FWDA  F  VK Y +P +V  ASL P  G  FIAGG
Sbjct  186  SMEFSKDKKLLLTTAGNEVTFWDAQSFHPVKVYSLPYDVHCASLHPD-GSRFIAGG  240



>gb|EXX68237.1| Tif34p [Rhizophagus irregularis DAOM 197198w]
Length=308

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PD P  + +G   ++++V W   ++ ++ S  D   +R+WD+R+ + + T  T+  +TS
Sbjct  140  KPDDPASEAEGHESTIKSVIW-DGERNVILSAGDDKEIRVWDVRNFDQINTFKTEHPITS  198

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S +G YIT+  G  V F DA+ +++ KS     +V S SL P   K F+AGG
Sbjct  199  MELSANGKYITSTAGKVVHFLDASTYQVFKSVPTAYDVSSVSLHPDH-KRFVAGG  252



>ref|XP_396504.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis mellifera]
 ref|XP_003691084.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis florea]
 ref|XP_006613623.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis dorsata]
Length=330

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P+   G    +R V + +N+ T L +C D   +R+WD  S + V+ LD  +   S
Sbjct  132  KPDAAPQVFSGHKNGIRHVTFFNNN-TALITCGDDKTLRVWDRNSGQEVKRLDFPAIPNS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVSRDG+ ITT   + V FW++ +   ++ Y  P  + SASL P     F+ GG
Sbjct  191  MEVSRDGNIITTTHSNIVTFWNSRELTKLREYTAPTQMNSASLHPDC-SIFVCGG  244



>ref|XP_001986592.1| GH20440 [Drosophila grimshawi]
 gb|EDW01459.1| GH20440 [Drosophila grimshawi]
Length=328

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P    G  G+++   +  +D+ I+S+  D + VRLWD  +   V+ L  +++  S
Sbjct  134  QPDAEPELYSGHAGAIKRALFCRDDKCIISAADDKT-VRLWDRMTGIEVQRLQFQNNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+SRD H +T   GS++ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISRDNHVLTITHGSTISFWEVDTLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>ref|NP_001279558.1| serine/threonine kinase receptor associated protein [Callorhinchus 
milii]
 gb|AFK10801.1| serine/threonine kinase receptor associated protein [Callorhinchus 
milii]
 gb|AFM85457.1| serine-threonine kinase receptor associated protein [Callorhinchus 
milii]
Length=329

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            + DA P +I G   +++   W + D+ ILS+  D + +RLWD  S   V++++  +SV+S
Sbjct  131  KTDAEPLEIGGHTSAIKKACWCNGDKQILSAADDKT-IRLWDRESMTEVKSINFGTSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E    G  +    G ++ F++A    L+KS+D P ++ SASL P     F+AGG
Sbjct  190  MEYIPKGEMLILTHGKTIAFYNALSLELIKSFDAPASINSASLHPE-KDCFVAGG  243



>gb|ESA22835.1| hypothetical protein GLOINDRAFT_342473 [Rhizophagus irregularis 
DAOM 181602]
Length=334

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PD P  + +G   ++++V W      ILS+  D   +R+WD+R+ + + T  T+  +TS
Sbjct  140  KPDDPASEAEGHESTIKSVIWDGERNVILSAGDDKE-IRVWDVRNFDQINTFKTEHPITS  198

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S +G YIT+  G  V F DA+ +++ KS     +V S SL P   K F+AGG
Sbjct  199  MELSANGKYITSTAGKVVHFLDASTYQVFKSVPTAYDVSSVSLHPDH-KRFVAGG  252



>gb|EFA79493.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=315

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 4/116 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  169
            +P+ P  QI G    ++T  W ++ND  ILS  +D   +R+ DLRS   +  L  K+ ++
Sbjct  128  KPNVPLAQIPGHQSMIKTAMWSVYNDDVILSGGNDEV-IRIMDLRSGTQM-ALCAKAPIS  185

Query  168  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            S E S+D  Y+ T  G+ V FW+A  F  VK Y +P  V  ASL P   + FIAGG
Sbjct  186  SMEFSKDKQYLVTTAGNEVTFWNAQNFHPVKVYSLPFEVICASLHPDNSR-FIAGG  240



>ref|XP_003294375.1| WD40 repeat-containing protein [Dictyostelium purpureum]
 gb|EGC29100.1| WD40 repeat-containing protein [Dictyostelium purpureum]
Length=283

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            + + P  QI G   +++   W   +  I+ S      +R+WDLRS   + +L  KSS++S
Sbjct  120  KANEPLFQISGHQNTIKKATWSAFNSDIVLSGGLDEVIRIWDLRSGTQI-SLCAKSSISS  178

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E S+D  Y+ T  G+ V FWDA+ F  +K Y +P  V  ASL P   K FIAGG
Sbjct  179  MEFSKDKKYLVTTAGNEVTFWDAHSFYPLKVYSLPFEVNCASLSPDNSK-FIAGG  232



>ref|XP_003972671.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Takifugu rubripes]
Length=329

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 2/113 (2%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            DA P++I G   +++   W + D+ ILS+  D + +RLWD  S E V+ L   +SV+S E
Sbjct  133  DAAPQEIAGHTSAIKKALWCNGDKHILSAAEDKT-IRLWDRCSMEEVKRLSFDTSVSSME  191

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
               DG  +    G ++ F++A    L+KS D P  + SASL P     F+AGG
Sbjct  192  YVADGEVLVITYGKTIAFYNALSLDLIKSVDAPAPINSASLHPE-KDFFVAGG  243



>ref|XP_008544371.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Microplitis demolitor]
Length=330

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PD+PP+   G    ++ V +  ND  ++ SC+D   +R+WD  + + VR +D  +  +S
Sbjct  132  KPDSPPQVFSGHTSFIKQVMFF-NDNKLIVSCADDKTLRVWDRSNGQEVRRIDFPALPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG  ITT   ++V FW++     ++ Y +P  V S SL P     F+ GG
Sbjct  191  MEVSKDGKIITTTHSNTVSFWNSLDLTKIREYTIPTQVNSVSLHPD-CSIFVCGG  244



>ref|XP_001624518.1| predicted protein [Nematostella vectensis]
 gb|EDO32418.1| predicted protein, partial [Nematostella vectensis]
Length=213

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  339  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  160
            D+ P+ + G  GS++T  W + +  ++ S  D   +RLWD R+ E  R +    ++T+ +
Sbjct  39   DSEPQVLTGHTGSIKTALW-NKENNMVYSGGDDKMIRLWDTRTLENTRNIQLPHNLTNMD  97

Query  159  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            +SRDG+ +    G++V F++     ++KS++MP  V  ASL P     F+AGG
Sbjct  98   MSRDGNVLVITHGTTVVFYETESMDVIKSFEMPTLVYGASLHPD-KSCFVAGG  149



>ref|XP_001976425.1| GG20020 [Drosophila erecta]
 ref|XP_002092635.1| GE11556 [Drosophila yakuba]
 gb|EDV56825.1| GG20020 [Drosophila erecta]
 gb|EDW92347.1| GE11556 [Drosophila yakuba]
Length=328

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +  G  GS++   +   D+ I+S+  D + VRLWD  +   V+ L   S+  S
Sbjct  134  QPEAQPEEYAGHTGSIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFNSNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T + GSS+ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISSDNHILTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>ref|XP_005805514.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Xiphophorus maculatus]
Length=333

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = -3

Query  330  PRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSR  151
            P++I G   +++   W ++D  ILS+  D + VRLWD RS E V+TL   +SV+S E   
Sbjct  140  PQEIAGHSSAIKKSLWCNDDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSSMEYLA  198

Query  150  DGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG
Sbjct  199  DGEILVITYGKTIAFYNALSLDLIKTVEAPAPINSASLHPE-KDFFVAGG  247



>ref|XP_011270254.1| hypothetical protein CAOG_08643 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91798.1| hypothetical protein CAOG_008643 [Capsaspora owczarzaki ATCC 
30864]
Length=321

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RP+A P   DG   + R   +++ND  +L++  D S +RLWDLR+ +  R +   +S TS
Sbjct  131  RPEAEPVIFDGLTATARVAMFVNNDSMLLTAAED-SCIRLWDLRTRQEERVIPLDASATS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS DG  +T A G S+ F++   F  +KS      + SASL     K F+AGG
Sbjct  190  VEVSADGQIMTVAHGHSISFFNMQTFEKIKSITHTSPLYSASLHGSKTK-FVAGG  243



>ref|XP_003705564.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Megachile rotundata]
Length=330

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V + +N+ T L +C+D   +R+WD+ S + V+ L+  +   S
Sbjct  132  KPEAAPQIFSGHKNGIRHVTFFNNN-TALITCADDKTLRVWDINSGQEVKRLNFPAIPNS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S+DG+ ITT   + V FWD+ +   +  Y  P  + SASL P     F+ GG
Sbjct  191  MELSKDGNIITTTHSNIVTFWDSKELTKLHEYTAPTQMNSASLHPDC-SIFVCGG  244



>ref|NP_611804.1| wing morphogenesis defect, isoform A [Drosophila melanogaster]
 ref|NP_001097436.1| wing morphogenesis defect, isoform B [Drosophila melanogaster]
 ref|XP_002040104.1| GM15531 [Drosophila sechellia]
 gb|AAF47023.1| wing morphogenesis defect, isoform A [Drosophila melanogaster]
 gb|AAL28548.1| HL01517p [Drosophila melanogaster]
 gb|ABV53896.1| wing morphogenesis defect, isoform B [Drosophila melanogaster]
 gb|EDW56969.1| GM15531 [Drosophila sechellia]
 gb|ACL83966.1| wmd-PA, partial [synthetic construct]
 gb|ACL89061.1| wmd-PA [synthetic construct]
Length=328

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +  G  G+++   +   D+ I+S+  D + VRLWD  +   V+ L   S+  S
Sbjct  134  QPEAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFNSNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T + GSS+ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISSDNHILTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>ref|XP_011335793.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cerapachys biroi]
 gb|EZA56461.1| Serine-threonine kinase receptor-associated protein [Cerapachys 
biroi]
Length=330

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + ++ LD  +  +S
Sbjct  132  KPEASPQIFSGHASGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEIKRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG  ITT   + V FWD+ +   +K +  P  V SASL P     F+ GG
Sbjct  191  MEVSKDGSIITTTHSNIVTFWDSKELTKIKEFAAPTQVNSASLHPDC-TMFVCGG  244



>ref|XP_011052618.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Acromyrmex echinatior]
 gb|EGI66547.1| Serine-threonine kinase receptor-associated protein [Acromyrmex 
echinatior]
Length=330

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEAAPQIFSGHASGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG+ ITT   + V FW++ +   +K + +P  V SASL P     F+ GG
Sbjct  191  MEVSKDGNIITTTHSNIVTFWNSKELTKIKEFMVPTQVNSASLHPDC-TIFVCGG  244



>ref|NP_001090526.1| serine/threonine kinase receptor associated protein [Xenopus 
laevis]
 gb|AAH97832.1| Strap protein [Xenopus laevis]
Length=273

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +I G   +++   W +ND  ILS+  D + VRLWD  S   V+TL   +SV+S
Sbjct  75   KPEAEPWEISGHTSAIKKALWYNNDNQILSAADDKT-VRLWDRVSMTEVKTLQFGASVSS  133

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEP  31
             E   +G  +    G ++  +D++   L+KS++ P  + SASL P
Sbjct  134  MEYIPEGEALLITYGRTIALYDSSSLELIKSFEAPAPINSASLHP  178



>gb|KFM64458.1| Serine-threonine kinase receptor-associated protein, partial 
[Stegodyphus mimosarum]
Length=333

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RP+     + G   +V+   +L +++ I+S+  D S VR WDL S E ++ L+ ++   +
Sbjct  132  RPEESGVCLSGHTSAVKKALFLQDEKRIVSAADDKS-VRFWDLTSHEEIKKLEFETQPNN  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S +G+ +    G SV FWD N F  +K+Y +P  V SASL P     F+ GG
Sbjct  191  LELSLNGNILVIPHGHSVSFWDVNNFEKLKTYSVPSQVNSASLHPD-QSVFVCGG  244



>ref|XP_002074661.1| GK23046 [Drosophila willistoni]
 gb|EDW85647.1| GK23046 [Drosophila willistoni]
Length=328

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G  G+++   +   D+ I+S+  D + VRLWD  +   V+ L   ++  S
Sbjct  134  QPEADPEIYCGHTGAIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFPNNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+SRD H +T A GSS+ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISRDNHVLTIAHGSSISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>gb|KDR13003.1| Serine-threonine kinase receptor-associated protein [Zootermopsis 
nevadensis]
Length=370

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G    +R V +   D T L +C+D   +R+WD  S + V+ LD  +  +S
Sbjct  175  KPEATPTVFSGHTSGIRHVIFFRGD-THLVTCADDRTLRVWDRTSGQEVQKLDFSAIPSS  233

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EV+RDG  +T   G+ V FWDA   + ++ + +P  V SASL P     F+ GG
Sbjct  234  LEVARDGSTLTVTHGNVVSFWDAQSLKKIREFTVPTQVNSASLHPD-KTIFVCGG  287



>ref|XP_969569.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Tribolium castaneum]
 gb|EFA09026.1| hypothetical protein TcasGA2_TC006736 [Tribolium castaneum]
Length=327

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +  G    +R V +  ND T L SC+D   +R+WD  S + V+ +D  S   S
Sbjct  132  KPEAKPEEFTGHTSGIRHVIFFRND-THLVSCADDKTLRVWDRSSGKEVQKMDFPSIPNS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVSRDG  +T    + V F D+     ++ + +P  V SASL P     F+AGG
Sbjct  191  LEVSRDGTVLTVTHSNHVTFLDSESLNKIREFSVPTTVNSASLHPD-KTIFVAGG  244



>ref|XP_007527681.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Erinaceus europaeus]
Length=350

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA PR+I G    ++   W  +D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  RPDAEPREISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAISLEPIKSFEAPATINSASLHPE--KEFLVAG  241



>ref|XP_004525970.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Ceratitis capitata]
Length=327

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G  G+++   +  +D+ ILS+  D + VRLWD  +   V+ L    +  S
Sbjct  133  QPNAEPEMYAGHTGALKRALFCRDDKCILSAAEDKT-VRLWDRLTGNEVQRLQFPHNPNS  191

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T   GS++ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  192  LEISADNHILTITHGSTISFWEVDTLKKLKEVKVPTNVSSASLHPD-KHVFVCGG  245



>ref|XP_011263567.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Camponotus floridanus]
 gb|EFN63377.1| Serine-threonine kinase receptor-associated protein [Camponotus 
floridanus]
Length=329

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + ++ LD  +  +S
Sbjct  132  KPEALPQIFSGHASGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEIKRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEP  31
             EVS+DG  ITT   + V FW++ +   +K + +P  V SASL P
Sbjct  191  MEVSKDGSIITTTHSNIVTFWNSKELTKIKEFTVPTQVNSASLHP  235



>ref|XP_011190917.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Bactrocera cucurbitae]
Length=327

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G  G+++   +  +D+ ILS+  D + VRLWD  +   ++ L    +  S
Sbjct  133  QPNAEPEMYAGHAGALKRALFCRDDKCILSAAEDKT-VRLWDRLTGNEIQRLQFPHNPNS  191

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T   GS++ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  192  LEISADNHILTITHGSTISFWEVDTLKKLKEVKVPTNVSSASLHPD-KHVFVCGG  245



>ref|NP_001087814.1| serine/threonine kinase receptor associated protein [Xenopus 
laevis]
 gb|AAH81265.1| MGC86380 protein [Xenopus laevis]
Length=329

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +I G   +++   W +N+  ILS+ SD   VRLWD  S   V+TL    SV+S
Sbjct  131  KPEAEPWEISGHTSAIKKALWYNNNTQILSA-SDDRTVRLWDRVSMTEVKTLQFGVSVSS  189

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G ++  +D++   L+KS++ P ++ SASL P   +  +AGG
Sbjct  190  MEYIPEGEALLITYGRTIALYDSSSLELIKSFEAPASINSASLHPD-KECIVAGG  243



>ref|XP_011150584.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Harpegnathos saltator]
 gb|EFN77156.1| Serine-threonine kinase receptor-associated protein [Harpegnathos 
saltator]
Length=330

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+  P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEEAPQIFSGHTSGIRHVTFFDNNSALVT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG  ITT   + V FW++ +   +K + +P  V SASL P     F+ GG
Sbjct  191  MEVSKDGKIITTTHSNIVTFWNSKELTKIKEFTVPTQVNSASLHPDC-SIFVCGG  244



>ref|XP_002059888.1| GJ14989 [Drosophila virilis]
 gb|EDW57225.1| GJ14989 [Drosophila virilis]
Length=328

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P    G  G+++   +  +D+ I+S+  D + VRLWD  +   V+ L   ++  S
Sbjct  134  QPDAEPELYAGHGGAIKRALFCRDDKCIISAADDKT-VRLWDRMTGIEVQRLQFANNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T   GS++ FW+    + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISHDNHVLTITHGSTISFWEIETLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>gb|EPQ08116.1| Serine-threonine kinase receptor-associated protein [Myotis brandtii]
Length=309

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S
Sbjct  90   KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSS  147

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F+  G
Sbjct  148  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAG  200



>ref|XP_011207556.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Bactrocera dorsalis]
Length=295

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G  G+++   +  +D+ ILS+  D + VRLWD  +   ++ L    +  S
Sbjct  101  QPNAEPELYAGHTGALKRALFCRDDKCILSAAEDKT-VRLWDRLTGNEIQRLQFPHNPNS  159

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T   GS++ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  160  LEISADNHILTITHGSTISFWEVDTLKKLKEVKVPTNVSSASLHPD-KHVFVCGG  213



>dbj|GAM26537.1| hypothetical protein SAMD00019534_097120 [Acytostelium subglobosum 
LB1]
Length=291

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  169
            +P+ P  QI G    ++   W  +ND  +LS   D   +R+ DLR+   +  L  K+ ++
Sbjct  128  KPNEPLLQIPGHQSMIKAAMWSAYNDDVVLSGGGDEI-IRIMDLRAGTHM-ALCAKAPIS  185

Query  168  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
            S E S+D  Y+ T  G+ + FWDA  F  +K Y +P  V  ASL P   K FIAGG
Sbjct  186  SMEFSKDKKYLITTAGAEITFWDAATFHPLKVYSLPFEVNCASLHPDNSK-FIAGG  240



>ref|XP_011207555.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Bactrocera dorsalis]
Length=327

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G  G+++   +  +D+ ILS+  D + VRLWD  +   ++ L    +  S
Sbjct  133  QPNAEPELYAGHTGALKRALFCRDDKCILSAAEDKT-VRLWDRLTGNEIQRLQFPHNPNS  191

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T   GS++ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  192  LEISADNHILTITHGSTISFWEVDTLKKLKEVKVPTNVSSASLHPD-KHVFVCGG  245



>ref|XP_006084353.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis lucifugus]
Length=350

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAG  241



>ref|NP_001120495.1| serine/threonine kinase receptor associated protein [Xenopus 
(Silurana) tropicalis]
 gb|AAI61374.1| LOC100145616 protein [Xenopus (Silurana) tropicalis]
Length=327

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P +I G   +++   W +ND  ILS+ SD   VRLWD  S   V+TL    SV+S
Sbjct  129  KPEAEPWEISGHTSAIKKALWYNNDNQILSA-SDDKTVRLWDRVSMTEVKTLQFGVSVSS  187

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G ++  ++A    L+KS++ P  + SASL P   +  +AGG
Sbjct  188  MEYIPEGEALLITYGRTIALYNALSLDLIKSFEAPAPINSASLHPD-KECIVAGG  241



>gb|ENN71163.1| hypothetical protein YQE_12093, partial [Dendroctonus ponderosae]
Length=325

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G    +R + +  ND T L SC+D   +R+WD  + + +  +    S  S
Sbjct  132  KPEAVPEVFSGHTAGIRHILFFRND-THLVSCADDKTLRVWDRSNKQEIHKVSFPFSPNS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG  +T A  + V F+DA     ++ Y +P  V SASL P     F+AGG
Sbjct  191  LEVSKDGSVLTVAYSNKVAFYDAETLNKIREYTIPSPVNSASLHPD-KSIFVAGG  244



>ref|XP_002732021.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Saccoglossus kowalevskii]
Length=326

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
             P++ P+ I G   S+R   W    +TI+S+  D + VR+WD+ S   +  +D  SS  +
Sbjct  132  HPESEPQVISGHTSSIRDALWCQKGKTIISAAEDKT-VRMWDVASNREIMKIDLDSSNLN  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             +++ DG  +    G S+ F+  +    +KSY+ P  V SASL P     F+AGG
Sbjct  191  LDINNDGSILVITHGKSISFYKTDSLEKLKSYEAPTPVYSASLHPE-KLCFVAGG  244



>ref|XP_002004424.1| GI19623 [Drosophila mojavensis]
 gb|EDW08359.1| GI19623 [Drosophila mojavensis]
Length=328

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P    G  G+++   +  +D+ I+S+  D + VRLWD  +   V+ L   ++  S
Sbjct  134  QPEAEPELYMGHTGAIKRALFCRDDKCIISAADDKT-VRLWDRMTGIEVQRLQFPNNPNS  192

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S D H +T   GS++ FW+ +  + +K   +P NV SASL P     F+ GG
Sbjct  193  LEISHDNHVLTITHGSTISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGG  246



>ref|XP_004460360.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform 2 [Dasypus novemcinctus]
Length=349

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P++I G    ++   W  +D+ ILS+  D   VRLWD  S   V++L    SV+S
Sbjct  131  KPDADPKEISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDQASMTEVKSLSFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAG  241



>ref|XP_001600320.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Nasonia vitripennis]
Length=329

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R   +  ND+ +L +C+D   +R+WD  S   V+ L+  +   S
Sbjct  132  KPEADPQVFSGHTSGIRHATFFDNDK-LLITCADDKTLRVWDRSSGLEVKKLEFPAIPRS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E+S+DG  ITT   + V FWD+ +   ++ + +P  V SASL P     F+ GG
Sbjct  191  MELSKDGKIITTTHSNIVTFWDSKELTKLREFTVPTQVNSASLHPD-NSIFVCGG  244



>ref|XP_004460359.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform 1 [Dasypus novemcinctus]
Length=350

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +PDA P++I G    ++   W  +D+ ILS+  D   VRLWD  S   V++L    SV+S
Sbjct  131  KPDADPKEISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDQASMTEVKSLSFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAG  241



>ref|XP_006505894.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Mus musculus]
Length=273

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G    ++   W  +D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAG  241



>ref|XP_011396442.1| Serine-threonine kinase receptor-associated protein [Auxenochlorella 
protothecoides]
 gb|KFM23568.1| Serine-threonine kinase receptor-associated protein [Auxenochlorella 
protothecoides]
Length=322

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 67/116 (58%), Gaps = 3/116 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            RPDA P +      S+R  AW+H+++ +L S SD   + + D R+  VV+TL+T   VTS
Sbjct  136  RPDAAP-ETAALASSIRGAAWIHDNKAMLISYSDKPNLDVLDTRTLSVVKTLETAGPVTS  194

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSY-DMPCNVESASLEPRFGKXFIAGG  1
             +V+  G +I TADGS V   D   F + +++     +VE+A+  P  GK  +AGG
Sbjct  195  IDVTDCGRFIVTADGSQVLIHDGTDFAVKRTFRPSGYSVEAAAYAPDRGK-LVAGG  249



>ref|XP_011156221.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Solenopsis invicta]
Length=329

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEATPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG+ I T   + V FWD+ +   +K   +P  V S SL P     F+ GG
Sbjct  191  MEVSKDGNIIITTHSNIVTFWDSKELTKIKECTVPTQVNSTSLHPDC-TIFVCGG  244



>ref|XP_006773325.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis davidii]
Length=350

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   +++L    SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTELKSLSFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAG  241



>gb|EFZ20290.1| hypothetical protein SINV_00798 [Solenopsis invicta]
Length=328

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEATPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG+ I T   + V FWD+ +   +K   +P  V S SL P     F+ GG
Sbjct  191  MEVSKDGNIIITTHSNIVTFWDSKELTKIKECTVPTQVNSTSLHPDC-TIFVCGG  244



>ref|XP_011301387.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Fopius arisanus]
Length=330

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++  G    ++ V +  +D++++S C+D   +R+WD  S    R LD  +  +S
Sbjct  132  KPEAAPQKFSGHTSFIKHVTFFDHDKSLVS-CADDKTLRVWDRSSGLETRRLDFPAIPSS  190

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             EVS+DG  ITT   + V FW+++    ++ + +P  V S SL P     F+ GG
Sbjct  191  MEVSKDGSIITTTHANIVTFWNSHDLTKIREFTIPTQVNSVSLHPD-RTMFVCGG  244



>ref|XP_003749912.2| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Rattus norvegicus]
Length=279

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAG  241



>ref|XP_007196085.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Balaenoptera acutorostrata scammoni]
Length=350

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = -3

Query  345  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  166
            +P+A P++I G    ++   W   DQ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDQQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  165  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKXFIAGG  1
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F+  G
Sbjct  189  MEYIPEGEMLVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAG  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554595229600