BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018I15

Length=816
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          319   3e-103   Nicotiana sylvestris
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          316   5e-102   Nicotiana tomentosiformis
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          315   9e-102   Solanum lycopersicum
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          312   1e-100   Solanum tuberosum [potatoes]
emb|CDP08773.1|  unnamed protein product                                312   2e-100   Coffea canephora [robusta coffee]
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          311   4e-100   Nicotiana tomentosiformis
ref|XP_002511907.1|  caax prenyl protease ste24, putative               310   6e-100   Ricinus communis
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    310   7e-100   Nicotiana sylvestris
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                310   1e-99    Erythranthe guttata [common monkey flower]
gb|KDO86286.1|  hypothetical protein CISIN_1g014430mg                   305   2e-99    Citrus sinensis [apfelsine]
ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          307   2e-98    Vitis vinifera
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          307   2e-98    Phoenix dactylifera
ref|XP_002302601.1|  CAAX protease family protein                       306   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          306   2e-98    Sesamum indicum [beniseed]
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          306   5e-98    Elaeis guineensis
gb|EPS68077.1|  hypothetical protein M569_06696                         296   6e-98    Genlisea aurea
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    304   9e-98    Nicotiana sylvestris
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          305   1e-97    Citrus sinensis [apfelsine]
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             305   2e-97    
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          303   7e-97    Pyrus x bretschneideri [bai li]
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein                303   9e-97    
ref|XP_002320821.1|  CAAX protease family protein                       302   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          302   1e-96    Populus euphratica
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    302   1e-96    Gossypium arboreum [tree cotton]
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          302   2e-96    Elaeis guineensis
gb|KJB41392.1|  hypothetical protein B456_007G102500                    301   2e-96    Gossypium raimondii
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          301   2e-96    Nelumbo nucifera [Indian lotus]
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             301   3e-96    Prunus persica
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          301   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          300   1e-95    Phoenix dactylifera
ref|XP_007051723.1|  Peptidase family M48 family protein                300   2e-95    
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          299   2e-95    Prunus mume [ume]
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          298   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          298   5e-95    
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog          298   7e-95    Fragaria vesca subsp. vesca
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          297   1e-94    Cucumis melo [Oriental melon]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          296   2e-94    
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          296   2e-94    Cucumis sativus [cucumbers]
gb|ADE76166.1|  unknown                                                 288   6e-94    Picea sitchensis
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700          295   8e-94    Amborella trichopoda
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             295   9e-94    Phaseolus vulgaris [French bean]
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     293   2e-93    Eucalyptus grandis [rose gum]
gb|AFK35300.1|  unknown                                                 286   3e-93    Lotus japonicus
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          293   3e-93    Eucalyptus grandis [rose gum]
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          293   3e-93    
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          293   4e-93    Glycine max [soybeans]
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          292   7e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|KHM99334.1|  CAAX prenyl protease 1 like                             291   1e-92    Glycine soja [wild soybean]
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          291   2e-92    Glycine max [soybeans]
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  290   5e-92    Medicago truncatula
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          290   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          286   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          286   1e-90    Camelina sativa [gold-of-pleasure]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                        286   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAL07084.1|  putative CAAX prenyl protease                           286   2e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDY48517.1|  BnaA09g00060D                                          286   2e-90    Brassica napus [oilseed rape]
ref|XP_002874990.1|  ATSTE24                                            286   2e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          286   2e-90    Brassica rapa
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          285   5e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg             285   8e-90    Capsella rubella
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease     284   1e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CDY07191.1|  BnaCnng02060D                                          284   1e-89    
emb|CDX91888.1|  BnaC03g31900D                                          283   2e-89    
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    283   2e-89    Arabis alpina [alpine rockcress]
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    283   2e-89    Tarenaya hassleriana [spider flower]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             285   4e-89    
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    282   6e-89    Brassica rapa
emb|CDX74353.1|  BnaA03g26940D                                          281   1e-88    
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          278   2e-87    Oryza brachyantha
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog          278   5e-87    Setaria italica
emb|CAL26913.1|  CAAX peptidase                                         276   1e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001783632.1|  predicted protein                                  276   1e-86    
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850          276   1e-86    Sorghum bicolor [broomcorn]
gb|EEC73787.1|  hypothetical protein OsI_08473                          276   2e-86    Oryza sativa Indica Group [Indian rice]
ref|NP_001047739.1|  Os02g0680400                                       275   3e-86    
ref|XP_001780822.1|  predicted protein                                  275   5e-86    
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog          274   1e-85    Brachypodium distachyon [annual false brome]
ref|NP_001131195.1|  uncharacterized protein LOC100192503               272   7e-85    Zea mays [maize]
emb|CAB80941.1|  putative CAAX prenyl protease                          271   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog          270   5e-84    Fragaria vesca subsp. vesca
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2       269   7e-84    
gb|AFW63375.1|  CAAX prenyl protease 1                                  272   1e-82    
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    266   2e-82    Brassica rapa
gb|KDP28583.1|  hypothetical protein JCGZ_14354                         260   3e-80    Jatropha curcas
ref|NP_001152504.1|  CAAX prenyl protease 1                             260   3e-80    Zea mays [maize]
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1       260   3e-80    Zea mays [maize]
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600             257   3e-79    Selaginella moellendorffii
gb|AIC32889.1|  STE24                                                   248   7e-76    Puccinellia tenuiflora
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog          232   2e-69    Fragaria vesca subsp. vesca
gb|KJB41393.1|  hypothetical protein B456_007G102500                    228   4e-68    Gossypium raimondii
gb|KDO86287.1|  hypothetical protein CISIN_1g014430mg                   226   2e-67    Citrus sinensis [apfelsine]
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                     223   8e-67    
gb|KHN29321.1|  CAAX prenyl protease 1 like                             205   1e-59    Glycine soja [wild soybean]
gb|AAB61028.1|  A_IG002N01.21 gene product                              191   5e-55    Arabidopsis thaliana [mouse-ear cress]
gb|KDO86288.1|  hypothetical protein CISIN_1g014430mg                   189   2e-53    Citrus sinensis [apfelsine]
gb|KEH18809.1|  CAAX prenyl protease-like protein                       179   6e-49    Medicago truncatula
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672              171   4e-46    Volvox carteri f. nagariensis
gb|ESA09906.1|  hypothetical protein GLOINDRAFT_80760                   169   1e-45    
emb|CCI48758.1|  unnamed protein product                                162   1e-42    Albugo candida
emb|CCA18761.1|  CAAX prenyl protease 1 putative                        160   7e-42    Albugo laibachii Nc14
ref|XP_009501173.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   2e-40    Phalacrocorax carbo [common cormorant]
ref|XP_008935450.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-40    Merops nubicus
ref|XP_010116516.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-40    Chlamydotis macqueenii
ref|XP_009949557.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-40    Leptosomus discolor
ref|XP_010158796.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-39    Eurypyga helias
gb|EMP29923.1|  CAAX prenyl protease 1 like protein                     149   2e-39    Chelonia mydas [green seaturtle]
ref|XP_009059971.1|  hypothetical protein LOTGIDRAFT_209825             153   3e-39    Lottia gigantea
ref|XP_004348317.1|  CAAX prenyl protease 1                             154   3e-39    Capsaspora owczarzaki ATCC 30864
dbj|BAG51388.1|  unnamed protein product                                148   3e-39    Homo sapiens [man]
gb|AFW68434.1|  hypothetical protein ZEAMMB73_431227                    148   3e-39    
ref|XP_002900396.1|  CAAX prenyl protease 1                             153   3e-39    Phytophthora infestans T30-4
gb|ETE70091.1|  CAAX prenyl protease 1-like protein                     152   4e-39    Ophiophagus hannah
gb|ELU11443.1|  hypothetical protein CAPTEDRAFT_171238                  152   5e-39    Capitella teleta
ref|XP_005428744.1|  PREDICTED: CAAX prenyl protease 1 homolog          151   6e-39    Geospiza fortis
ref|XP_010624212.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    151   6e-39    Fukomys damarensis [Damara mole rat]
ref|XP_005100140.1|  PREDICTED: CAAX prenyl protease 1 homolog          152   6e-39    Aplysia californica
gb|KFP73521.1|  CAAX prenyl protease 1                                  147   6e-39    Apaloderma vittatum
ref|XP_005651455.1|  hypothetical protein COCSUDRAFT_27312              151   6e-39    Coccomyxa subellipsoidea C-169
ref|XP_009876903.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   7e-39    Apaloderma vittatum
ref|XP_010721597.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   7e-39    Meleagris gallopavo [common turkey]
ref|XP_010284930.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   7e-39    Phaethon lepturus
ref|XP_010624213.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    152   9e-39    Fukomys damarensis [Damara mole rat]
ref|XP_009685466.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    150   1e-38    Struthio camelus australis
ref|XP_009491273.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-38    Pelecanus crispus
ref|XP_007430031.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    151   1e-38    Python bivittatus
ref|XP_002292916.1|  predicted protein                                  150   1e-38    Thalassiosira pseudonana CCMP1335
ref|XP_009813244.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-38    Gavia stellata
gb|ETL45293.1|  hypothetical protein L916_04606                         151   2e-38    Phytophthora parasitica
gb|ETO80780.1|  hypothetical protein F444_04815                         151   2e-38    Phytophthora parasitica P1976
gb|ETL98448.1|  hypothetical protein L917_04490                         151   2e-38    Phytophthora parasitica
gb|ETI52023.1|  hypothetical protein F443_04763                         151   2e-38    Phytophthora parasitica P1569
gb|ETK91894.1|  hypothetical protein L915_04651                         151   2e-38    Phytophthora parasitica
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864             150   2e-38    Phytophthora sojae
ref|XP_008902128.1|  hypothetical protein PPTG_09033                    150   2e-38    Phytophthora parasitica INRA-310
ref|XP_009685465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   2e-38    Struthio camelus australis
ref|XP_005353368.1|  PREDICTED: CAAX prenyl protease 1 homolog          150   2e-38    
ref|XP_005309438.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   3e-38    Chrysemys picta bellii
ref|XP_007066142.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    149   3e-38    
ref|XP_005029095.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   3e-38    
ref|XP_004426071.1|  PREDICTED: CAAX prenyl protease 1 homolog          150   3e-38    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFV87620.1|  CAAX prenyl protease 1                                  149   4e-38    Struthio camelus australis
ref|XP_007950886.1|  PREDICTED: CAAX prenyl protease 1 homolog          150   4e-38    Orycteropus afer afer
gb|KGL80196.1|  CAAX prenyl protease 1                                  149   4e-38    Tinamus guttatus
gb|KGO76072.1|  Peptidase M48                                           150   4e-38    Penicillium italicum
ref|XP_006033777.1|  PREDICTED: CAAX prenyl protease 1 homolog          150   4e-38    
ref|XP_004450692.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   4e-38    
gb|EOA94667.1|  CAAX prenyl protease 1-like protein                     150   4e-38    Anas platyrhynchos [duck]
gb|KFH71808.1|  hypothetical protein MVEG_02102                         149   5e-38    Mortierella verticillata NRRL 6337
ref|XP_004705331.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   5e-38    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005029094.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   5e-38    Anas platyrhynchos [duck]
ref|XP_009991374.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   5e-38    Tauraco erythrolophus
ref|XP_417720.1|  PREDICTED: CAAX prenyl protease 1 homolog             149   5e-38    Gallus gallus [bantam]
ref|XP_004665222.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   5e-38    Jaculus jaculus
gb|KFP47980.1|  CAAX prenyl protease 1                                  148   5e-38    Cathartes aura
ref|XP_005309437.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   5e-38    Chrysemys picta bellii
ref|XP_010217187.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   6e-38    Tinamus guttatus
ref|XP_007492913.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   6e-38    Monodelphis domestica
ref|XP_010593553.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   6e-38    Loxodonta africana [African bush elephant]
gb|KFU93569.1|  CAAX prenyl protease 1                                  149   6e-38    Chaetura pelagica
ref|XP_001381205.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   6e-38    Monodelphis domestica
ref|XP_006269945.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   7e-38    Alligator mississippiensis
ref|XP_009095809.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   8e-38    
ref|XP_010187899.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   8e-38    Mesitornis unicolor
ref|XP_005309436.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   8e-38    Chrysemys picta bellii
gb|KFQ39196.1|  CAAX prenyl protease 1                                  148   9e-38    Mesitornis unicolor
gb|KFO78045.1|  CAAX prenyl protease 1                                  148   9e-38    Cuculus canorus
ref|XP_006113335.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   9e-38    Pelodiscus sinensis [Chinese softshell turtle]
gb|KFP66604.1|  CAAX prenyl protease 1                                  148   9e-38    Cariama cristata
ref|XP_009701667.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   9e-38    Cariama cristata
ref|XP_008929891.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    
gb|KFW75388.1|  CAAX prenyl protease 1                                  148   1e-37    Manacus vitellinus
ref|XP_002194902.2|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Taeniopygia guttata
ref|XP_003415368.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    149   1e-37    Loxodonta africana [African bush elephant]
ref|XP_010133525.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Buceros rhinoceros silvestris
gb|KFV07913.1|  CAAX prenyl protease 1                                  148   1e-37    Tauraco erythrolophus
gb|KFP82009.1|  CAAX prenyl protease 1                                  148   1e-37    Acanthisitta chloris
gb|KFO58257.1|  CAAX prenyl protease 1                                  148   1e-37    Corvus brachyrhynchos
ref|XP_010345849.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   1e-37    Saimiri boliviensis boliviensis
gb|KFV03217.1|  CAAX prenyl protease 1                                  148   1e-37    Pterocles gutturalis
ref|XP_009074890.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Acanthisitta chloris
ref|XP_010086478.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Pterocles gutturalis
ref|XP_009917539.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   1e-37    Haliaeetus albicilla
ref|XP_007892978.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Callorhinchus milii [Australian ghost shark]
gb|ELK19500.1|  CAAX prenyl protease 1 like protein                     147   1e-37    Pteropus alecto
ref|XP_001623710.1|  predicted protein                                  148   1e-37    Nematostella vectensis
ref|XP_010001210.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Chaetura pelagica
gb|KFO89161.1|  CAAX prenyl protease 1                                  148   1e-37    Buceros rhinoceros silvestris
gb|EFB13524.1|  hypothetical protein PANDA_017398                       148   1e-37    Ailuropoda melanoleuca
ref|XP_004614273.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   1e-37    Sorex araneus [Eurasian shrew]
gb|KGO40189.1|  Peptidase M48                                           148   1e-37    Penicillium expansum
ref|XP_005607230.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   1e-37    Equus caballus [domestic horse]
gb|KFP21746.1|  CAAX prenyl protease 1                                  148   1e-37    Egretta garzetta
gb|KFM12524.1|  CAAX prenyl protease 1                                  148   1e-37    Aptenodytes forsteri
ref|XP_002715233.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   1e-37    
ref|XP_008630820.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    
gb|KFV40539.1|  CAAX prenyl protease 1                                  148   1e-37    Tyto alba [Schleiereule]
ref|XP_005492450.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    
ref|XP_005083884.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Mesocricetus auratus [Syrian golden hamster]
ref|XP_009575599.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Fulmarus glacialis
gb|ERE83119.1|  putative CAAX prenyl protease 1 like protein            148   1e-37    Cricetulus griseus [Chinese hamsters]
gb|KFR09506.1|  CAAX prenyl protease 1                                  148   1e-37    Opisthocomus hoazin [hoatzin]
gb|KFQ91415.1|  CAAX prenyl protease 1                                  148   1e-37    Nipponia nippon
ref|XP_009969340.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Tyto alba [Schleiereule]
ref|XP_010207607.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Colius striatus
ref|XP_006113334.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   1e-37    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006886567.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009891312.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    Charadrius vociferus
ref|XP_004740737.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   1e-37    Mustela putorius furo [black ferret]
ref|XP_009909817.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   1e-37    Picoides pubescens
ref|XP_007114324.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   1e-37    
gb|KFV92102.1|  CAAX prenyl protease 1                                  147   1e-37    Fulmarus glacialis
ref|XP_006995844.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Peromyscus maniculatus bairdii
gb|KFP23371.1|  CAAX prenyl protease 1                                  148   2e-37    Colius striatus
ref|XP_006867649.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Chrysochloris asiatica
gb|KFV63659.1|  CAAX prenyl protease 1                                  147   2e-37    Picoides pubescens
ref|XP_004025583.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   2e-37    
ref|XP_008063695.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   2e-37    Carlito syrichta
ref|XP_005529940.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_003225003.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    
ref|XP_003989947.2|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    
ref|XP_004415415.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   2e-37    
ref|XP_007077458.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Panthera tigris altaica
ref|XP_005058383.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Ficedula albicollis
ref|XP_009917537.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   2e-37    Haliaeetus albicilla
gb|KFP02851.1|  CAAX prenyl protease 1                                  147   2e-37    Calypte anna
ref|XP_009931337.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Opisthocomus hoazin [hoatzin]
ref|XP_006737576.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Leptonychotes weddellii
ref|NP_001288163.1|  zinc metallopeptidase STE24                        148   2e-37    Equus caballus [domestic horse]
ref|XP_003799067.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   2e-37    
ref|XP_007453816.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Lipotes vexillifer [baiji]
ref|XP_002565802.1|  Pc22g18990                                         148   2e-37    Penicillium rubens Wisconsin 54-1255
gb|KGL99640.1|  CAAX prenyl protease 1                                  147   2e-37    Charadrius vociferus
ref|XP_002927608.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   2e-37    Ailuropoda melanoleuca
ref|XP_010017682.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   2e-37    Nestor notabilis
ref|XP_006904034.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    148   2e-37    
ref|XP_008063694.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   2e-37    Carlito syrichta
gb|EHB18901.1|  CAAX prenyl protease 1-like protein                     147   2e-37    Heterocephalus glaber [naked mole rat]
gb|KFQ43267.1|  CAAX prenyl protease 1                                  147   2e-37    Nestor notabilis
ref|XP_003891707.2|  PREDICTED: CAAX prenyl protease 1 homolog          147   2e-37    
ref|XP_539577.3|  PREDICTED: CAAX prenyl protease 1 homolog             148   2e-37    Canis lupus familiaris [dogs]
ref|XP_004678903.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Condylura cristata
ref|XP_009644178.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Egretta garzetta
ref|XP_003273371.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   2e-37    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_513352.2|  PREDICTED: CAAX prenyl protease 1 homolog             148   2e-37    Pan troglodytes
ref|XP_002750699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    148   2e-37    Callithrix jacchus [common marmoset]
ref|NP_001126457.1|  CAAX prenyl protease 1 homolog                     148   2e-37    Pongo abelii [orang utan]
gb|AAH37283.1|  Zinc metallopeptidase (STE24 homolog, S. cerevisiae)    147   2e-37    Homo sapiens [man]
ref|XP_004851106.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   2e-37    Heterocephalus glaber [naked mole rat]
gb|ELR54320.1|  CAAX prenyl protease 1-like protein                     147   3e-37    Bos mutus
ref|XP_003501864.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Cricetulus griseus [Chinese hamsters]
ref|XP_011376276.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Pteropus vampyrus
ref|XP_005898693.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Bos mutus
ref|XP_004450691.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Dasypus novemcinctus
ref|XP_010352519.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Rhinopithecus roxellana
ref|NP_001244375.1|  CAAX prenyl protease 1 homolog                     147   3e-37    Macaca mulatta [rhesus macaque]
ref|NP_005848.2|  CAAX prenyl protease 1 homolog                        147   3e-37    Homo sapiens [man]
ref|XP_003937059.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Saimiri boliviensis boliviensis
ref|XP_009284932.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   3e-37    Aptenodytes forsteri
dbj|BAA33727.1|  Ste24p                                                 147   3e-37    Homo sapiens [man]
gb|AIC62085.1|  ZMPSTE24                                                147   3e-37    synthetic construct
ref|XP_004371951.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Trichechus manatus latirostris
gb|KJB41394.1|  hypothetical protein B456_007G102500                    145   3e-37    Gossypium raimondii
ref|XP_008149410.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Eptesicus fuscus
ref|XP_007977465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Chlorocebus sabaeus
pdb|4AW6|A  Chain A, Crystal Structure Of The Human Nuclear Membr...    147   3e-37    Homo sapiens [man]
ref|XP_003765468.1|  PREDICTED: CAAX prenyl protease 1 homolog          149   3e-37    
ref|XP_004851105.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Heterocephalus glaber [naked mole rat]
gb|KFP94249.1|  CAAX prenyl protease 1                                  147   3e-37    Haliaeetus albicilla
ref|XP_010861024.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Bison bison bison
ref|XP_005139561.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Melopsittacus undulatus
ref|XP_009466806.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Nipponia nippon
ref|XP_005437030.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    
ref|XP_004316653.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004266443.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    Orcinus orca [Orca]
ref|XP_005235139.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   3e-37    
ref|XP_010861023.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   3e-37    Bison bison bison
ref|XP_010574593.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    146   4e-37    Haliaeetus leucocephalus
ref|XP_008710233.1|  PREDICTED: CAAX prenyl protease 1 homolog          148   4e-37    Ursus maritimus [white bear]
ref|NP_001179857.1|  CAAX prenyl protease 1 homolog                     147   4e-37    Bos taurus [bovine]
ref|XP_010411361.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
ref|NP_001101444.1|  CAAX prenyl protease 1 homolog                     147   4e-37    
ref|XP_006215922.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
gb|AAK38172.1|  Zmpste24                                                147   4e-37    
ref|XP_010958108.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    147   4e-37    
ref|XP_004910060.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
ref|XP_008494648.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
ref|XP_005317922.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
ref|XP_010995251.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    147   4e-37    
ref|XP_007164766.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
ref|XP_006188105.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
emb|CAD31792.1|  farnesylated-proteins converting enzyme-1              147   4e-37    
ref|NP_766288.1|  CAAX prenyl protease 1 homolog                        147   4e-37    
ref|XP_008589089.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    146   4e-37    
ref|XP_009561758.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   4e-37    
ref|XP_005514212.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    147   4e-37    
ref|XP_002485210.1|  CaaX prenyl protease Ste24                         147   5e-37    
ref|XP_010574592.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   5e-37    
gb|EPZ36837.1|  Peptidase M48 domain-containing protein                 143   5e-37    
ref|XP_006503082.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    147   5e-37    
ref|XP_003462326.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   5e-37    
ref|XP_006061988.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   6e-37    
gb|EKV19760.1|  CaaX prenyl protease Ste24                              146   6e-37    
ref|XP_004001889.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   6e-37    
ref|XP_006758037.1|  PREDICTED: CAAX prenyl protease 1 homolog          147   6e-37    
ref|XP_005970531.1|  PREDICTED: CAAX prenyl protease 1 homolog          146   7e-37    
ref|XP_006098203.1|  PREDICTED: CAAX prenyl protease 1 homolog          146   7e-37    
ref|XP_005868719.1|  PREDICTED: CAAX prenyl protease 1 homolog          146   7e-37    
ref|XP_005410609.1|  PREDICTED: CAAX prenyl protease 1 homolog          146   8e-37    
emb|CDM27808.1|  CAAX prenyl protease 1                                 146   9e-37    
ref|XP_006165004.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    146   1e-36    
ref|XP_008589087.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    146   1e-36    
ref|XP_002112567.1|  hypothetical protein TRIADDRAFT_25296              146   1e-36    
ref|XP_004646026.1|  PREDICTED: CAAX prenyl protease 1 homolog          145   1e-36    
ref|XP_004591591.1|  PREDICTED: CAAX prenyl protease 1 homolog          145   1e-36    
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897                 145   1e-36    
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079                 145   1e-36    
gb|KFY19341.1|  hypothetical protein V493_08005                         145   1e-36    
ref|XP_007536149.1|  PREDICTED: CAAX prenyl protease 1 homolog          145   2e-36    
pdb|2YPT|A  Chain A, Crystal Structure Of The Human Nuclear Membr...    145   2e-36    
ref|XP_001821320.1|  CAAX prenyl protease 1                             145   2e-36    
ref|XP_007218054.1|  hypothetical protein PRUPE_ppa006168mg             143   3e-36    
ref|NP_001087923.1|  zinc metallopeptidase STE24                        145   3e-36    
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226                144   3e-36    
gb|KFY59517.1|  hypothetical protein V496_05652                         144   4e-36    
gb|KEY76113.1|  CaaX prenyl protease Ste24                              144   5e-36    
gb|EPS28736.1|  hypothetical protein PDE_03682                          144   6e-36    
gb|EDP50136.1|  CaaX prenyl protease Ste24                              144   6e-36    
ref|XP_752066.2|  CaaX prenyl protease Ste24                            144   6e-36    
dbj|GAM40464.1|  zinc metalloprotease                                   143   8e-36    
ref|XP_001949388.2|  PREDICTED: CAAX prenyl protease 1 homolog          143   8e-36    
ref|XP_002148969.1|  CaaX prenyl protease Ste24                         142   1e-35    
ref|XP_001214622.1|  hypothetical protein ATEG_05444                    142   1e-35    
ref|NP_001017255.1|  zinc metallopeptidase STE24                        142   2e-35    
ref|XP_011115562.1|  hypothetical protein H072_10056                    142   2e-35    
gb|EME39248.1|  hypothetical protein DOTSEDRAFT_75093                   142   2e-35    
ref|XP_006631345.1|  PREDICTED: CAAX prenyl protease 1 homolog          142   2e-35    
gb|KFX89268.1|  hypothetical protein V490_07139                         142   2e-35    
ref|XP_004082296.1|  PREDICTED: CAAX prenyl protease 1 homolog          142   3e-35    
gb|EEH10632.1|  CaaX prenyl protease                                    142   3e-35    
gb|EGC45621.1|  CaaX prenyl protease                                    142   3e-35    
emb|CBJ27157.1|  CaaX prenyl protease Ste24                             142   3e-35    
ref|XP_001271650.1|  CaaX prenyl protease Ste24                         142   3e-35    
gb|EER44696.1|  CaaX prenyl protease                                    141   4e-35    
gb|ELR10214.1|  STE24 endopeptidase                                     142   4e-35    
gb|KFZ20107.1|  hypothetical protein V502_03363                         141   4e-35    
gb|KFY04966.1|  hypothetical protein V491_09229                         143   4e-35    
ref|XP_003815473.1|  PREDICTED: CAAX prenyl protease 1 homolog          141   4e-35    
gb|KFY38041.1|  hypothetical protein V494_04536                         142   5e-35    
ref|XP_001267265.1|  CaaX prenyl protease Ste24                         141   5e-35    
ref|XP_002796885.1|  CAAX prenyl protease                               141   5e-35    
tpg|DAA01789.1|  TPA: CaaX prenyl protease                              141   5e-35    
ref|XP_003661486.1|  hypothetical protein MYCTH_2300946                 141   5e-35    
emb|CEJ80463.1|  hypothetical protein VHEMI00644                        141   5e-35    
ref|XP_010759714.1|  hypothetical protein PADG_04087                    141   5e-35    
emb|CAK04159.1|  novel protein (zgc:55655)                              141   5e-35    
ref|XP_009822213.1|  hypothetical protein H257_00958                    141   5e-35    
gb|AAX78522.1|  CaaX prenyl protease                                    141   6e-35    
gb|EMF09871.1|  CaaX prenyl protease                                    141   6e-35    
gb|KIW01377.1|  hypothetical protein PV09_07145                         141   6e-35    
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                      140   6e-35    
ref|XP_010877922.1|  PREDICTED: CAAX prenyl protease 1 homolog          141   6e-35    
ref|XP_001540370.1|  CaaX prenyl protease                               140   7e-35    
ref|XP_007754023.1|  STE24 endopeptidase                                140   8e-35    
emb|CDH48818.1|  prenyl protease                                        140   8e-35    
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                   140   8e-35    
gb|AFI71084.1|  putative CAAX prenyl protease                           134   9e-35    
gb|KIW82886.1|  hypothetical protein Z517_02129                         140   1e-34    
gb|KFZ02509.1|  hypothetical protein V501_09542                         142   1e-34    
gb|KFY09356.1|  hypothetical protein V492_05514                         142   1e-34    
ref|XP_010733223.1|  PREDICTED: CAAX prenyl protease 1 homolog          140   1e-34    
ref|XP_008724234.1|  hypothetical protein G647_10020                    140   1e-34    
emb|CEP19164.1|  hypothetical protein                                   140   1e-34    
gb|KFY76197.1|  hypothetical protein V499_04041                         141   2e-34    
ref|XP_010788908.1|  PREDICTED: CAAX prenyl protease 1 homolog          140   2e-34    
gb|AAI65348.1|  Zmpste24 protein                                        140   2e-34    
ref|NP_956186.1|  CAAX prenyl protease 1 homolog                        139   2e-34    
dbj|GAN04268.1|  metallopeptidase                                       139   2e-34    
ref|XP_002627156.1|  CaaX prenyl protease                               139   2e-34    
gb|KIW71892.1|  hypothetical protein PV04_00120                         139   2e-34    
gb|KIX97886.1|  hypothetical protein Z520_06664                         139   2e-34    
ref|XP_007584901.1|  putative prenyl protease protein                   139   2e-34    
ref|XP_007834407.1|  hypothetical protein PFICI_07635                   139   2e-34    
gb|AFI71082.1|  putative CAAX prenyl protease                           132   2e-34    
ref|XP_006008854.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   2e-34    
gb|KHJ35024.1|  putative peptidase family m48                           139   3e-34    
gb|EGD96703.1|  CaaX prenyl protease                                    139   3e-34    
ref|XP_002843395.1|  CAAX prenyl protease 1                             139   3e-34    
ref|XP_008283596.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   3e-34    
ref|XP_003453270.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   3e-34    
gb|EWG42807.1|  STE24 endopeptidase                                     139   3e-34    
ref|XP_006696845.1|  ribosomal protein L34-like protein                 140   3e-34    
ref|XP_006798596.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   3e-34    
ref|XP_004540520.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   4e-34    
ref|XP_005925764.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   4e-34    
ref|XP_009152612.1|  STE24 endopeptidase                                139   4e-34    
ref|XP_007244663.1|  PREDICTED: CAAX prenyl protease 1 homolog          139   4e-34    
ref|XP_002584079.1|  hypothetical protein UREG_04768                    139   4e-34    
gb|EGE06070.1|  CAAX prenyl protease                                    139   4e-34    
ref|XP_003236858.1|  CaaX prenyl protease                               139   4e-34    
gb|KFY87676.1|  hypothetical protein V500_06835                         140   5e-34    
ref|XP_002181639.1|  predicted protein                                  138   5e-34    
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                  138   5e-34    
ref|XP_007780353.1|  STE24 endopeptidase                                138   5e-34    
ref|XP_003023010.1|  hypothetical protein TRV_02831                     139   5e-34    
ref|XP_006681887.1|  hypothetical protein BATDEDRAFT_17759              138   6e-34    
ref|XP_001401563.1|  CAAX prenyl protease 1                             138   7e-34    
ref|NP_001133548.1|  CAAX prenyl protease 1 homolog                     138   7e-34    
gb|KIX06592.1|  hypothetical protein Z518_04568                         138   7e-34    
ref|XP_008861314.1|  hypothetical protein H310_00342                    138   7e-34    
gb|KFG61038.1|  CAAX metallo endopeptidase                              132   7e-34    
gb|ESS30154.1|  CAAX metallo endopeptidase                              132   7e-34    
ref|XP_008611054.1|  hypothetical protein SDRG_07015                    137   8e-34    
gb|EYE94778.1|  CaaX prenyl protease Ste24                              137   9e-34    
ref|XP_003850777.1|  CAAX prenyl protease 1                             137   9e-34    
ref|XP_009222333.1|  CAAX prenyl protease 1                             137   9e-34    
emb|CAG10466.1|  unnamed protein product                                138   9e-34    
gb|EMT68098.1|  CAAX prenyl protease 1                                  137   1e-33    
gb|KIW94481.1|  hypothetical protein Z519_04457                         137   1e-33    
ref|XP_007751798.1|  STE24 endopeptidase                                137   1e-33    
gb|EJT41596.1|  STE24-like protein                                      137   1e-33    
gb|EHN01607.1|  Ste24p                                                  137   1e-33    
ref|XP_008307531.1|  PREDICTED: CAAX prenyl protease 1 homolog          137   1e-33    
pdb|4IL3|A  Chain A, Crystal Structure Of S. Mikatae Ste24p             137   1e-33    
ref|XP_003709694.1|  CAAX prenyl protease 1                             137   1e-33    
gb|ENH68811.1|  CAAX prenyl protease 1                                  137   1e-33    
ref|XP_003962545.1|  PREDICTED: CAAX prenyl protease 1 homolog          137   1e-33    
gb|KIW26412.1|  hypothetical protein PV07_09509                         137   1e-33    
ref|XP_011415720.1|  PREDICTED: CAAX prenyl protease 1 homolog          137   1e-33    
gb|AJR68004.1|  Ste24p                                                  137   1e-33    
gb|KIV94338.1|  hypothetical protein PV10_02112                         137   1e-33    
gb|EXM07215.1|  STE24 endopeptidase                                     137   2e-33    
gb|EWZ02551.1|  STE24 endopeptidase                                     137   2e-33    
gb|EXL53967.1|  STE24 endopeptidase                                     137   2e-33    
ref|XP_005801358.1|  PREDICTED: CAAX prenyl protease 1 homolog          137   2e-33    
emb|CDQ71667.1|  unnamed protein product                                137   2e-33    
gb|EGU84979.1|  hypothetical protein FOXB_04560                         137   2e-33    
gb|EHN06284.1|  Ste24p                                                  137   2e-33    
gb|AJR63219.1|  Ste24p                                                  137   2e-33    
gb|EWG95205.1|  Ste24p                                                  137   2e-33    
gb|AJR60934.1|  Ste24p                                                  137   2e-33    
emb|CAY80831.1|  Ste24p                                                 137   2e-33    
ref|NP_012651.1|  Ste24p                                                137   2e-33    
gb|EDN63433.1|  zinc metalloprotease                                    137   2e-33    
gb|EDZ71132.1|  YJR117Wp-like protein                                   137   2e-33    
gb|AJR61585.1|  Ste24p                                                  137   2e-33    
gb|EDV12854.1|  CAAX prenyl protease 1                                  137   2e-33    
ref|XP_002842311.1|  hypothetical protein                               136   2e-33    
gb|AJR59949.1|  Ste24p                                                  137   2e-33    
gb|AJR63874.1|  Ste24p                                                  137   2e-33    
gb|AJR60606.1|  Ste24p                                                  137   2e-33    
ref|XP_007574196.1|  PREDICTED: CAAX prenyl protease 1 homolog          137   2e-33    
gb|KIL91310.1|  hypothetical protein FAVG1_04924                        137   2e-33    
ref|XP_460632.1|  DEHA2F06248p                                          136   2e-33    
ref|XP_001239931.1|  hypothetical protein CIMG_09552                    136   2e-33    
gb|ELQ35873.1|  CAAX prenyl protease 1                                  137   2e-33    
emb|CDH09260.1|  probable CAAX prenyl protease 1                        136   2e-33    
gb|AJR67380.1|  Ste24p                                                  136   2e-33    
emb|CCT67513.1|  probable zinc metallo-protease                         136   2e-33    
gb|EPE10297.1|  caax prenyl protease 1                                  136   2e-33    
emb|CDF87226.1|  BN860_01640g1_1                                        136   2e-33    
ref|XP_007787411.1|  hypothetical protein EPUS_00192                    136   2e-33    
emb|CDH15706.1|  probable CAAX prenyl protease 1                        136   2e-33    
gb|AJR62890.1|  Ste24p                                                  136   3e-33    
ref|XP_003067440.1|  CAAX prenyl protease, putative                     136   3e-33    
gb|EIE81350.1|  hypothetical protein RO3G_06055                         136   3e-33    
gb|KFA62896.1|  hypothetical protein S40285_02256                       136   3e-33    
dbj|GAA82676.1|  CaaX prenyl protease Ste24                             136   3e-33    
ref|XP_011324509.1|  hypothetical protein FGSG_12839                    136   3e-33    
emb|CCG83629.1|  CaaX prenyl protease Ste24                             136   3e-33    
ref|XP_453545.1|  hypothetical protein                                  136   3e-33    
gb|KEY67837.1|  hypothetical protein S7711_04975                        136   3e-33    
gb|KDO33073.1|  hypothetical protein SPRG_01888                         136   4e-33    
ref|XP_011104176.1|  ste24p                                             136   4e-33    
gb|KIN03786.1|  hypothetical protein OIDMADRAFT_158613                  136   4e-33    
ref|XP_002492040.1|  Highly conserved zinc metalloprotease              135   4e-33    
gb|KDB15160.1|  putative zinc metallo-protease                          136   4e-33    
ref|XP_009254473.1|  hypothetical protein FPSE_03079                    135   4e-33    
ref|XP_003172087.1|  CAAX prenyl protease 1                             135   4e-33    
ref|XP_007376706.1|  hypothetical protein SPAPADRAFT_62544              135   5e-33    
emb|CCD77520.1|  farnesylated-protein converting enzyme 1 (M48 fa...    135   5e-33    
gb|KID79414.1|  Peptidase M48                                           135   5e-33    
gb|KIV77520.1|  hypothetical protein PV11_09310                         136   5e-33    
gb|ABN11935.1|  zinc metalloproteinase-like protein                     130   5e-33    
ref|XP_003349500.1|  hypothetical protein SMAC_03088                    136   5e-33    
ref|XP_003050604.1|  predicted protein                                  138   5e-33    
ref|XP_009848380.1|  hypothetical protein NEUTE1DRAFT_120293            135   5e-33    
emb|CCC09083.1|  unnamed protein product                                135   5e-33    
gb|AJR71904.1|  Ste24p                                                  135   5e-33    
emb|CCE28602.1|  probable zinc metallo-protease                         135   5e-33    
ref|XP_961364.3|  CaaX prenyl protease Ste24                            135   5e-33    
ref|XP_008398126.1|  PREDICTED: CAAX prenyl protease 1 homolog          135   5e-33    
emb|CDO93753.1|  unnamed protein product                                135   6e-33    
ref|XP_002174544.2|  CAA Xprenyl protease                               135   6e-33    
ref|XP_011398178.1|  CAAX prenyl protease 1-like protein                135   6e-33    
ref|XP_001911737.1|  hypothetical protein                               135   6e-33    
ref|XP_003677696.1|  hypothetical protein NCAS_0H00350                  135   6e-33    
gb|KGB37699.1|  CAAX prenyl protease 1-like protein                     135   6e-33    
dbj|GAA95272.1|  hypothetical protein E5Q_01928                         135   7e-33    
gb|EFZ21267.1|  hypothetical protein SINV_07351                         135   7e-33    
ref|XP_007812372.1|  putative zinc metallo-protease                     135   9e-33    



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA PLRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  424



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR FEFQADAFAKKLGYA PLRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRTFEFQADAFAKKLGYAAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP+KKTD
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPEKKTD  424



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA PLRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKKT+
Sbjct  388  ENLSSMNTDPWYSAYHYSHPPLVERLAAIDESDKKTE  424



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA PLRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTD WYSAYHYSHPPLVERLAAIDE DKKT+
Sbjct  388  ENLSAMNTDHWYSAYHYSHPPLVERLAAIDESDKKTE  424



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/157 (94%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQCK DEEVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LLQQCKKDEEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY+L LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYSLALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKKAD  424



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL AIDE DKKTD
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLTAIDEIDKKTD  424



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSF+AVQILTFLQFGGYTLVRNS DLFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFVAVQILTFLQFGGYTLVRNSTDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKKED  424



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL AIDE DKKTD
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLTAIDEHDKKTD  424



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLI+FQHTV+PLQHLVSF LNLVSRAFEFQADAFAKKLGYA PLRAGL+KLQE
Sbjct  328  DTQPVLIGLILFQHTVMPLQHLVSFSLNLVSRAFEFQADAFAKKLGYATPLRAGLIKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE DKKTD
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEADKKTD  424



>gb|KDO86286.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=309

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF
Sbjct  153  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF  212

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  213  DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQE  272

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK
Sbjct  273  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  307



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK +EEVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLFQSFGF
Sbjct  268  LIQQCKKEEEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSGDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYAAALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKKED  424



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYATALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA++EPD+K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALEEPDRKKE  424



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGY   LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYGSALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKK D
Sbjct  388  ENLSSMNTDPWYSAYHYSHPPLVERLAAIDEADKKAD  424



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEEVVAV+AHELGHWKLNHTM+SFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNDEEVVAVIAHELGHWKLNHTMFSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLI+FQHTVIPLQHLVSF LNLVSRAFEFQADAFAKKLGY  PLRAGL+KLQE
Sbjct  328  DTQPVLIGLILFQHTVIPLQHLVSFLLNLVSRAFEFQADAFAKKLGYGAPLRAGLIKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTD WYSAYHYSHPPLVERLAAIDEPDKKTD
Sbjct  388  ENLSAMNTDHWYSAYHYSHPPLVERLAAIDEPDKKTD  424



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA++EPD+K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALEEPDRKKE  424



>gb|EPS68077.1| hypothetical protein M569_06696, partial [Genlisea aurea]
Length=177

 Score =   296 bits (759),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 3/160 (2%)
 Frame = -3

Query  811  VIQQCKNDEE-VVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFG  635
            +IQQCKNDEE VVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS+DLFQSFG
Sbjct  18   LIQQCKNDEEEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSRDLFQSFG  77

Query  634  FETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ  455
            F+TQPVLIGLIIFQHTVIPLQHLVSF LNLVSRAFEFQADAFAKKLGY  PLRAGL+KLQ
Sbjct  78   FDTQPVLIGLIIFQHTVIPLQHLVSFSLNLVSRAFEFQADAFAKKLGYGGPLRAGLIKLQ  137

Query  454  EENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP--DKKTD  341
            EENLSAMNTDPWYSAYHYSHPPLVERLAAID+   DKK +
Sbjct  138  EENLSAMNTDPWYSAYHYSHPPLVERLAAIDDDAHDKKRE  177



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
              CKNDEEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+T
Sbjct  249  SNCKNDEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDT  308

Query  625  QPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEEN  446
            QPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQEEN
Sbjct  309  QPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQEEN  368

Query  445  LSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            LSAMNTDPWYSAYHYSHPPLVERL AIDE DKKTD
Sbjct  369  LSAMNTDPWYSAYHYSHPPLVERLTAIDEHDKKTD  403



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  422



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF
Sbjct  307  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF  366

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  367  DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQE  426

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK
Sbjct  427  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  461



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS  LFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPV+IGLIIFQHT+IP+QH+VSF LNLVSR+FEFQADAFAKKLGY+  LRAGLVKLQE
Sbjct  328  DTQPVIIGLIIFQHTIIPIQHIVSFALNLVSRSFEFQADAFAKKLGYSSALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID+PDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDKPDKKAD  424



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS +LF+SFGF
Sbjct  280  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSNLFRSFGF  339

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LR  LVKLQE
Sbjct  340  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYTSSLRVALVKLQE  399

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK D
Sbjct  400  ENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKKAD  436



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LR GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRGGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKK D
Sbjct  388  ENLSSMNTDPWYSAYHYSHPPLVERLAAIDESDKKAD  424



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LR GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRGGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKK D
Sbjct  388  ENLSSMNTDPWYSAYHYSHPPLVERLAAIDESDKKAD  424



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID  DKK +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDAADKKEE  424



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LR+GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRSGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA++EP  K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALEEPGSKKE  424



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID  DKK +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDAADKKEE  424



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSFIAVQ+LTFLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFIAVQVLTFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP QHLVSFGLNLVSR+FEFQADAFAKKLG A PLRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPFQHLVSFGLNLVSRSFEFQADAFAKKLGLAKPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DE +KK +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDESNKKEE  424



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS  LFQSFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPV+IGLIIFQHT+IPLQHLVSF LNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQE
Sbjct  328  DTQPVIIGLIIFQHTIIPLQHLVSFALNLVSRSFEFQADAFAKKLGYASALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL AID+PDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLDAIDKPDKKAD  424



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N+EEVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCTNEEEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQP+LIGLIIFQHTVIPLQHLV+FGLNLVSR FEFQADAFAKKLGYA  LRAGL+KLQE
Sbjct  328  DTQPILIGLIIFQHTVIPLQHLVNFGLNLVSRTFEFQADAFAKKLGYAKALRAGLIKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAI+EPD K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIEEPDSKKE  424



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+ EVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCKNEVEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LR+GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRSGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A++EP  K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLTALEEPGSKKE  424



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 152/168 (90%), Gaps = 11/168 (7%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKL--  458
            +TQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKL  
Sbjct  328  DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQV  387

Query  457  ---------QEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
                     QEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK D
Sbjct  388  TELEFSPLFQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKED  435



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS  LFQSFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPV+IGLIIFQHT+IPLQHLV+F LNLVSR+FEFQADAFAK+LGYA  LRAGLVKLQE
Sbjct  328  DTQPVIIGLIIFQHTIIPLQHLVNFALNLVSRSFEFQADAFAKRLGYASALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL AID+PDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLDAIDKPDKKAD  424



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSFIA+QILTFLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFIAIQILTFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            ++QP+LIGLIIFQHTVIPLQHLV+FGLNLVSRAFEFQADAFAKKLGYA  LRAGL+KLQE
Sbjct  328  DSQPILIGLIIFQHTVIPLQHLVNFGLNLVSRAFEFQADAFAKKLGYAKALRAGLIKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL+AI+E D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLSAIEEADSKKE  424



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHT+YSFIAVQILTFLQFGGYTLVRNS  LFQSFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTLYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPV+IGLIIFQHT+IP+QH+VSF LNLVSR+FEFQADAFAKKLGY+  LRAGLVKLQE
Sbjct  328  DTQPVIIGLIIFQHTIIPIQHIVSFALNLVSRSFEFQADAFAKKLGYSSALRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID+P KK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDKPXKKAD  424



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILT +QFGGYTLVRNS  LFQSFGF
Sbjct  270  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTLMQFGGYTLVRNSSSLFQSFGF  329

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPV+IGLIIFQHT+IP+QHLVSF LNLVSRAFEFQADAFAK LGYA  LRAGLV+LQE
Sbjct  330  DTQPVIIGLIIFQHTIIPVQHLVSFALNLVSRAFEFQADAFAKALGYAASLRAGLVRLQE  389

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  KKTD
Sbjct  390  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEETKKTD  426



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIA+QILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIALQILTLLQFGGYTLVRNSSDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSF LNLVSR+FEFQADAFA+KLGY+ PLRAGLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFALNLVSRSFEFQADAFAQKLGYSAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDLADKKEE  424



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIA+QILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAIQILTLLQFGGYTLVRNSSDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             TQPVLIGLI+FQHTVIPLQHLVSF LNLVSR+FEFQADAFA+KLGY+ PLRAGLVKLQE
Sbjct  328  NTQPVLIGLILFQHTVIPLQHLVSFALNLVSRSFEFQADAFAQKLGYSAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDLADKKEE  424



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIA+QILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAIQILTLLQFGGYTLVRNSSDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             TQPVLIGLI+FQHTVIPLQHLVSF LNLVSR+FEFQADAFA+KLGY+ PLRAGLVKLQE
Sbjct  328  NTQPVLIGLILFQHTVIPLQHLVSFALNLVSRSFEFQADAFAQKLGYSAPLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDLADKKEE  424



>gb|ADE76166.1| unknown [Picea sitchensis]
Length=228

 Score =   288 bits (738),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+EEVVAV+AHELGHWKLNHTMYSF+A+Q+LT LQFGGYTLVRNSKDLF+SFGF
Sbjct  72   LIQQCKNEEEVVAVIAHELGHWKLNHTMYSFVAMQVLTLLQFGGYTLVRNSKDLFESFGF  131

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVL+GL+IFQHT++P+ HLVSF LNLVSRAFEFQAD FAK LGY  PLRAGL+KLQE
Sbjct  132  QTQPVLVGLLIFQHTIMPIHHLVSFALNLVSRAFEFQADGFAKNLGYGAPLRAGLIKLQE  191

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLS MNTDPWYSAYHYSHPPLVERLAA+D  DKK +
Sbjct  192  ENLSTMNTDPWYSAYHYSHPPLVERLAALDRSDKKEE  228



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN +E+VAV+ HELGHWKLNHT+YSFIAVQI+TFLQFGGYTLVRNSKDLF SFGF
Sbjct  268  LIQQCKNVDEIVAVIGHELGHWKLNHTLYSFIAVQIITFLQFGGYTLVRNSKDLFLSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGY+ PLRA L+KLQE
Sbjct  328  KTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYSTPLRAALIKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDTADKK  422



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   295 bits (754),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +T+PVLIGLI+FQHTVIPLQ LVSFGLNLVSR+FEFQADAFAKKLGYA  LR+GLVKLQE
Sbjct  328  DTEPVLIGLILFQHTVIPLQQLVSFGLNLVSRSFEFQADAFAKKLGYASELRSGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLA +DEPDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAVLDEPDKKND  424



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK  EEVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  256  LIQQCKT-EEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSDLFKSFGF  314

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSF LNLVSR+FEFQADAFAKKLGYA  LR+GLVKLQE
Sbjct  315  DTQPVLIGLIIFQHTVIPLQHLVSFALNLVSRSFEFQADAFAKKLGYASELRSGLVKLQE  374

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID+ DKK D
Sbjct  375  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDKSDKKED  411



>gb|AFK35300.1| unknown [Lotus japonicus]
Length=229

 Score =   286 bits (733),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK DEE+VAV+AHELGHWKLNHT+Y+F+A+QILT LQFGG+TLVRNS DLFQSFGF
Sbjct  73   LIQQCKKDEEIVAVIAHELGHWKLNHTVYTFVAMQILTLLQFGGFTLVRNSTDLFQSFGF  132

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLI+FQHTVIPLQ LVSFGLNLVSR+FEFQADAFAK LGYA  LR GLV+LQE
Sbjct  133  DTQPVLIGLILFQHTVIPLQQLVSFGLNLVSRSFEFQADAFAKNLGYAAELRLGLVRLQE  192

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL AID+ DKK D
Sbjct  193  ENLSAMNTDPWYSAYHYSHPPLVERLEAIDKSDKKAD  229



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 1/157 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK  EEVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKT-EEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSDLFKSFGF  326

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSF LNLVSR+FEFQADAFAKKLGYA  LR+GLVKLQE
Sbjct  327  DTQPVLIGLIIFQHTVIPLQHLVSFALNLVSRSFEFQADAFAKKLGYASELRSGLVKLQE  386

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID+ DKK D
Sbjct  387  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDKSDKKED  423



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 151/159 (95%), Gaps = 2/159 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQCKNDEE+VAV+AHELGHWKLNHT+Y+FIA+QILT LQFGGYTLVRNS DLFQSFGF
Sbjct  274  LVQQCKNDEEIVAVIAHELGHWKLNHTLYTFIAMQILTLLQFGGYTLVRNSTDLFQSFGF  333

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP+Q LVSFGLNLVSR+FEFQAD FAKKLGY+  LRAGLVKLQE
Sbjct  334  DTQPVLIGLIIFQHTVIPVQQLVSFGLNLVSRSFEFQADGFAKKLGYSSALRAGLVKLQE  393

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK--KTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDK  K+D
Sbjct  394  ENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKLDKSD  432



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DL++SFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSTDLYRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKKED  424



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   292 bits (748),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 1/158 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKND+EVVAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCKNDKEVVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFESFGF  327

Query  631  E-TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ  455
              TQPVLIGLIIFQHTVIPLQHLV+F LNLVSR+FEFQADAFAK LGYA  L+ GLVKLQ
Sbjct  328  HGTQPVLIGLIIFQHTVIPLQHLVNFALNLVSRSFEFQADAFAKNLGYASELKCGLVKLQ  387

Query  454  EENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            EENLSAMNTDPWYSAYHYSHPPLVERLAA+DE DKK D
Sbjct  388  EENLSAMNTDPWYSAYHYSHPPLVERLAALDETDKKQD  425



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DL++SFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSTDLYRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+D+PDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDKPDKKED  424



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DL++SFGF
Sbjct  268  LIQQCKDDEEIVAVIAHELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSADLYRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLA +DEPDKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAVLDEPDKKED  424



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQCKNDEE+VAV+AHELGHWKLNHT+Y+FIA+QILT LQFGGYTLVRNS DLFQSFGF
Sbjct  268  LVQQCKNDEEIVAVIAHELGHWKLNHTVYTFIAMQILTLLQFGGYTLVRNSTDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLI+FQHTVIPLQ LVSFGLNLVSR+FEFQAD FAKKLGY+  LRAGLVKLQE
Sbjct  328  DTQPVLIGLILFQHTVIPLQQLVSFGLNLVSRSFEFQADGFAKKLGYSSSLRAGLVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            ENLSAMNTDPWYSAYHYSHPPLVERLAA+D PDK
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAALDIPDK  421



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKND+E+VAV+AHELGHWKLNHTMYSFIA+QIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDDEIVAVIAHELGHWKLNHTMYSFIAMQILAFLQFGGYTLVRNSSDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFA KLGY+  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAVKLGYSQDLRNALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            ENLSAMNTDPWYSAYHYSHPPLVERL AID  DKKT
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLEAIDGEDKKT  423



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  424



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  424



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  424



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  424



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKTD  424



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFSSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  424



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKTD  424



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YS YHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSTYHYSHPPLVERLRAIDGEDKKTD  424



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  +KKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGDEKKTD  424



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP +SAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLHSAYHYSHPPLVERLRAIDGEDKKTD  424



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +I QCKN++E+VAV+AHELGHWKLNHT YSFIAVQILT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIHQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKTD  424



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN+ E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNENEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKTD  424



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL F QFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFCQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGLDKKTD  424



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQCKND E+VAV+AHELGHWKLNHTMYSF+AVQ+L FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LVQQCKNDNEIVAVIAHELGHWKLNHTMYSFVAVQVLAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP+Q LVSF LNLVSR+FEFQADAFA KL YA  LRA LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPVQRLVSFCLNLVSRSFEFQADAFAVKLDYAKDLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAID  D KTD
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDGLDPKTD  424



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  338  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  397

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQE
Sbjct  398  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQE  457

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  458  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKTD  494



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC+N+ E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCQNENEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  424



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC+N+ E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCQNENEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQE
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  388  ENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKTD  424



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N++E+V+V+AHELGHWKL+HT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCSNEDEIVSVIAHELGHWKLSHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QPV+IGLIIFQHT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  EDQPVIIGLIIFQHTIIPVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL+A+++PD K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLSALEDPDSKKE  424



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N++E+V+V+AHELGHWKLNHT+YSFIAVQ+L FLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCSNEDEIVSVIAHELGHWKLNHTVYSFIAVQLLMFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QP++IGLIIFQHT+IPLQHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  EDQPIIIGLIIFQHTIIPLQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSKKE  424



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC ND E+V+VLAHELGHWKLNHT YSF+AVQ+LTF+QFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCSNDNEIVSVLAHELGHWKLNHTAYSFVAVQLLTFMQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QPV+IGLIIF HT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LR  LVKLQE
Sbjct  328  EDQPVIIGLIIFMHTIIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPELRGALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLSALEDLDSKKE  424



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +I QCKN+EEVVAV+AHELGHWKL+HTMYSF+A+Q+LT LQFGGYTLVRNS  LF SFGF
Sbjct  272  LISQCKNEEEVVAVIAHELGHWKLSHTMYSFLAMQVLTLLQFGGYTLVRNSSGLFLSFGF  331

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             TQPVLIGLI+FQHT++P  HLVSF LNL+SRAFEFQADAFA+ LGY  PLRAGL+KLQE
Sbjct  332  STQPVLIGLILFQHTIMPFHHLVSFALNLLSRAFEFQADAFARSLGYREPLRAGLIKLQE  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYH+SHPPLVERL A+DE  KKTD
Sbjct  392  ENLSAMNTDPWYSAYHHSHPPLVERLQALDETSKKTD  428



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N++E+V+V+AHELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCSNEDEIVSVIAHELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QP++IGLIIFQHT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  EDQPIIIGLIIFQHTIIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSKKE  424



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC +++E+V+V+AHELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCSSEDEIVSVIAHELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QPV+IGLIIFQHT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  EDQPVIIGLIIFQHTIIPVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLSALEDADSKKE  424



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC +++E+V+V+AHELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCSSEDEIVSVIAHELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QPV+IGLIIFQHT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  EDQPVIIGLIIFQHTIIPVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLSALEDADSKKE  424



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +I QCKN+EEVVAV+AHELGHWKL+HTMYSF+A+Q+LT LQFGGYTLVRNS DLF SFGF
Sbjct  272  LISQCKNEEEVVAVIAHELGHWKLSHTMYSFLAMQVLTLLQFGGYTLVRNSTDLFLSFGF  331

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             TQPVLIGLI+FQHT++P  HLVSF LNLVSRAFEFQADAFA+ LGY   LRAGL+KLQE
Sbjct  332  TTQPVLIGLILFQHTIMPFHHLVSFALNLVSRAFEFQADAFARSLGYKDSLRAGLIKLQE  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A+DE  KK +
Sbjct  392  ENLSAMNTDPWYSAYHYSHPPLVERLQALDEASKKEE  428



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N+ E+V+VLAHELGHWKLNHT YSF+AVQ+LTFLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCTNENEIVSVLAHELGHWKLNHTAYSFVAVQLLTFLQFGGYTLVRNSKDLFESFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E Q V+IGLIIF HT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  EDQSVIIGLIIFMHTIIPVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPELRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            ENLSAMNTDPWYSAYHYSHPPLVERL+AI++ D K
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLSAIEDLDSK  422



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N++E+V+V+AHELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVR+SKDLF SFGF
Sbjct  268  LIQQCSNEDEIVSVIAHELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRSSKDLFGSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            + QPV+IGLIIFQHT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  328  KDQPVIIGLIIFQHTIIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSKKE  424



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 145/185 (78%), Gaps = 28/185 (15%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  275  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  334

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVK---  461
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVK   
Sbjct  335  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQV  394

Query  460  -------------------------LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  356
                                     LQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  395  REDNNRTQTVTSICVTHLNGFFVGILQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  454

Query  355  DKKTD  341
            DKKTD
Sbjct  455  DKKTD  459



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAVLAHELGHWKLNH++Y FI+ QI T L FGGY L+RNS  LFQSFGF
Sbjct  268  LIQQCKNDEEIVAVLAHELGHWKLNHSVYLFISRQIRTLLHFGGYALLRNSSSLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPV+IGLIIFQ+T+ P+Q+LV+F  NLVSRAFEFQADAFAKKLGYA  LRA LV+LQE
Sbjct  328  DTQPVIIGLIIFQYTITPIQYLVNFARNLVSRAFEFQADAFAKKLGYASSLRASLVRLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLAAI E DKK D
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLAAIGETDKKAD  424



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N++E+V+V+AHELGHWKLNH +YSF+AVQ+L FLQFGGYTLVRNSKDLFQSFGF
Sbjct  268  LIQQCTNEDEIVSVIAHELGHWKLNHIVYSFVAVQLLMFLQFGGYTLVRNSKDLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QP++ GLIIFQHT IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKL E
Sbjct  328  EDQPIITGLIIFQHTRIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLHE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  388  ENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDAKKN  424



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC N++E+V+V+AHELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVR+SKDLF SFGF
Sbjct  471  LIQQCSNEDEIVSVIAHELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRSSKDLFGSFGF  530

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            + QPV+IGLIIFQHT+IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQE
Sbjct  531  KDQPVIIGLIIFQHTIIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQE  590

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  591  ENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSKKE  627



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 143/188 (76%), Gaps = 31/188 (16%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC+N+ E+VAV+AHELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCQNENEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVK---  461
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVK   
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQV  387

Query  460  ----------------------------LQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
                                        LQEENLSAMNTDP YSAYHYSHPPLVERL AI
Sbjct  388  RETAEIKTQTVYTRVVPCHNGCCFCCGFLQEENLSAMNTDPLYSAYHYSHPPLVERLRAI  447

Query  364  DEPDKKTD  341
            D  DKKTD
Sbjct  448  DGEDKKTD  455



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQCK D+EV+A+LAHE+GHWKLNHTMY FIAVQIL+FLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LLQQCK-DDEVLAILAHEMGHWKLNHTMYFFIAVQILSFLQFGGYTLVRNSSDLFRSFGF  326

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVL+GLII+Q+ +IP+QHL+  GLN VSR+FE+QADAF+KKLGY  PLR+GLVKLQ 
Sbjct  327  DTQPVLVGLIIYQYIMIPVQHLLFLGLNRVSRSFEYQADAFSKKLGYCSPLRSGLVKLQV  386

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENL AMNTDPW+SAYH+SHP LVERLA ++EPDKK D
Sbjct  387  ENLEAMNTDPWFSAYHHSHPCLVERLAELNEPDKKED  423



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 12/169 (7%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTL------------V  668
            +IQQC N++E+V+V+AHELGHWKLNH +YSF+AVQ+L FLQFGGYTL            V
Sbjct  256  LIQQCTNEDEIVSVIAHELGHWKLNHIVYSFVAVQLLMFLQFGGYTLLLMFLQFGGYTLV  315

Query  667  RNSKDLFQSFGFETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  488
            RNSKDLFQSFGFE QP++ GLIIFQHT IP+QHL+SF LNLVSRAFEFQADAFAK LGYA
Sbjct  316  RNSKDLFQSFGFEDQPIITGLIIFQHTRIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYA  375

Query  487  LPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
              LRA LVKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  376  PQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDAKKN  424



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 12/169 (7%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTL------------V  668
            +IQQC N++E+V+V+AHELGHWKLNH +YSF+AVQ+L FLQFGGYTL            V
Sbjct  268  LIQQCTNEDEIVSVIAHELGHWKLNHIVYSFVAVQLLMFLQFGGYTLLLMFLQFGGYTLV  327

Query  667  RNSKDLFQSFGFETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  488
            RNSKDLFQSFGFE QP++ GLIIFQHT IP+QHL+SF LNLVSRAFEFQADAFAK LGYA
Sbjct  328  RNSKDLFQSFGFEDQPIITGLIIFQHTRIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYA  387

Query  487  LPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
              LRA LVKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  388  PQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDAKKN  436



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQC N++EVVAV+AHELGHWKLNHT YSFIA Q LT LQ  GYT VRNSKDLF SFGF
Sbjct  268  LVQQCTNEDEVVAVIAHELGHWKLNHTTYSFIAGQFLTLLQCVGYTFVRNSKDLFHSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             TQPVLIGL +FQHT+ PL H+  F +NLVSRAFEFQAD FA +LGYALPLR GL+KLQE
Sbjct  328  TTQPVLIGLQLFQHTLTPLLHVAGFVMNLVSRAFEFQADNFAGELGYALPLRGGLIKLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYS YHYSHPPLVERLAA+D+  KKT+
Sbjct  388  ENLSAMNTDPWYSTYHYSHPPLVERLAALDKFQKKTE  424



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC  D EVV+VLAHELGHWKLNHT YSF+AVQ+LTFLQFGGYTLVRNSKDLF+SFGF
Sbjct  268  LIQQCI-DNEVVSVLAHELGHWKLNHTTYSFVAVQLLTFLQFGGYTLVRNSKDLFESFGF  326

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            + QPV+IGLIIF HT+IP+QH++SF LNLVSRAFEFQADAFAK LGYA  LR  LVKLQE
Sbjct  327  DDQPVIIGLIIFMHTIIPVQHVLSFCLNLVSRAFEFQADAFAKNLGYAPELRGALVKLQE  386

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            EN  AMNTDP YSAYH+SHPPLVE   A+++ D K +
Sbjct  387  ENSFAMNTDPGYSAYHFSHPPLVEGFFALEDLDTKKE  423



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC+ND+E+VAV+AHELGHWK NH +YS IA QI   L  GGYTLVR+   LFQSFGF
Sbjct  268  LIQQCENDDEIVAVIAHELGHWKRNHIVYSLIANQICALLYIGGYTLVRHWSSLFQSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             T+P++I LIIFQ+ + P+Q+LV F  NLVSRAFE+QADAFAKKLGYA  +RA LV+LQE
Sbjct  328  HTRPLIIALIIFQYAITPIQNLVYFAGNLVSRAFEYQADAFAKKLGYASSIRASLVRLQE  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            ENL+AMN DPWYSAYHY+HP LVERLAAI + DK+
Sbjct  388  ENLAAMNIDPWYSAYHYTHPTLVERLAAIGKMDKE  422



>gb|KJB41393.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=391

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIPLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKLQ+
Sbjct  328  DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQK  387



>gb|KDO86287.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=399

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +TQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQ 
Sbjct  328  DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQV  387

Query  451  EN  446
             N
Sbjct  388  IN  389



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 120/157 (76%), Gaps = 24/157 (15%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC ND E+V+VLAHELGHWKLNHT YSF+AVQ+LTF+QFGGYTLVRNSKDLF+SFGF
Sbjct  222  LIQQCSNDNEIVSVLAHELGHWKLNHTAYSFVAVQVLTFMQFGGYTLVRNSKDLFESFGF  281

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            E QPV+IGLII                        F ADAFAK LGYA  LR  LVKLQE
Sbjct  282  EDQPVIIGLII------------------------FMADAFAKNLGYAPELRGALVKLQE  317

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K D
Sbjct  318  ENLSAMNTDPWYSAYHYSHPPLVERLSALEDLDSKKD  354



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 112/157 (71%), Gaps = 38/157 (24%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCK+DEE+VAV+AHELGHWKLNHT+Y+F+A+Q                         
Sbjct  257  LIQQCKDDEEIVAVIAHELGHWKLNHTVYTFVAMQ-------------------------  291

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
                         HTVIPLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQE
Sbjct  292  -------------HTVIPLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQE  338

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENLSAMNTDPWYSAYHYSHPPLVERLA +DEPDKK D
Sbjct  339  ENLSAMNTDPWYSAYHYSHPPLVERLAVLDEPDKKED  375



>gb|AAB61028.1| A_IG002N01.21 gene product [Arabidopsis thaliana]
Length=316

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 109/167 (65%), Gaps = 48/167 (29%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKN++E+VAV+AHELGHWKLNHT YSFIAVQ                         
Sbjct  188  LIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQ-------------------------  222

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ-  455
                         HTVIPLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQ 
Sbjct  223  -------------HTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQV  269

Query  454  ---------EENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
                     EENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  270  REDNNRTQTEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  316



>gb|KDO86288.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=367

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQCKNDEE+VAV+AHELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF
Sbjct  268  LIQQCKNDEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF  327

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQA  518
            +TQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQ 
Sbjct  328  DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQV  365



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            ++QQ KNDEEV+AV+AHELGHWKLNH +  ++A+Q +  L  GG+TL RNS DLFQSFGF
Sbjct  280  IVQQDKNDEEVLAVIAHELGHWKLNHFVPLYVAMQFVPLLNGGGFTLARNSTDLFQSFGF  339

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             +QPV+IGLII+     PL ++V FG N + R+ EFQADAFA KLGY   LR+ LVK Q 
Sbjct  340  HSQPVIIGLIIYLLIAAPLNYIVMFGRNHLFRSIEFQADAFAVKLGYKSALRSVLVKKQM  399

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            ENL   N DPWY AY    PP V RL A+DE DKK D
Sbjct  400  ENLMEFNADPWYYAYRVIQPPAVLRLTAMDELDKKAD  436



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 111/165 (67%), Gaps = 10/165 (6%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +IQQC ++E+VVAVLAHELGHWKL HT   FI  Q++   QF  YTLVRNS  L  +FGF
Sbjct  296  LIQQC-SEEQVVAVLAHELGHWKLFHTPQLFIVNQVVLVSQFCLYTLVRNSTALPAAFGF  354

Query  631  ET---------QPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPL  479
             +          P  I LI+FQ  V PL  ++ +  N+VSR FEFQADAFA   G+   L
Sbjct  355  GSGEAVGASGLAPAFISLILFQFIVSPLDEVIHYASNVVSRRFEFQADAFAVHTGHGTEL  414

Query  478  RAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            R+ L+K++EEN  AM+ DPWYS+YHYSHPPLV+RL AID   KK 
Sbjct  415  RSALLKMEEENKGAMHVDPWYSSYHYSHPPLVDRLKAIDSAVKKA  459



>gb|ESA09906.1| hypothetical protein GLOINDRAFT_80760 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73371.1| Ste24p [Rhizophagus irregularis DAOM 197198w]
Length=430

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +I+Q  N+ E+VA++ HELGHW LNHT+   I  QI  F  F  ++   N+  L++SFGF
Sbjct  279  LIEQA-NNGEIVAIVGHELGHWYLNHTVKILIISQIHNFFLFFVFSQFINNTSLYRSFGF  337

Query  631  ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            ETQP+LIG ++FQ    P++++V+F +N++SR  EF+ADA+AKKLGY + LR+GL+K+Q 
Sbjct  338  ETQPILIGFMLFQFIYAPVENVVAFLMNILSRKHEFEADAYAKKLGYGVQLRSGLIKIQI  397

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  353
            +NL  +N DPWYSAYH+SHPPL ERL+AI++ D
Sbjct  398  KNLGNLNNDPWYSAYHFSHPPLPERLSAIEKID  430



>emb|CCI48758.1| unnamed protein product [Albugo candida]
Length=493

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 4/158 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  N EE+VA+L HELGHWKL HT  S I  Q+ TF     + L  N  DLF SFGF
Sbjct  335  LLEQASN-EEIVAILGHELGHWKLWHTGQSLIFQQVYTFACLYLFGLCMNDADLFASFGF  393

Query  631  --ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVK  461
              +++PV+IG ++F  T+  P+ HL+SF L L +R  EFQADAFA  LG+A  L+ GL K
Sbjct  394  AVKSKPVMIGFLLFTQTLWAPVNHLLSFMLTLNTRKNEFQADAFATDLGHAKALQTGLTK  453

Query  460  LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +  ENLS MN D WYSAYHY HPPL+ERL+AI + ++K
Sbjct  454  ISIENLSNMNPDKWYSAYHYDHPPLLERLSAIKQRERK  491



>emb|CCA18761.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
 emb|CCA25203.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
Length=493

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  N EE+VA+L HELGHWKL HT  S I  Q+ TF     + L  N  DLF +FGF
Sbjct  335  LLEQASN-EEIVAILGHELGHWKLWHTGQSLIFQQVYTFACLYLFGLCMNDADLFANFGF  393

Query  631  ETQ--PVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVK  461
             T+  PV+IG ++F  T+  P+ H++SF L L +R  EFQADAFA  LG+A  L+ GL K
Sbjct  394  ATKSKPVMIGFLLFTQTLWAPVNHVLSFMLTLNTRKNEFQADAFATDLGHAKALQTGLTK  453

Query  460  LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +  ENLS MN D WYSAYHY HPPL+ERL+AI + + K
Sbjct  454  ISTENLSNMNPDKWYSAYHYDHPPLLERLSAIKQRESK  491



>ref|XP_009501173.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Phalacrocorax 
carbo]
Length=157

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  QI +FL F  + ++   K+LF +FGF +
Sbjct  4    QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQINSFLCFFLFAVLIGRKELFAAFGFYD  62

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  63   TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRQFEFQADAFAKELGKAKDLYSALIKLNK  122

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  123  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  157



>ref|XP_008935450.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Merops nubicus]
Length=157

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  4    QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  62

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L   L+KL +
Sbjct  63   TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYTALIKLNK  122

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  123  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  157



>ref|XP_010116516.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Chlamydotis 
macqueenii]
Length=157

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  4    QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFSAFGFYD  62

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  63   TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  122

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  123  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  157



>ref|XP_009949557.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Leptosomus 
discolor]
 ref|XP_010309942.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Balearica 
regulorum gibbericeps]
Length=157

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  4    QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  62

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  63   TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  122

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  123  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  157



>ref|XP_010158796.1| PREDICTED: CAAX prenyl protease 1 homolog [Eurypyga helias]
Length=219

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  66   QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  124

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  125  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  184

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  185  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  219



>gb|EMP29923.1| CAAX prenyl protease 1 like protein [Chelonia mydas]
Length=265

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  112  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYE  170

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  171  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  230

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  231  DNLGFPVSDWIFSMWHYSHPPLLERLQAL--KDAKQD  265



>ref|XP_009059971.1| hypothetical protein LOTGIDRAFT_209825 [Lottia gigantea]
 gb|ESO88920.1| hypothetical protein LOTGIDRAFT_209825 [Lottia gigantea]
Length=467

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = -3

Query  793  NDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVL  614
            N+EEV+AVL+HELGHWKLNH + + +  QI TFL F  + L+ N K+LF +FGF TQP L
Sbjct  319  NNEEVLAVLSHELGHWKLNHNLKNLVIGQINTFLCFMMFALLMNRKELFTAFGFTTQPTL  378

Query  613  IG-LIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSA  437
            IG LIIFQ    P   ++SF +  +SR FEFQAD FAK L  A  L++ L+KL ++NL  
Sbjct  379  IGLLIIFQFIFSPYNEVLSFCMTALSRKFEFQADDFAKTLHRANKLKSALIKLNKDNLGF  438

Query  436  MNTDPWYSAYHYSHPPLVERLAAID  362
              +D  YS +H+SHPPL+ERL A++
Sbjct  439  PISDWLYSTWHFSHPPLIERLNALE  463



>ref|XP_004348317.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93739.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
Length=519

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = -3

Query  784  EVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIG  608
            E++AVLAHELGHWKLNHT+ +F+  Q + F+ F  ++L  + + L+ SFGF +++PV IG
Sbjct  373  EILAVLAHELGHWKLNHTLKNFVFSQFMNFVSFALFSLFVSYQPLYTSFGFPDSRPVFIG  432

Query  607  L-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMN  431
            + ++FQ    P+  ++ F + ++SR +EFQADAFA KLG+   LR  LVKLQ+ NLS M+
Sbjct  433  MFLVFQFVFQPMNTVLQFLMTVLSRRYEFQADAFAAKLGHGGHLRTALVKLQKNNLSDMD  492

Query  430  TDPWYSAYHYSHPPLVERLAAI  365
             DP YS YHYSHPPLVERL AI
Sbjct  493  PDPLYSMYHYSHPPLVERLNAI  514



>dbj|BAG51388.1| unnamed protein product [Homo sapiens]
Length=235

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  82   QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  140

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  141  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  200

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  201  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  229



>gb|AFW68434.1| hypothetical protein ZEAMMB73_431227 [Zea mays]
Length=247

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = -3

Query  739  NHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVIPLQHLVS  560
            N TM +F+AVQ+L  LQFGGYTLVRNSK LF+SFGFE QP++IGLIIFQHT+IP+QHL+S
Sbjct  5    NQTM-TFVAVQLLMILQFGGYTLVRNSKVLFESFGFEDQPIIIGLIIFQHTIIPIQHLLS  63

Query  559  FGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ  455
            F LNLVS+AFEFQADAFAK LGYA  LRA LVKLQ
Sbjct  64   FCLNLVSKAFEFQADAFAKNLGYAPQLRAALVKLQ  98



>ref|XP_002900396.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
 gb|EEY60189.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
Length=485

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VAVL HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  326  LLEQATHDE-IVAVLGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  384

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                 +PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+A+ L++GL 
Sbjct  385  AGDSAKPVIIGFLLFSQTMWAPVEHVLSFLMTLNTRKNEFQADAFAVDLGHAVALKSGLT  444

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  445  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  484



>gb|ETE70091.1| CAAX prenyl protease 1-like protein [Ophiophagus hannah]
Length=409

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  256  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYE  314

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  315  TQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  374

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ E
Sbjct  375  DNLGFPVSDWLFSMWHYSHPPLLERLQALKE  405



>gb|ELU11443.1| hypothetical protein CAPTEDRAFT_171238 [Capitella teleta]
Length=459

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = -3

Query  793  NDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVL  614
            N+ E++AVL HELGHWKL+H + + +  Q  TF  F  + L+ N  +L+++FGF +QP L
Sbjct  312  NNNEILAVLGHELGHWKLSHNLKNLVIGQFNTFFCFMVFGLLMNRSELYEAFGFTSQPTL  371

Query  613  IGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSA  437
            IGL IIFQ    P   L+SF + ++SR FEF+AD FAK LG A PLR+ LVKL ++NL  
Sbjct  372  IGLLIIFQFIFSPYNELLSFCMTVLSRKFEFEADRFAKSLGRAAPLRSALVKLNKDNLGF  431

Query  436  MNTDPWYSAYHYSHPPLVERLAAIDEPD  353
              +D  YS +HYSHPPL+ER+ A+++ +
Sbjct  432  PISDWLYSTWHYSHPPLIERMKALEKEE  459



>ref|XP_005428744.1| PREDICTED: CAAX prenyl protease 1 homolog [Geospiza fortis]
Length=409

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  256  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  314

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  315  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  374

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +P ++
Sbjct  375  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDPKQE  409



>ref|XP_010624212.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Fukomys 
damarensis]
Length=424

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  271  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFSLFAVLIRRKELFAAFGFYD  329

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  330  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  389

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+  P +
Sbjct  390  DNLGFPVSDWLFSMWHYSHPPLLERLQALKNPKQ  423



>ref|XP_005100140.1| PREDICTED: CAAX prenyl protease 1 homolog [Aplysia californica]
Length=490

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = -3

Query  793  NDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVL  614
            N+EEV+AVL HELGHW  +H +   I  QI  FL FG + ++   K LF +FGF+ QP +
Sbjct  338  NNEEVLAVLCHELGHWYHSHVLKQLIISQINMFLCFGIFAVLMKEKVLFAAFGFDVQPTM  397

Query  613  IGLII-FQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSA  437
            IGLII FQ  + P   ++SF L  ++R  EFQADAFA  +G++  LR+ L+KL E+NLS 
Sbjct  398  IGLIIIFQFILAPYNEVLSFVLTYMTRKCEFQADAFAAGMGWSDTLRSALIKLNEDNLSF  457

Query  436  MNTDPWYSAYHYSHPPLVERLAAI-DEPDKKT  344
              +D  YSA+H+SHPPL++RL A+ D+PDKKT
Sbjct  458  PLSDWLYSAWHFSHPPLLDRLRALHDQPDKKT  489



>gb|KFP73521.1| CAAX prenyl protease 1, partial [Apaloderma vittatum]
Length=258

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  105  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  163

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  164  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  223

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ +
Sbjct  224  DNLGFPVSDWIFSMWHYSHPPLLERLQALKD  254



>ref|XP_005651455.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26911.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
Length=437

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +I+QC  D+ VVAVLAHELGHWKL HT+ + I  Q+     F  ++LV+ S  LF SFGF
Sbjct  281  LIEQCSEDQ-VVAVLAHELGHWKLGHTLKNLILTQMQMLCTFALFSLVKESTGLFTSFGF  339

Query  631  -ETQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ  455
               QP  I   +F     P+  +V    N++SR FEFQADAFA  LG A  L+  L  L 
Sbjct  340  VNQQPAFIAYTLFSIISAPVNEVVGLLSNILSRRFEFQADAFAVSLGKAEELKQALKILD  399

Query  454  EENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
             +N SA+N DP YSAYH+SHPPLVERL A+D   KK +
Sbjct  400  AKNRSAVNVDPLYSAYHHSHPPLVERLTAVDAATKKGE  437



>ref|XP_009876903.1| PREDICTED: CAAX prenyl protease 1 homolog [Apaloderma vittatum]
Length=262

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  109  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  167

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  168  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  227

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ +
Sbjct  228  DNLGFPVSDWIFSMWHYSHPPLLERLQALKD  258



>ref|XP_010721597.1| PREDICTED: CAAX prenyl protease 1 homolog [Meleagris gallopavo]
Length=316

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  163  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  221

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  222  TQPTLIGLMIIFQFIFSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  281

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ +
Sbjct  282  DNLGFPVSDWIFSMWHYSHPPLLERLQALKD  312



>ref|XP_010284930.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Phaethon 
lepturus]
 gb|KFQ67253.1| CAAX prenyl protease 1, partial [Phaethon lepturus]
Length=258

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  105  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  163

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  164  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  223

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ +
Sbjct  224  DNLGFPVSDWIFSMWHYSHPPLLERLQALKD  254



>ref|XP_010624213.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Fukomys 
damarensis]
 gb|KFO32523.1| CAAX prenyl protease 1 like protein [Fukomys damarensis]
Length=475

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFSLFAVLIRRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+  P +
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALKNPKQ  474



>ref|XP_009685466.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Struthio 
camelus australis]
Length=380

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  227  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  285

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  286  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  345

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  346  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  380



>ref|XP_009491273.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Pelecanus 
crispus]
Length=309

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  156  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  214

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  215  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  274

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  275  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  309



>ref|XP_007430031.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Python 
bivittatus]
Length=476

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  323  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYE  381

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  382  TQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  441

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ E
Sbjct  442  DNLGFPVSDWLFSMWHYSHPPLLERLQALKE  472



>ref|XP_002292916.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90112.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=425

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 111/161 (69%), Gaps = 6/161 (4%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +I+Q  +D E++A+L HELGHWK+ HT+ +F+  Q+ T   F  + L  NS +L+++FGF
Sbjct  265  LIEQV-HDNEILAILGHELGHWKMGHTLINFVITQLYTGASFYAFALCYNSHELYRAFGF  323

Query  631  --ETQPV--LIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGL  467
              E++PV  LI L+ F  T+  P+   +SF + + SR  EF+AD F+ KLG +  L++GL
Sbjct  324  NDESRPVPTLIALLFFFSTIWAPIDKALSFAMTVHSRRCEFEADEFSVKLGMSQGLQSGL  383

Query  466  VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
             K+  ENL AM  DPWYS YHYSHPPLVERL+A+ + DKK+
Sbjct  384  CKIHLENLGAMLPDPWYSTYHYSHPPLVERLSAMMKMDKKS  424



>ref|XP_009813244.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Gavia stellata]
 gb|KFQ58206.1| CAAX prenyl protease 1, partial [Pelecanus crispus]
 gb|KFV44062.1| CAAX prenyl protease 1, partial [Gavia stellata]
Length=310

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  157  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  215

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  216  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  275

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  276  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  310



>gb|ETL45293.1| hypothetical protein L916_04606 [Phytophthora parasitica]
Length=484

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VA+L HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  325  LLEQATHDE-IVAILGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  383

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                ++PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  384  AGDSSKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  443

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  444  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETO80780.1| hypothetical protein F444_04815 [Phytophthora parasitica P1976]
Length=484

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VA+L HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  325  LLEQATHDE-IVAILGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  383

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                ++PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  384  AGDSSKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  443

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  444  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETL98448.1| hypothetical protein L917_04490 [Phytophthora parasitica]
 gb|ETM51609.1| hypothetical protein L914_04599 [Phytophthora parasitica]
 gb|ETP49699.1| hypothetical protein F442_04842 [Phytophthora parasitica P10297]
Length=484

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VA+L HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  325  LLEQATHDE-IVAILGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  383

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                ++PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  384  AGDSSKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  443

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  444  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETI52023.1| hypothetical protein F443_04763 [Phytophthora parasitica P1569]
Length=484

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VA+L HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  325  LLEQATHDE-IVAILGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  383

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                ++PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  384  AGDSSKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  443

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  444  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETK91894.1| hypothetical protein L915_04651 [Phytophthora parasitica]
 gb|ETP21822.1| hypothetical protein F441_04764 [Phytophthora parasitica CJ01A1]
Length=484

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VA+L HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  325  LLEQATHDE-IVAILGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  383

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                ++PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  384  AGDSSKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  443

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  444  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VAVL HELGHWKL HT   F+  Q      F  + L  N  +LF SFGF
Sbjct  309  LLEQATHDE-IVAVLGHELGHWKLWHTAQGFVIQQAYILASFYVFGLCMNDAELFASFGF  367

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                 +PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  368  AGDSAKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  427

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KKT
Sbjct  428  KLAIENLSNMNPDELYSAYHYSHPPLVERLNAITARAKKT  467



>ref|XP_008902128.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
 gb|ETN12113.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
Length=484

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -3

Query  811  VIQQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF  632
            +++Q  +DE +VA+L HELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF
Sbjct  325  LLEQATHDE-IVAILGHELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGF  383

Query  631  ---ETQPVLIGLIIFQHTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLV  464
                ++PV+IG ++F  T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL 
Sbjct  384  AGDSSKPVIIGFLLFSQTMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLT  443

Query  463  KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  344
            KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  444  KLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>ref|XP_009685465.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Struthio 
camelus australis]
Length=409

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  256  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  314

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  315  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  374

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  375  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  409



>ref|XP_005353368.1| PREDICTED: CAAX prenyl protease 1 homolog [Microtus ochrogaster]
Length=475

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  QI +FL F  + ++   K LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQINSFLCFFLFGVLIGQKILFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   DKK D
Sbjct  441  DNLGFPVSDWLFSTWHYSHPPLLERLQALR--DKKQD  475



>ref|XP_005309438.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X4 [Chrysemys 
picta bellii]
Length=377

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  224  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYE  282

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  283  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  342

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  343  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DAKQD  377



>ref|XP_007066142.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Chelonia mydas]
Length=410

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  257  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYE  315

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  316  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  375

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  376  DNLGFPVSDWIFSMWHYSHPPLLERLQAL--KDAKQD  410



>ref|XP_005029095.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Anas platyrhynchos]
Length=427

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  427



>ref|XP_004426071.1| PREDICTED: CAAX prenyl protease 1 homolog [Ceratotherium simum 
simum]
Length=475

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SFGL ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFGLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>gb|KFV87620.1| CAAX prenyl protease 1, partial [Struthio camelus australis]
Length=427

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_007950886.1| PREDICTED: CAAX prenyl protease 1 homolog [Orycteropus afer afer]
Length=475

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  470



>gb|KGL80196.1| CAAX prenyl protease 1, partial [Tinamus guttatus]
Length=427

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  427



>gb|KGO76072.1| Peptidase M48 [Penicillium italicum]
Length=456

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = -3

Query  787  EEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLI  611
            EEVVAVL HELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF + QP++I
Sbjct  289  EEVVAVLGHELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFVKEQPIMI  348

Query  610  GLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMN  431
            G ++F   + P+  +V   +N++SR FEFQAD FA+KLGY+  L + L+KLQ +NLS M+
Sbjct  349  GFLLFSDALAPMDAVVKLLMNILSRKFEFQADEFAQKLGYSDKLASSLLKLQIQNLSTMD  408

Query  430  TDPWYSAYHYSHPPLVERLAAI  365
             DP Y++YHYSHP L ERLAA+
Sbjct  409  ADPIYASYHYSHPILTERLAAL  430



>ref|XP_006033777.1| PREDICTED: CAAX prenyl protease 1 homolog [Alligator sinensis]
Length=460

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  307  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYE  365

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  366  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAEDLYSALIKLNK  425

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  426  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DSKQD  460



>ref|XP_004450692.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Dasypus 
novemcinctus]
Length=366

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  213  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  271

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  272  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  331

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+    +
Sbjct  332  DNLGFPVSDWLFSMWHYSHPPLLERLQALKSTKQ  365



>gb|EOA94667.1| CAAX prenyl protease 1-like protein, partial [Anas platyrhynchos]
Length=467

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  314  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  372

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  373  TQPTLIGLMIIFQFIFSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  432

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  433  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  467



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = -3

Query  796  KNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQP  620
             N++E+ AVLAHELGHW  NHT+      Q+  F  F  ++   N++D++ SFGF ++ P
Sbjct  295  SNNDEICAVLAHELGHWACNHTLKMLAFGQVQLFAVFYLFSQFINNEDMYTSFGFMDSTP  354

Query  619  VLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLS  440
              IG I+FQ+   P++ ++SF  N++SR +EFQADAFA+ LGYA  L +GL+KLQ +NL 
Sbjct  355  TFIGFILFQYLYSPVESVISFITNMISRRYEFQADAFARDLGYAGSLASGLIKLQLKNLG  414

Query  439  AMNTDPWYSAYHYSHPPLVERLAAIDEP  356
             MN D  +S YH SHP LVERL AI++P
Sbjct  415  TMNPDWLHSMYHRSHPELVERLNAINQP  442



>ref|XP_004705331.1| PREDICTED: CAAX prenyl protease 1 homolog [Echinops telfairi]
Length=432

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -3

Query  799  CKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQ  623
            CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E+Q
Sbjct  281  CKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFHAFGFYESQ  339

Query  622  PVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEEN  446
            P LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL  +N
Sbjct  340  PTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLDSALIKLNRDN  399

Query  445  LSAMNTDPWYSAYHYSHPPLVERLAAI  365
            L    +D  YS +HYSHPPL+ERL A+
Sbjct  400  LGFPVSDWLYSMWHYSHPPLLERLQAL  426



>ref|XP_005029094.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Anas platyrhynchos]
Length=465

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  312  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  370

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  371  TQPTLIGLMIIFQFIFSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  430

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  431  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  465



>ref|XP_009991374.1| PREDICTED: CAAX prenyl protease 1 homolog [Tauraco erythrolophus]
Length=358

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  205  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  263

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  264  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  323

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  324  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  358



>ref|XP_417720.1| PREDICTED: CAAX prenyl protease 1 homolog [Gallus gallus]
Length=465

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  312  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  370

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  371  TQPTLIGLMIIFQFIFSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  430

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  431  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  465



>ref|XP_004665222.1| PREDICTED: CAAX prenyl protease 1 homolog [Jaculus jaculus]
Length=432

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  279  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  337

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  338  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  397

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  398  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  426



>gb|KFP47980.1| CAAX prenyl protease 1 [Cathartes aura]
Length=377

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  224  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  282

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  283  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  342

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  343  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  377



>ref|XP_005309437.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Chrysemys 
picta bellii]
Length=430

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  277  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYE  335

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  336  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  395

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  396  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DAKQD  430



>ref|XP_010217187.1| PREDICTED: CAAX prenyl protease 1 homolog [Tinamus guttatus]
Length=451

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  298  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  356

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  357  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  416

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  417  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  451



>ref|XP_007492913.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Monodelphis 
domestica]
Length=472

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++ + K+LF +FGF +
Sbjct  319  QGCKN-EEVLAVLGHELGHWKLGHTVKNIVISQMNSFLCFFLFAMLISRKELFAAFGFYD  377

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  378  SQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  437

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  438  DNLGFPVSDWLFSMWHYSHPPLLERLQALQ--DSKQD  472



>ref|XP_010593553.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Loxodonta 
africana]
Length=417

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  264  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  322

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL  
Sbjct  323  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNR  382

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  383  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  411



>gb|KFU93569.1| CAAX prenyl protease 1, partial [Chaetura pelagica]
Length=427

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  393  DNLGFPVSDWLFSMWHYSHPPLLERLQALK--DAKQD  427



>ref|XP_001381205.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Monodelphis 
domestica]
Length=474

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++ + K+LF +FGF +
Sbjct  321  QGCKN-EEVLAVLGHELGHWKLGHTVKNIVISQMNSFLCFFLFAMLISRKELFAAFGFYD  379

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  380  SQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  439

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  440  DNLGFPVSDWLFSMWHYSHPPLLERLQALQ--DSKQD  474



>ref|XP_006269945.1| PREDICTED: CAAX prenyl protease 1 homolog [Alligator mississippiensis]
Length=468

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  315  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYE  373

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  374  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAEDLYSALIKLNK  433

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  434  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DSKQD  468



>ref|XP_009095809.1| PREDICTED: CAAX prenyl protease 1 homolog [Serinus canaria]
Length=409

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  256  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  314

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  315  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  374

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  375  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  409



>ref|XP_010187899.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Mesitornis 
unicolor]
Length=425

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  272  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  330

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  331  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  390

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  391  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  425



>ref|XP_005309436.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Chrysemys 
picta bellii]
Length=467

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  314  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYE  372

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  373  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  432

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  433  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DAKQD  467



>gb|KFQ39196.1| CAAX prenyl protease 1, partial [Mesitornis unicolor]
Length=426

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  426



>gb|KFO78045.1| CAAX prenyl protease 1, partial [Cuculus canorus]
Length=407

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  254  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFTAFGFYD  312

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  313  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  372

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  373  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  407



>ref|XP_006113335.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Pelodiscus 
sinensis]
Length=437

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   ++LF +FGF E
Sbjct  284  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQRELFAAFGFYE  342

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  343  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKANDLYSALIKLNK  402

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+ E  +
Sbjct  403  DNLGFPVSDWIFSMWHYSHPPLLERLQALKEAKQ  436



>gb|KFP66604.1| CAAX prenyl protease 1, partial [Cariama cristata]
Length=427

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DAKQD  427



>ref|XP_009701667.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Cariama cristata]
Length=426

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DAKQD  426



>ref|XP_008929891.1| PREDICTED: CAAX prenyl protease 1 homolog [Manacus vitellinus]
Length=433

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  280  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFTAFGFYD  338

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  339  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  398

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  399  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  433



>gb|KFW75388.1| CAAX prenyl protease 1, partial [Manacus vitellinus]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFTAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_002194902.2| PREDICTED: CAAX prenyl protease 1 homolog [Taeniopygia guttata]
Length=443

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  290  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  348

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  349  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  408

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  409  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  443



>ref|XP_003415368.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Loxodonta 
africana]
Length=475

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYE  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL  
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNR  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_010133525.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Buceros rhinoceros 
silvestris]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  426



>gb|KFV07913.1| CAAX prenyl protease 1, partial [Tauraco erythrolophus]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDTKQE  427



>gb|KFP82009.1| CAAX prenyl protease 1, partial [Acanthisitta chloris]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKQLGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDSKQE  427



>gb|KFO58257.1| CAAX prenyl protease 1, partial [Corvus brachyrhynchos]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_010345849.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Saimiri 
boliviensis boliviensis]
Length=417

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  264  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  322

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  323  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  382

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  383  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  411



>gb|KFV03217.1| CAAX prenyl protease 1, partial [Pterocles gutturalis]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  426



>ref|XP_009074890.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Acanthisitta 
chloris]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKQLGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDSKQE  426



>ref|XP_010086478.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Pterocles 
gutturalis]
Length=425

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  272  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  330

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  331  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  390

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  391  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  425



>ref|XP_009917539.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Haliaeetus 
albicilla]
Length=357

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  204  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  262

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQAD+FAK+LG A  L + L+KL +
Sbjct  263  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADSFAKELGKAKDLYSALIKLNK  322

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  323  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  357



>ref|XP_007892978.1| PREDICTED: CAAX prenyl protease 1 homolog [Callorhinchus milii]
Length=421

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 4/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            +Q  N++EV+AVL HELGHWKL HT+ + +  Q+ +F  F  + ++ + K+LF +FGF +
Sbjct  267  RQGCNNQEVLAVLGHELGHWKLGHTVKNIVISQVNSFFCFFLFAVLMDRKELFSAFGFYD  326

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL +
Sbjct  327  SQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKNLGKATDLYSSLIKLNK  386

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL     D  YS +HYSHPPL+ERL A+   DKK D
Sbjct  387  DNLGFPVADWLYSMWHYSHPPLLERLRALK--DKKED  421



>gb|ELK19500.1| CAAX prenyl protease 1 like protein [Pteropus alecto]
Length=396

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  243  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  301

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  302  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  361

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  362  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  390



>ref|XP_001623710.1| predicted protein [Nematostella vectensis]
 gb|EDO31610.1| predicted protein [Nematostella vectensis]
Length=450

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
            + C NDE V+AVL HELGHW L+H + + I  Q  T   F  + ++ + K L+++FGF +
Sbjct  299  KGCSNDE-VLAVLGHELGHWSLSHNLKNLIISQFNTLFCFLIFGILMHEKVLYEAFGFNS  357

Query  625  QPVLIGLII-FQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEE  449
            QPVLIGLII FQ    P   L+ F + +++R FEFQADAFAK+LG+A  LR+ L+KL ++
Sbjct  358  QPVLIGLIIIFQFVFSPYNELLGFLMTILTRRFEFQADAFAKQLGFAPHLRSALIKLHQD  417

Query  448  NLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            NL     D  YSAYHYSHPPL+ERL A+
Sbjct  418  NLGFPIADKLYSAYHYSHPPLLERLRAL  445



>ref|XP_010001210.1| PREDICTED: CAAX prenyl protease 1 homolog [Chaetura pelagica]
Length=460

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  307  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  365

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  366  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  425

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  426  DNLGFPVSDWLFSMWHYSHPPLLERLQALK--DAKQD  460



>gb|KFO89161.1| CAAX prenyl protease 1, partial [Buceros rhinoceros silvestris]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>gb|EFB13524.1| hypothetical protein PANDA_017398 [Ailuropoda melanoleuca]
Length=434

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T
Sbjct  282  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYT  340

Query  625  -QPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  341  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  400

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  401  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  430



>ref|XP_004614273.1| PREDICTED: CAAX prenyl protease 1 homolog [Sorex araneus]
Length=475

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFSLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>gb|KGO40189.1| Peptidase M48 [Penicillium expansum]
 gb|KGO53048.1| Peptidase M48 [Penicillium expansum]
 gb|KGO63477.1| Peptidase M48 [Penicillium expansum]
Length=456

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = -3

Query  787  EEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLI  611
            EEVVAVL HELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF + QP++I
Sbjct  289  EEVVAVLGHELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFVKEQPIMI  348

Query  610  GLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMN  431
            G ++F   + P+  +V   +N++SR FEF+AD FA+KLGY+  L + L+KLQ +NLS M+
Sbjct  349  GFLLFSDALAPMDAVVKLLMNILSRKFEFEADEFAQKLGYSDKLASSLLKLQIQNLSTMD  408

Query  430  TDPWYSAYHYSHPPLVERLAAI  365
             DP Y++YHYSHP L ERLAA+
Sbjct  409  ADPIYASYHYSHPILTERLAAL  430



>ref|XP_005607230.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Equus caballus]
 ref|XP_008522392.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Equus przewalskii]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  332  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  392  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  420



>gb|KFP21746.1| CAAX prenyl protease 1, partial [Egretta garzetta]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>gb|KFM12524.1| CAAX prenyl protease 1, partial [Aptenodytes forsteri]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_002715233.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryctolagus cuniculus]
Length=473

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  320  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  378

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL +
Sbjct  379  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKNLGKAKDLYSALIKLNK  438

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+  P +
Sbjct  439  DNLGFPVSDWLFSMWHYSHPPLLERLQALKTPKQ  472



>ref|XP_008630820.1| PREDICTED: CAAX prenyl protease 1 homolog [Corvus brachyrhynchos]
Length=449

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  296  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  354

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  355  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  414

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  415  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  449



>gb|KFV40539.1| CAAX prenyl protease 1, partial [Tyto alba]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_005492450.1| PREDICTED: CAAX prenyl protease 1 homolog [Zonotrichia albicollis]
Length=453

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  300  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  358

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  359  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  418

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  419  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  453



>ref|XP_005083884.1| PREDICTED: CAAX prenyl protease 1 homolog [Mesocricetus auratus]
Length=475

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  QI +FL F  + ++   K LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQKVLFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG +  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFVFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMSKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  441  DNLGFPVSDWLFSTWHYSHPPLLERLQALK--DTKQD  475



>ref|XP_009575599.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Fulmarus 
glacialis]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  426



>gb|ERE83119.1| putative CAAX prenyl protease 1 like protein [Cricetulus griseus]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  QI +FL F  + ++   + LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQEVLFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  332  SQPTLIGLLIIFQFVFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  392  DNLGFPVSDWLFSTWHYSHPPLLERLQALK--DTKQD  426



>gb|KFR09506.1| CAAX prenyl protease 1, partial [Opisthocomus hoazin]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>gb|KFQ91415.1| CAAX prenyl protease 1, partial [Nipponia nippon]
Length=427

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_009969340.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Tyto alba]
Length=432

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  279  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  337

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  338  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  397

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  398  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  432



>ref|XP_010207607.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Colius striatus]
Length=446

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  293  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  351

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  352  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  411

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  412  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  446



>ref|XP_006113334.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Pelodiscus 
sinensis]
Length=466

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   ++LF +FGF E
Sbjct  313  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQRELFAAFGFYE  371

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  372  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKANDLYSALIKLNK  431

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+ E  +
Sbjct  432  DNLGFPVSDWIFSMWHYSHPPLLERLQALKEAKQ  465



>ref|XP_006886567.1| PREDICTED: CAAX prenyl protease 1 homolog [Elephantulus edwardii]
Length=474

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  321  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAILIGRKELFAAFGFYD  379

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  380  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  439

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  440  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  468



>ref|XP_009891312.1| PREDICTED: CAAX prenyl protease 1 homolog [Charadrius vociferus]
Length=431

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  278  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  336

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL +
Sbjct  337  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKDLGKAKDLYSALIKLNK  396

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  397  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  431



>ref|XP_004740737.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
 ref|XP_004783002.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
Length=475

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFHT  380

Query  625  -QPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  470



>ref|XP_009909817.1| PREDICTED: CAAX prenyl protease 1 homolog [Picoides pubescens]
Length=428

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  275  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  333

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  334  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAQDLYSALIKLNK  393

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ +
Sbjct  394  DNLGFPVSDWIFSMWHYSHPPLLERLQALKD  424



>ref|XP_007114324.1| PREDICTED: CAAX prenyl protease 1 homolog [Physeter catodon]
Length=432

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  279  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  337

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  338  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  397

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  398  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  426



>gb|KFV92102.1| CAAX prenyl protease 1, partial [Fulmarus glacialis]
Length=427

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_006995844.1| PREDICTED: CAAX prenyl protease 1 homolog [Peromyscus maniculatus 
bairdii]
Length=475

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  QI +FL F  + ++   + LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQRVLFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  TQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSTWHYSHPPLLERLQAL  469



>gb|KFP23371.1| CAAX prenyl protease 1, partial [Colius striatus]
Length=433

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  280  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  338

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  339  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  398

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  399  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  433



>ref|XP_006867649.1| PREDICTED: CAAX prenyl protease 1 homolog [Chrysochloris asiatica]
Length=475

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   ++LF +FGF E
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAILIGRRELFAAFGFYE  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>gb|KFV63659.1| CAAX prenyl protease 1, partial [Picoides pubescens]
Length=427

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAQDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  359
            +NL    +D  +S +HYSHPPL+ERL A+ +
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKD  423



>ref|XP_004025583.1| PREDICTED: CAAX prenyl protease 1 homolog [Gorilla gorilla gorilla]
Length=422

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  269  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  327

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  328  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  387

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  388  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  416



>ref|XP_008063695.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarsius 
syrichta]
Length=436

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  283  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  341

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  342  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  401

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  402  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  430



>ref|XP_005529940.1| PREDICTED: CAAX prenyl protease 1 homolog [Pseudopodoces humilis]
Length=465

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  312  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  370

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  371  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  430

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  431  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  465



>ref|XP_003225003.1| PREDICTED: CAAX prenyl protease 1 homolog [Anolis carolinensis]
Length=477

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  324  QGCKN-EEVLAVLGHELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYD  382

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL +
Sbjct  383  TQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKDLGKAKDLYSALIKLNK  442

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+ E  +
Sbjct  443  DNLGFPVSDWLFSMWHYSHPPLLERLQALKESKQ  476



>ref|XP_003989947.2| PREDICTED: CAAX prenyl protease 1 homolog [Felis catus]
Length=475

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF  
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFSAFGFYN  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A++   +
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALESSKQ  474



>ref|XP_004415415.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004415416.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Odobenus 
rosmarus divergens]
Length=475

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYT  380

Query  625  -QPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  470



>ref|XP_007077458.1| PREDICTED: CAAX prenyl protease 1 homolog [Panthera tigris altaica]
Length=473

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF  
Sbjct  320  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFSAFGFYN  378

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  379  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  438

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A++   +
Sbjct  439  DNLGFPVSDWLFSMWHYSHPPLLERLQALESSKQ  472



>ref|XP_005058383.1| PREDICTED: CAAX prenyl protease 1 homolog [Ficedula albicollis]
Length=465

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  312  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  370

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  371  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  430

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  431  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  465



>ref|XP_009917537.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Haliaeetus 
albicilla]
 ref|XP_009917538.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Haliaeetus 
albicilla]
 ref|XP_010574594.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Haliaeetus 
leucocephalus]
 ref|XP_010574595.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Haliaeetus 
leucocephalus]
Length=408

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  255  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  313

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQAD+FAK+LG A  L + L+KL +
Sbjct  314  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADSFAKELGKAKDLYSALIKLNK  373

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  374  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  408



>gb|KFP02851.1| CAAX prenyl protease 1, partial [Calypte anna]
Length=427

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 5/155 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   ++LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRQFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+   DKK
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALK--DKK  425



>ref|XP_009931337.1| PREDICTED: CAAX prenyl protease 1 homolog [Opisthocomus hoazin]
Length=451

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  298  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  356

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  357  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  416

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  417  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  451



>ref|XP_006737576.1| PREDICTED: CAAX prenyl protease 1 homolog [Leptonychotes weddellii]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYT  380

Query  625  -QPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  470



>ref|NP_001288163.1| zinc metallopeptidase STE24 [Equus caballus]
 ref|XP_008522390.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Equus przewalskii]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_003799067.1| PREDICTED: CAAX prenyl protease 1 homolog [Otolemur garnettii]
Length=446

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  293  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAILIGRKELFAAFGFYD  351

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  352  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  411

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  412  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  440



>ref|XP_007453816.1| PREDICTED: CAAX prenyl protease 1 homolog [Lipotes vexillifer]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFSD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_002565802.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99187.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
Length=456

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = -3

Query  787  EEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLI  611
            EEVVAVL HELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF   QP++I
Sbjct  289  EEVVAVLGHELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFINEQPIMI  348

Query  610  GLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMN  431
            G ++F   + P+  +V   +N++SR FEF+ADAFA+ LGY+  L + L+KLQ +NLS M+
Sbjct  349  GFLLFSDALAPMDAVVKLLMNILSRKFEFEADAFAQNLGYSDKLASSLLKLQIQNLSTMD  408

Query  430  TDPWYSAYHYSHPPLVERLAAI  365
             DP Y++YHYSHP L ERLAA+
Sbjct  409  ADPIYASYHYSHPILTERLAAL  430



>gb|KGL99640.1| CAAX prenyl protease 1, partial [Charadrius vociferus]
Length=427

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKDLGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  427



>ref|XP_002927608.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Ailuropoda 
melanoleuca]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET  626
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYT  380

Query  625  -QPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
             QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  470



>ref|XP_010017682.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Nestor notabilis]
Length=426

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  273  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  331

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  332  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  391

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  392  DNLGFPVSDWIFSMWHYSHPPLLERLQAL  420



>ref|XP_006904034.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Pteropus alecto]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_008063694.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarsius 
syrichta]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>gb|EHB18901.1| CAAX prenyl protease 1-like protein [Heterocephalus glaber]
Length=445

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  292  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIRRKELFAAFGFYD  350

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  351  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAEDLYSALIKLNK  410

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  411  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  439



>gb|KFQ43267.1| CAAX prenyl protease 1, partial [Nestor notabilis]
Length=427

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  274  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  332

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  333  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  392

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  393  DNLGFPVSDWIFSMWHYSHPPLLERLQAL  421



>ref|XP_003891707.2| PREDICTED: CAAX prenyl protease 1 homolog, partial [Papio anubis]
Length=458

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  305  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  363

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  364  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  423

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  424  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  452



>ref|XP_539577.3| PREDICTED: CAAX prenyl protease 1 homolog [Canis lupus familiaris]
Length=473

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF  
Sbjct  320  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYN  378

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  379  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  438

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAID  362
            +NL    +D  +S +HYSHPPL+ERL A++
Sbjct  439  DNLGFPVSDWLFSMWHYSHPPLLERLQALE  468



>ref|XP_004678903.1| PREDICTED: CAAX prenyl protease 1 homolog [Condylura cristata]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_009644178.1| PREDICTED: CAAX prenyl protease 1 homolog [Egretta garzetta]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            TQP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL +
Sbjct  381  TQPTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  347
            +NL    +D  +S +HYSHPPL+ERL A+ +  ++
Sbjct  441  DNLGFPVSDWIFSMWHYSHPPLLERLQALKDAKQE  475



>ref|XP_003273371.1| PREDICTED: CAAX prenyl protease 1 homolog [Nomascus leucogenys]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_513352.2| PREDICTED: CAAX prenyl protease 1 homolog [Pan troglodytes]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_002750699.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Callithrix 
jacchus]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|NP_001126457.1| CAAX prenyl protease 1 homolog [Pongo abelii]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>gb|AAH37283.1| Zinc metallopeptidase (STE24 homolog, S. cerevisiae) [Homo sapiens]
 gb|ABW03365.1| zinc metallopeptidase (STE24 homolog, S. cerevisiae) [synthetic 
construct]
 gb|ABW03708.1| zinc metallopeptidase (STE24 homolog, S. cerevisiae) [synthetic 
construct]
Length=475

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  441  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  469



>ref|XP_004851106.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Heterocephalus 
glaber]
Length=424

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  271  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIRRKELFAAFGFYD  329

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  330  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAEDLYSALIKLNK  389

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAI  365
            +NL    +D  +S +HYSHPPL+ERL A+
Sbjct  390  DNLGFPVSDWLFSMWHYSHPPLLERLQAL  418



>gb|ELR54320.1| CAAX prenyl protease 1-like protein [Bos mutus]
Length=476

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 106/154 (69%), Gaps = 3/154 (2%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +
Sbjct  323  QGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFVAFGFND  381

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  382  SQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNK  441

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  350
            +NL    +D  +S +HYSHPPL+ERL A+    +
Sbjct  442  DNLGFPVSDWLFSMWHYSHPPLLERLQALKNSKR  475



>ref|XP_003501864.1| PREDICTED: CAAX prenyl protease 1 homolog [Cricetulus griseus]
 ref|XP_007618844.1| PREDICTED: CAAX prenyl protease 1 homolog [Cricetulus griseus]
 gb|EGV97096.1| CAAX prenyl protease 1-like [Cricetulus griseus]
 gb|ERE83120.1| putative CAAX prenyl protease 1 like protein [Cricetulus griseus]
Length=475

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = -3

Query  805  QQCKNDEEVVAVLAHELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-E  629
            Q CKN EEV+AVL HELGHWKL HT+ + I  QI +FL F  + ++   + LF +FGF +
Sbjct  322  QGCKN-EEVLAVLGHELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQEVLFAAFGFYD  380

Query  628  TQPVLIGL-IIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  452
            +QP LIGL IIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL +
Sbjct  381  SQPTLIGLLIIFQFVFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNK  440

Query  451  ENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  341
            +NL    +D  +S +HYSHPPL+ERL A+   D K D
Sbjct  441  DNLGFPVSDWLFSTWHYSHPPLLERLQALK--DTKQD  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1659957175625