BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018I01

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599412.1|  PREDICTED: NAC domain-containing protein 78-...    186   3e-51   Nicotiana tomentosiformis
ref|XP_009764398.1|  PREDICTED: NAC domain-containing protein 78-...    185   5e-51   Nicotiana sylvestris
ref|XP_009625486.1|  PREDICTED: NAC domain-containing protein 78-...    183   3e-50   Nicotiana tomentosiformis
ref|XP_009771992.1|  PREDICTED: NAC domain-containing protein 78-...    168   8e-45   Nicotiana sylvestris
ref|XP_009771991.1|  PREDICTED: NAC domain-containing protein 78-...    167   2e-44   Nicotiana sylvestris
ref|XP_004250028.1|  PREDICTED: NAC domain-containing protein 78        162   1e-42   Solanum lycopersicum
ref|XP_004239710.1|  PREDICTED: NAC domain-containing protein 78-...    162   1e-42   Solanum lycopersicum
ref|XP_006345843.1|  PREDICTED: NAC domain-containing protein 78-...    159   2e-41   Solanum tuberosum [potatoes]
gb|EYU39671.1|  hypothetical protein MIMGU_mgv1a003896mg                156   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_007010050.1|  NAC domain protein, IPR003441, putative isof...    155   4e-40   
ref|XP_006361710.1|  PREDICTED: NAC domain-containing protein 78-...    155   6e-40   Solanum tuberosum [potatoes]
ref|XP_006361711.1|  PREDICTED: NAC domain-containing protein 78-...    155   7e-40   
ref|XP_010090439.1|  NAC domain-containing protein 78                   152   6e-39   
ref|XP_011076897.1|  PREDICTED: NAC domain-containing protein 78-...    150   2e-38   Sesamum indicum [beniseed]
gb|AGL39700.1|  NAC transcription factor 044                            146   6e-37   Jatropha curcas
ref|XP_007218872.1|  hypothetical protein PRUPE_ppa003239mg             144   3e-36   Prunus persica
ref|XP_008232319.1|  PREDICTED: NAC domain-containing protein 78 ...    144   5e-36   Prunus mume [ume]
ref|XP_011031619.1|  PREDICTED: NAC domain-containing protein 78-...    143   6e-36   Populus euphratica
ref|XP_011031618.1|  PREDICTED: NAC domain-containing protein 78-...    143   8e-36   Populus euphratica
ref|XP_011101545.1|  PREDICTED: NAC domain-containing protein 78-...    142   1e-35   Sesamum indicum [beniseed]
ref|XP_011101544.1|  PREDICTED: NAC domain-containing protein 78-...    142   1e-35   Sesamum indicum [beniseed]
ref|XP_011101543.1|  PREDICTED: NAC domain-containing protein 78-...    142   1e-35   Sesamum indicum [beniseed]
ref|XP_011024334.1|  PREDICTED: NAC domain-containing protein 78-...    142   2e-35   Populus euphratica
gb|AIA57516.1|  NAC domain-containing protein                           142   3e-35   Boehmeria nivea [Chinese silk-plant]
ref|XP_008232318.1|  PREDICTED: NAC domain-containing protein 78 ...    142   3e-35   Prunus mume [ume]
ref|XP_006436536.1|  hypothetical protein CICLE_v10031147mg             140   1e-34   Citrus clementina [clementine]
emb|CDO99814.1|  unnamed protein product                                140   2e-34   Coffea canephora [robusta coffee]
ref|XP_006378789.1|  NAC domain-containing protein 78                   139   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011024333.1|  PREDICTED: NAC domain-containing protein 78-...    139   3e-34   Populus euphratica
ref|XP_006436534.1|  hypothetical protein CICLE_v10031147mg             136   2e-33   
ref|XP_002315338.2|  hypothetical protein POPTR_0010s23650g             136   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006436535.1|  hypothetical protein CICLE_v10031147mg             136   3e-33   Citrus clementina [clementine]
ref|XP_009346099.1|  PREDICTED: NAC domain-containing protein 78-...    130   9e-33   Pyrus x bretschneideri [bai li]
ref|XP_002265345.2|  PREDICTED: NAC domain-containing protein 78        134   1e-32   Vitis vinifera
ref|XP_009346651.1|  PREDICTED: NAC domain-containing protein 78-...    132   1e-31   Pyrus x bretschneideri [bai li]
gb|ADL36811.1|  NAC domain class transcription factor                   131   2e-31   Malus domestica [apple tree]
ref|XP_006379522.1|  hypothetical protein POPTR_0008s03170g             130   6e-31   
ref|XP_009346652.1|  PREDICTED: NAC domain-containing protein 78-...    130   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_009346650.1|  PREDICTED: NAC domain-containing protein 78-...    130   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_010543581.1|  PREDICTED: NAC domain-containing protein 78-...    128   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_002311983.2|  NAC domain-containing protein 78                   126   1e-29   
gb|KDO47584.1|  hypothetical protein CISIN_1g007598mg                   125   1e-29   Citrus sinensis [apfelsine]
ref|XP_008345397.1|  PREDICTED: NAC domain-containing protein 78-...    126   2e-29   
ref|XP_010032131.1|  PREDICTED: NAC domain-containing protein 78        125   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010552948.1|  PREDICTED: NAC domain-containing protein 78-...    124   6e-29   Tarenaya hassleriana [spider flower]
gb|KJB60503.1|  hypothetical protein B456_009G309000                    124   9e-29   Gossypium raimondii
ref|XP_006297351.1|  hypothetical protein CARUB_v10013370mg             123   1e-28   Capsella rubella
gb|KDO47590.1|  hypothetical protein CISIN_1g007598mg                   122   1e-28   Citrus sinensis [apfelsine]
gb|KDO47589.1|  hypothetical protein CISIN_1g007598mg                   122   2e-28   Citrus sinensis [apfelsine]
ref|XP_006407560.1|  hypothetical protein EUTSA_v10020438mg             122   2e-28   Eutrema salsugineum [saltwater cress]
gb|AGC27316.1|  NAC domain protein 13                                   123   2e-28   Gossypium hirsutum [American cotton]
gb|KDO47587.1|  hypothetical protein CISIN_1g007598mg                   122   2e-28   Citrus sinensis [apfelsine]
gb|KDO47586.1|  hypothetical protein CISIN_1g007598mg                   122   2e-28   Citrus sinensis [apfelsine]
gb|KDO47585.1|  hypothetical protein CISIN_1g007598mg                   122   3e-28   Citrus sinensis [apfelsine]
gb|KDO47583.1|  hypothetical protein CISIN_1g007598mg                   122   3e-28   Citrus sinensis [apfelsine]
dbj|BAJ34165.1|  unnamed protein product                                120   1e-27   Eutrema halophilum
gb|KFK38438.1|  hypothetical protein AALP_AA3G113300                    120   2e-27   Arabis alpina [alpine rockcress]
ref|XP_009361439.1|  PREDICTED: NAC domain-containing protein 78-...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_006398899.1|  hypothetical protein EUTSA_v10013110mg             119   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_011469276.1|  PREDICTED: NAC domain-containing protein 78 ...    119   5e-27   Fragaria vesca subsp. vesca
ref|XP_010486664.1|  PREDICTED: NAC domain-containing protein 78        118   7e-27   Camelina sativa [gold-of-pleasure]
emb|CAN70406.1|  hypothetical protein VITISV_021988                     118   9e-27   Vitis vinifera
ref|XP_008339779.1|  PREDICTED: NAC domain-containing protein 78-...    118   1e-26   
ref|XP_008339778.1|  PREDICTED: NAC domain-containing protein 78-...    118   1e-26   
ref|XP_010464726.1|  PREDICTED: NAC domain-containing protein 78-...    116   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_011469274.1|  PREDICTED: NAC domain-containing protein 78 ...    116   6e-26   Fragaria vesca subsp. vesca
ref|XP_004307017.1|  PREDICTED: NAC domain-containing protein 78 ...    115   8e-26   Fragaria vesca subsp. vesca
ref|XP_002532627.1|  conserved hypothetical protein                     114   1e-25   
ref|XP_011469277.1|  PREDICTED: NAC domain-containing protein 78 ...    114   2e-25   Fragaria vesca subsp. vesca
ref|XP_010485001.1|  PREDICTED: NAC domain-containing protein 78-...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010694513.1|  PREDICTED: NAC domain-containing protein 78        114   2e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV29480.1|  putative NAC domain class transcription factor          112   3e-25   Tamarix hispida
ref|NP_566376.1|  NAC domain containing protein 53                      111   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65338.1|  NAC, putative                                           111   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496134.1|  PREDICTED: NAC domain-containing protein 78-...    110   4e-24   Cicer arietinum [garbanzo]
ref|XP_004496133.1|  PREDICTED: NAC domain-containing protein 78-...    110   4e-24   Cicer arietinum [garbanzo]
ref|XP_010423584.1|  PREDICTED: NAC domain-containing protein 78 ...    107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010423582.1|  PREDICTED: NAC domain-containing protein 78 ...    107   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010423583.1|  PREDICTED: NAC domain-containing protein 78 ...    107   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010452336.1|  PREDICTED: NAC domain-containing protein 78-...    107   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010452337.1|  PREDICTED: NAC domain-containing protein 78-...    107   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004173168.1|  PREDICTED: NAC domain-containing protein 78-...    106   1e-22   
gb|KGN52230.1|  hypothetical protein Csa_5G622470                       106   1e-22   Cucumis sativus [cucumbers]
gb|AAG51388.1|AC011560_20  unknown protein; 75639-73470                 105   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243195.1|  PREDICTED: NAC domain-containing protein 78-...    104   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010243196.1|  PREDICTED: NAC domain-containing protein 78-...    104   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010267268.1|  PREDICTED: NAC domain-containing protein 78-...    104   9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008446811.1|  PREDICTED: NAC domain-containing protein 78-...    103   1e-21   Cucumis melo [Oriental melon]
ref|XP_008456549.1|  PREDICTED: NAC domain-containing protein 78-...    103   2e-21   
ref|XP_008456548.1|  PREDICTED: NAC domain-containing protein 78-...    103   2e-21   
gb|KFK24891.1|  hypothetical protein AALP_AA8G038000                    103   2e-21   Arabis alpina [alpine rockcress]
ref|NP_196061.1|  NAC family transcriptional activator                  102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490950.1|  PREDICTED: NAC domain-containing protein 78-...    101   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010490948.1|  PREDICTED: NAC domain-containing protein 78-...    101   8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002871092.1|  hypothetical protein ARALYDRAFT_908325             100   2e-20   Arabidopsis lyrata subsp. lyrata
gb|KEH17171.1|  NAC transcription factor-like protein                 99.4    4e-20   Medicago truncatula
gb|EYU32441.1|  hypothetical protein MIMGU_mgv1a002437mg              98.2    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_006286823.1|  hypothetical protein CARUB_v10003768mg           97.8    2e-19   
ref|XP_002882677.1|  ANAC053                                          97.1    2e-19   
ref|XP_004150380.1|  PREDICTED: NAC domain-containing protein 78-...  97.1    2e-19   Cucumis sativus [cucumbers]
gb|KEH43320.1|  NAC transcription factor-like protein                 95.5    5e-19   Medicago truncatula
gb|KEH43318.1|  NAC transcription factor-like protein                 95.5    6e-19   Medicago truncatula
gb|KEH43319.1|  NAC transcription factor-like protein                 95.1    1e-18   Medicago truncatula
gb|AAM34772.1|AF509872_1  nam-like protein 9                          94.4    1e-18   Petunia x hybrida [garden petunia]
gb|KEH43317.1|  NAC transcription factor-like protein                 95.1    1e-18   Medicago truncatula
gb|KEH43321.1|  NAC transcription factor-like protein                 95.1    1e-18   Medicago truncatula
gb|KHN00951.1|  NAC domain-containing protein 78                      92.0    8e-18   Glycine soja [wild soybean]
ref|XP_010485171.1|  PREDICTED: NAC domain-containing protein 78-...  86.3    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003556302.1|  PREDICTED: NAC domain-containing protein 78-...  92.0    1e-17   Glycine max [soybeans]
gb|AGV29486.1|  putative NAC domain class transcription factor        87.8    2e-17   Tamarix hispida
gb|AAF09254.1|AF201456_1  NAC2                                        91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125558.1|  PREDICTED: NAC domain-containing protein 78-...  90.9    2e-17   Brassica rapa
ref|XP_007144249.1|  hypothetical protein PHAVU_007G140500g           91.3    2e-17   Phaseolus vulgaris [French bean]
emb|CDY58437.1|  BnaC03g71220D                                        89.4    8e-17   Brassica napus [oilseed rape]
gb|AHA84185.1|  NAC domain-containing protein 78                      89.0    1e-16   Phaseolus vulgaris [French bean]
ref|XP_009125559.1|  PREDICTED: NAC domain-containing protein 78-...  88.2    2e-16   Brassica rapa
emb|CDY44853.1|  BnaC09g50530D                                        87.8    3e-16   Brassica napus [oilseed rape]
emb|CDY41354.1|  BnaA01g31650D                                        87.0    5e-16   Brassica napus [oilseed rape]
emb|CDX70227.1|  BnaA10g25760D                                        87.0    6e-16   
ref|XP_004142444.1|  PREDICTED: NAC domain-containing protein 78-...  86.3    9e-16   
ref|XP_009122601.1|  PREDICTED: NAC domain-containing protein 78-...  85.9    1e-15   Brassica rapa
gb|AAN46239.1|  unknown protein                                       84.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46238.1|  unknown protein                                       83.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14157.1|  BnaC02g02740D                                        84.0    6e-15   Brassica napus [oilseed rape]
gb|EPS65703.1|  nam-like protein 9                                    84.0    7e-15   Genlisea aurea
ref|XP_009130822.1|  PREDICTED: NAC domain-containing protein 78-...  83.2    1e-14   Brassica rapa
ref|XP_009130821.1|  PREDICTED: NAC domain-containing protein 78-...  82.8    2e-14   Brassica rapa
gb|AAN46250.1|  unknown protein                                       81.3    2e-14   Arabidopsis lyrata [lyrate rockcress]
ref|XP_009122853.1|  PREDICTED: NAC domain-containing protein 78      82.4    2e-14   Brassica rapa
emb|CDY11289.1|  BnaA03g01250D                                        81.6    3e-14   Brassica napus [oilseed rape]
gb|AAN46247.1|  unknown protein                                       79.7    5e-14   Arabidopsis lyrata [lyrate rockcress]
gb|AAN46251.1|  unknown protein                                       78.2    2e-13   Arabidopsis lyrata [lyrate rockcress]
emb|CDY61762.1|  BnaAnng17650D                                        77.4    7e-13   Brassica napus [oilseed rape]
ref|XP_010940544.1|  PREDICTED: uncharacterized protein LOC105059077  70.9    1e-10   Elaeis guineensis
ref|XP_006648145.1|  PREDICTED: NAC domain-containing protein 78-...  70.1    2e-10   Oryza brachyantha
ref|XP_003570443.1|  PREDICTED: NAC domain-containing protein 78      69.7    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_002453065.1|  hypothetical protein SORBIDRAFT_04g037720        69.3    4e-10   Sorghum bicolor [broomcorn]
gb|AAO72552.1|  NAC-like protein                                      68.2    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779162.1|  PREDICTED: uncharacterized protein LOC103698888  68.2    9e-10   Phoenix dactylifera
gb|EAY88066.1|  hypothetical protein OsI_09496                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001048559.1|  Os02g0822400                                     67.8    1e-09   
ref|XP_008787444.1|  PREDICTED: NAC domain-containing protein 78      67.4    2e-09   Phoenix dactylifera
ref|XP_009418258.1|  PREDICTED: uncharacterized protein LOC103998499  65.1    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF82881.1|  unknown                                               63.5    1e-08   Zea mays [maize]
ref|XP_004954444.1|  PREDICTED: NAC domain-containing protein 78-...  64.3    2e-08   Setaria italica
gb|ACN34478.1|  unknown                                               62.8    5e-08   Zea mays [maize]
gb|ACN28830.1|  unknown                                               62.8    7e-08   Zea mays [maize]
ref|NP_001152531.1|  NAC domain-containing protein 78                 62.8    7e-08   
ref|XP_010935813.1|  PREDICTED: NAC domain-containing protein 78-...  62.4    7e-08   Elaeis guineensis
ref|XP_010935812.1|  PREDICTED: NAC domain-containing protein 78-...  62.4    7e-08   Elaeis guineensis
ref|XP_008677410.1|  PREDICTED: NAC domain-containing protein 78 ...  62.4    8e-08   Zea mays [maize]
gb|EMS63008.1|  NAC domain-containing protein 78                      61.2    2e-07   Triticum urartu
gb|EMT07836.1|  hypothetical protein F775_28266                       60.8    2e-07   
dbj|BAJ97673.1|  predicted protein                                    60.1    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009383919.1|  PREDICTED: NAC domain-containing protein 78-...  55.5    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383926.1|  PREDICTED: NAC domain-containing protein 78-...  55.1    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418629.1|  PREDICTED: NAC domain-containing protein 78 ...  55.1    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418630.1|  PREDICTED: NAC domain-containing protein 78 ...  54.7    3e-05   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009599412.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=541

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 137/205 (67%), Gaps = 17/205 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ+M FD  +  GND+ + +Q+  A+K+  + T+Q + PNE     E+KND AS
Sbjct  339  FDANDDFQNMGFDPSVLFGNDDQISDQALPAEKNIGEVTQQFIAPNEGL--GEYKNDFAS  396

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EPTK GSD Q+PF+K+AS+MLGNI APPAFASE P KDA LRLN+ +Q SSSV VT
Sbjct  397  SSKLEPTKFGSDHQYPFMKRASKMLGNIHAPPAFASEFPTKDATLRLNSLSQTSSSVQVT  456

Query  391  AGLIQISDLTLGS--------KHGNYTIILSFDFSQGA-----QSPGSLEPVSHGKMLSG  251
            AG  QI D+T+GS        KH +Y I LSF  S+G+     +S  S+ P     ++S 
Sbjct  457  AGF-QIRDMTVGSNGTGWPLGKHADYNIFLSFGISRGSDESAVESFYSIHPGKTTSIISR  515

Query  250  GWFYFLLFWVLILSISVKVGTFIYA  176
            GWFY+L F  L+L +S K+GT I A
Sbjct  516  GWFYYLFFSFLMLCMSFKIGTIICA  540



>ref|XP_009764398.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=542

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 139/206 (67%), Gaps = 17/206 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ+M F+  +  G D+ + + +  ADK+     EQ V P+E+  D   K ++AS
Sbjct  338  FDADDDFQNMGFNPPMMTGGDDHVSDLASLADKNIGKVAEQPVAPSEEPAD--QKTNVAS  395

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EP+K GSD+++PF+KQAS MLG IPAPPAFASE P KDAA R+N++++ASSS+HVT
Sbjct  396  SSKLEPSKFGSDYKYPFMKQASCMLGGIPAPPAFASEFPSKDAAFRMNSSSEASSSIHVT  455

Query  391  AGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH---GKMLSGG-  248
            AG IQI ++T+G         KHGNY I+LSF  SQ A S  SLE V     GK +S   
Sbjct  456  AGYIQIRNMTMGGNGTDGLVGKHGNYNILLSFGLSQHADSSASLESVVSILPGKTISAAS  515

Query  247  --WFYFLLFWVLILSISVKVGTFIYA  176
              WFY+L  WVLILS+S K+GT I A
Sbjct  516  WCWFYYLFSWVLILSMSFKIGTLIRA  541



>ref|XP_009625486.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=542

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 141/206 (68%), Gaps = 17/206 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ+M F+  + IG D+ + + +  ADK+  +  +Q + P+E+  D   K ++AS
Sbjct  338  FDADDDFQNMGFNPPMMIGGDDHVSDLASLADKNIGEVADQPIAPSEEPTD--QKTNVAS  395

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EP+K GSD+++PF+KQAS MLG IPAPPAFASE P KDAA R+N++++ASSS+HVT
Sbjct  396  SSKLEPSKFGSDYKYPFMKQASCMLGGIPAPPAFASEFPSKDAAFRMNSSSEASSSIHVT  455

Query  391  AGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH---GKMLSGG-  248
            AG IQI ++T+          KHGNY I+LSF  SQ A S  SLE V     GK +S   
Sbjct  456  AGYIQIRNITMSGNGTDGLVGKHGNYNILLSFGLSQHADSSASLESVISILPGKTISTAS  515

Query  247  --WFYFLLFWVLILSISVKVGTFIYA  176
              WFY+LL W+LILS+S K+GT I A
Sbjct  516  WCWFYYLLSWILILSMSFKIGTLIRA  541



>ref|XP_009771992.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 136/205 (66%), Gaps = 17/205 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ M FD  +  GND+ + +Q+  A+K+  + T+Q + PNE     E+KND AS
Sbjct  305  FDANDDFQHMGFDPSVLFGNDDQISDQALLAEKNIGEVTQQFIAPNEGL--GENKNDFAS  362

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EPTK GSD Q+PF+K+ASQMLGNI APPAFASE P KDA LRLN+ +Q+SSSV VT
Sbjct  363  SSKLEPTKFGSDRQYPFMKKASQMLGNIHAPPAFASEFPTKDATLRLNSLSQSSSSVQVT  422

Query  391  AGLIQISDLTLGS--------KHGNYTIILSFDFSQGA-----QSPGSLEPVSHGKMLSG  251
            AG  QI D T+GS        K+ +Y IILSF  S+ +     +S  S+ P     ++S 
Sbjct  423  AGF-QIRDTTVGSNGTGWPLGKYADYNIILSFGISRRSDDSAMESFYSIHPGKTTSIISR  481

Query  250  GWFYFLLFWVLILSISVKVGTFIYA  176
            GWFY+L F  L+L +S K+GT I A
Sbjct  482  GWFYYLFFSFLMLCMSFKIGTIICA  506



>ref|XP_009771991.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 136/205 (66%), Gaps = 17/205 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ M FD  +  GND+ + +Q+  A+K+  + T+Q + PNE     E+KND AS
Sbjct  339  FDANDDFQHMGFDPSVLFGNDDQISDQALLAEKNIGEVTQQFIAPNEGL--GENKNDFAS  396

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EPTK GSD Q+PF+K+ASQMLGNI APPAFASE P KDA LRLN+ +Q+SSSV VT
Sbjct  397  SSKLEPTKFGSDRQYPFMKKASQMLGNIHAPPAFASEFPTKDATLRLNSLSQSSSSVQVT  456

Query  391  AGLIQISDLTLGS--------KHGNYTIILSFDFSQGA-----QSPGSLEPVSHGKMLSG  251
            AG  QI D T+GS        K+ +Y IILSF  S+ +     +S  S+ P     ++S 
Sbjct  457  AGF-QIRDTTVGSNGTGWPLGKYADYNIILSFGISRRSDDSAMESFYSIHPGKTTSIISR  515

Query  250  GWFYFLLFWVLILSISVKVGTFIYA  176
            GWFY+L F  L+L +S K+GT I A
Sbjct  516  GWFYYLFFSFLMLCMSFKIGTIICA  540



>ref|XP_004250028.1| PREDICTED: NAC domain-containing protein 78 [Solanum lycopersicum]
Length=528

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 126/198 (64%), Gaps = 12/198 (6%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ+M FD  +F GND+ + +Q+    KD  + T+Q + PNE    +E KN IAS
Sbjct  335  FDANDDFQNMSFDPSVFFGNDDQISDQALLPQKDVGEVTQQPIAPNEGF--SEDKNGIAS  392

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK  PTK  SD+Q+PFIKQASQMLGNI APPAFASE P KDA LRLN+ ++++SSV VT
Sbjct  393  SSKLVPTKFESDYQYPFIKQASQMLGNIHAPPAFASEFPTKDAILRLNSFSRSASSVQVT  452

Query  391  AGLIQISDLTLGSKHGNYTIILSFDFSQGAQSPG------SLEPVSHGKMLSGGWFYFLL  230
            AG    +   LG KH  Y IILS   S+G+           + P      +S GWF +L 
Sbjct  453  AG--NGTRWPLG-KHVYYNIILSLGLSRGSSDDSSMDSFHKIHPGKTTSTISRGWFCYLF  509

Query  229  FWVLILSISVKVGTFIYA  176
            F  L+L +S+++GT I A
Sbjct  510  FSFLMLLMSLRIGTIICA  527



>ref|XP_004239710.1| PREDICTED: NAC domain-containing protein 78-like [Solanum lycopersicum]
Length=544

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 134/206 (65%), Gaps = 18/206 (9%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D+FQ M F+  +  G+D+ + + +   +K+  +  +Q + P+E+  D   K ++AS
Sbjct  341  FDADDNFQSMGFNPPMMTGDDDHVSDLASVEEKNIAEVNDQPIAPSEEPDD--QKKNVAS  398

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EP+K GSD+++PF+KQ S MLG IPAPPAFASE P K+AALR+N++++ASSS+HVT
Sbjct  399  SSKLEPSKFGSDYKYPFMKQTSCMLGGIPAPPAFASEFPSKNAALRMNSSSEASSSIHVT  458

Query  391  AGLIQISDLTLGS--------KHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLS  254
             G I+I+++T+ S        KHGNY +ILS   SQ   S   LE      P      +S
Sbjct  459  -GFIRITNMTVSSNGMDGLVGKHGNYNVILSLGLSQHGDSSAHLESEASFLPGKTISTVS  517

Query  253  GGWFYFLLFWVLILSISVKVGTFIYA  176
              WFY+L  WVL+LS + K+GTFI A
Sbjct  518  WCWFYYLFLWVLLLSTTFKIGTFIRA  543



>ref|XP_006345843.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=544

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 130/206 (63%), Gaps = 18/206 (9%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D+FQ M F+  +    D+ + + +   +K+  +  +Q + P+E+  D   K ++AS
Sbjct  341  FDADDNFQSMGFNPPMMTEGDDHVSDLASPEEKNIGEVNDQPIAPSEEPED--QKKNVAS  398

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK EP+K GSD+++PF+KQAS MLG IPAPPAFASE P K AALR+N++++ASSS+HVT
Sbjct  399  SSKLEPSKFGSDYKYPFMKQASCMLGGIPAPPAFASEFPSKSAALRMNSSSEASSSIHVT  458

Query  391  AGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLS  254
             G IQI+++T+          KHGNY +ILS   SQ   S   LE      P      +S
Sbjct  459  -GFIQITNMTMSGNGMDELVGKHGNYNVILSLGLSQHGDSSAHLESAVSFLPGKTISTVS  517

Query  253  GGWFYFLLFWVLILSISVKVGTFIYA  176
              WFY+L  WVLILS + KVGT I A
Sbjct  518  WCWFYYLFLWVLILSTTFKVGTLIRA  543



>gb|EYU39671.1| hypothetical protein MIMGU_mgv1a003896mg [Erythranthe guttata]
Length=557

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 127/199 (64%), Gaps = 7/199 (4%)
 Frame = -1

Query  748  YDAKDDFQD-MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA +D  D  +FDS + + N++ + +Q+    ++  + TEQ  LP+E+  +  + N  A
Sbjct  359  FDANNDNSDHFMFDSSMILENEDLVSDQTLLLQEELDNGTEQCNLPSEQLDNNNNDNSSA  418

Query  571  SSSKPEP-TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            SSS      K  SD+++PF+KQASQMLG IPAPPAFASE P KDAALRLN+ +Q SSSVH
Sbjct  419  SSSDNLDSAKYESDYKYPFMKQASQMLGKIPAPPAFASEFPLKDAALRLNSLSQPSSSVH  478

Query  397  VTAGLIQISDLTLG----SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLL  230
            VTAG+IQI+D   G     KH N+ I+LSF FS    S  S  P      +S GW YF+ 
Sbjct  479  VTAGMIQITDGRGGDQLLGKHENFNIVLSFGFSANMDSSFSALPGKAASTVSRGWLYFMF  538

Query  229  FWVLILSISVKVGTFIYAR  173
             WVLILS+S K+G  I A+
Sbjct  539  LWVLILSVSFKIGICICAK  557



>ref|XP_007010050.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18860.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
Length=590

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 127/204 (62%), Gaps = 19/204 (9%)
 Frame = -1

Query  733  DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPE  554
            D Q + FDSD  +G++  + +Q P A   +   TEQ    +E     E  N  ASSSK E
Sbjct  389  DDQPLAFDSDQMVGSEIPVSDQEPLAQTHSNGGTEQVSNASEHL--EELGNSDASSSKQE  446

Query  553  --PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGL  383
              PTK  S  ++PF+KQAS MLG+ PAPPAFASE P KDAAL+LN+A QASSSVHV AG+
Sbjct  447  LEPTKFESGTKYPFLKQASHMLGSFPAPPAFASEFPSKDAALKLNSAAQASSSVHVVAGM  506

Query  382  IQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH------GKMLSGGW  245
            I+I+++T          SK+GN  I+LSF   QG  +  +  P++       G +L+ GW
Sbjct  507  IRITNMTSSGNQLDWSHSKNGNVNIVLSFSLPQGDVNSSNFLPMASLLSGKAGSVLARGW  566

Query  244  FYFLLFWVLILSISVKVGTFIYAR  173
            F+ +L WVLI+++S+K GT IY R
Sbjct  567  FFLMLLWVLIITVSLKFGTCIYTR  590



>ref|XP_006361710.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 125/206 (61%), Gaps = 17/206 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ+M FD  +F GND+ + +Q+   +KD  + T+Q + PNE     E KN  A+
Sbjct  339  FDANDDFQNMSFDPSVFFGNDDQISDQALLPEKDVGEVTQQPIAPNEGF--GEDKNGFAA  396

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK  PTK GSD+Q PF+KQASQMLGNI APPAFASE P KDA LRLN+ ++++S V VT
Sbjct  397  SSKLVPTKFGSDYQLPFMKQASQMLGNIHAPPAFASEFPTKDAILRLNSLSRSASPVQVT  456

Query  391  AGLIQISDLTLG--------SKHGNYTII------LSFDFSQGAQSPGSLEPVSHGKMLS  254
            A LI+I D++ G         KH  Y II       S        S  S+ P      +S
Sbjct  457  ADLIRIRDMSAGGNGTRWPLGKHVYYNIILSLGLSRSSSDDSSMDSFHSIHPGKTTSTIS  516

Query  253  GGWFYFLLFWVLILSISVKVGTFIYA  176
             GWF +L F  L+L +S+++GT I A
Sbjct  517  RGWFCYLFFSFLMLLMSLRIGTTICA  542



>ref|XP_006361711.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Solanum 
tuberosum]
Length=563

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 125/206 (61%), Gaps = 17/206 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DDFQ+M FD  +F GND+ + +Q+   +KD  + T+Q + PNE     E KN  A+
Sbjct  359  FDANDDFQNMSFDPSVFFGNDDQISDQALLPEKDVGEVTQQPIAPNEGF--GEDKNGFAA  416

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
            SSK  PTK GSD+Q PF+KQASQMLGNI APPAFASE P KDA LRLN+ ++++S V VT
Sbjct  417  SSKLVPTKFGSDYQLPFMKQASQMLGNIHAPPAFASEFPTKDAILRLNSLSRSASPVQVT  476

Query  391  AGLIQISDLTLG--------SKHGNYTII------LSFDFSQGAQSPGSLEPVSHGKMLS  254
            A LI+I D++ G         KH  Y II       S        S  S+ P      +S
Sbjct  477  ADLIRIRDMSAGGNGTRWPLGKHVYYNIILSLGLSRSSSDDSSMDSFHSIHPGKTTSTIS  536

Query  253  GGWFYFLLFWVLILSISVKVGTFIYA  176
             GWF +L F  L+L +S+++GT I A
Sbjct  537  RGWFCYLFFSFLMLLMSLRIGTTICA  562



>ref|XP_010090439.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB39454.1| NAC domain-containing protein 78 [Morus notabilis]
Length=612

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 125/208 (60%), Gaps = 16/208 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +D +DD Q + FDS   +G +  L ++ P   K      E +    ++  +    N+ ++
Sbjct  405  FDVEDDSQLLAFDSSQIMGIENSLTQEEPPLQKLVTGEAEASPTGTQQPAEAHDNNEAST  464

Query  568  SS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  395
            SS + E TK  SDF++PF+KQASQMLG+IPAPPAFA+E P KDAALRLN+   +S SVHV
Sbjct  465  SSQRAEVTKSESDFKYPFMKQASQMLGSIPAPPAFAAEFPTKDAALRLNSVGTSSGSVHV  524

Query  394  TAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVS------HGKML  257
            TAG+I+I  L L          K G+  ++LS+   Q A    ++ P++       G ++
Sbjct  525  TAGMIRIQHLNLDGNGMDWSFGKSGDVNLLLSYSLPQAAFDSATVVPMAGILSGKAGSVV  584

Query  256  SGGWFYFLLFWVLILSISVKVGTFIYAR  173
            S GWF+F+  WVLI+S+S KVG +IY R
Sbjct  585  SKGWFFFMFIWVLIISVSFKVGNYIYTR  612



>ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum]
Length=563

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 122/204 (60%), Gaps = 18/204 (9%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS-SSK  560
            D+ Q   +D  + +G++E + +Q+    +   +T +  +L  +  +D  + ND AS S K
Sbjct  362  DNAQHFAYDPSVMLGSEELISDQALLPQELNGETEKSTLLSGQ--IDDNNDNDAASPSDK  419

Query  559  PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGL  383
             +  K  SD Q+PFIKQAS MLG+IPAPPAFA+E P K   LRLN+ +Q SSSVHVTAG+
Sbjct  420  QDSAKYESDVQYPFIKQASHMLGSIPAPPAFAAEFPSKSTTLRLNSLSQPSSSVHVTAGM  479

Query  382  IQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLSGGW  245
            IQI +LT           K  N+ I+LSF FS+G     SLE      P      LS GW
Sbjct  480  IQIRNLTTDGNGRVQSFGKPENFNIVLSFGFSRGNDGSASLESSVSILPGKTLSTLSRGW  539

Query  244  FYFLLFWVLILSISVKVGTFIYAR  173
            F F+ FWVLILS+S K+GT I A+
Sbjct  540  FCFIFFWVLILSMSFKIGTCICAK  563



>gb|AGL39700.1| NAC transcription factor 044 [Jatropha curcas]
 gb|KDP45077.1| hypothetical protein JCGZ_01577 [Jatropha curcas]
Length=563

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 128/210 (61%), Gaps = 22/210 (10%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA DD  ++ FD    +G +  + +Q    +KD  +   +AV      +   H N+ AS
Sbjct  358  FDANDD--NLTFDPSELMGTEYAIPDQDHLFEKD-VNGGAKAVPVVTSELSEAHGNNDAS  414

Query  568  SSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            SSK   PE T   SD ++PF+KQASQMLG+IPAPPAFASE P KD AL+LNAA Q+SSS+
Sbjct  415  SSKQLKPEATMFESDMKYPFMKQASQMLGSIPAPPAFASEFPVKDRALQLNAA-QSSSSI  473

Query  400  HVTAGLIQISDLTLGS--------KHGNYTIILSFDFSQGAQSPGSLEPVS---HGKML-  257
             VTAG+I+I ++T GS        K+ N  IILSFD +Q    P SL P+     GK + 
Sbjct  474  RVTAGVIRIENITFGSSGMDWSSNKNQNVNIILSFDMAQANVGPASLVPMGSFFSGKAMS  533

Query  256  --SGGWFYFLLFWVLILSISVKVGTFIYAR  173
              S GW++ + FWVLI S + K+GT++  +
Sbjct  534  TVSRGWYFLMFFWVLIFSATFKIGTYVCTK  563



>ref|XP_007218872.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
 gb|EMJ20071.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
Length=590

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 119/209 (57%), Gaps = 17/209 (8%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD    + FDS   +G +  + +QSP   K     TEQ  +  E     E  ND +
Sbjct  382  FDADDDISQYIDFDSCGMMGVENSVPDQSPVDQKLGNGETEQLPMGVEHLAQAEDTNDAS  441

Query  571  SSSKPEPTKLGSDFQHPFIKQASQ-MLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            SS +    KL SD  +PFIK+AS  MLGNIPAPPAFASE P KDA LRLN+   +SSSVH
Sbjct  442  SSKQKPEFKLESDVNYPFIKKASHMMLGNIPAPPAFASEFPAKDAILRLNSGAASSSSVH  501

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPV------SHGKM  260
            +TAG+I+I D+T           K G   ++ S   SQ   + G+L P+        G +
Sbjct  502  LTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPMDGSLSGKTGCV  561

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +  GWF F+ FWVL LS+S K+G+++Y R
Sbjct  562  VMRGWFLFMFFWVLFLSMSFKIGSYVYTR  590



>ref|XP_008232319.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Prunus 
mume]
Length=590

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 119/209 (57%), Gaps = 17/209 (8%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD    + FDS   +G +  + +QSP   K     TEQ  +  E     E  ND +
Sbjct  382  FDADDDISQYIDFDSCGMMGVENSVPDQSPVDQKLVNGETEQLPMGVEHLAQAEDTNDAS  441

Query  571  SSSKPEPTKLGSDFQHPFIKQASQ-MLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            SS +    KL SD  +PFIK+AS  MLGNIPAPPAFASE P KDA LRLN+ + +SS VH
Sbjct  442  SSEQKPEFKLESDVNYPFIKKASHMMLGNIPAPPAFASEFPAKDAILRLNSGSASSSPVH  501

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPV------SHGKM  260
            +TAG+I+I D+T           K G   ++ S   SQ   + G+L P+        G +
Sbjct  502  ITAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPMDGSLSGKTGCV  561

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +  GWF F+ FWVL LS+S K+G+++Y R
Sbjct  562  VMRGWFLFMFFWVLFLSMSFKIGSYVYTR  590



>ref|XP_011031619.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=502

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 128/209 (61%), Gaps = 22/209 (11%)
 Frame = -1

Query  748  YDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D  ++M FD SDIF  +D  +  Q P   +D    TE+ +   +K ++T    D +
Sbjct  299  FDADD--ENMSFDPSDIF-ASDIAVSNQQPPPQEDVKGGTEEVLKAIQKPLETHGNVDPS  355

Query  571  SSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            SS  KP+  +  S F++PFIKQAS MLG IPAPPA ASE P KDAALR+ +A+  SSS+H
Sbjct  356  SSKQKPDAMEFDSGFKYPFIKQASHMLGKIPAPPALASEFPSKDAALRIQSAS--SSSIH  413

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVS---HGK---M  260
            VTAG+I+I +++LG         K+GN  +I SF   Q    P S  P++    GK   +
Sbjct  414  VTAGMIRIENMSLGGNGAEWSFGKNGNIDVIFSFGLPQQEGGPASWVPMTSLFSGKAESV  473

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +S GW + + FWVLILS+S K+GT I A+
Sbjct  474  VSRGWLFLMFFWVLILSVSYKIGTCICAK  502



>ref|XP_011031618.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=556

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 128/209 (61%), Gaps = 22/209 (11%)
 Frame = -1

Query  748  YDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D  ++M FD SDIF  +D  +  Q P   +D    TE+ +   +K ++T    D +
Sbjct  353  FDADD--ENMSFDPSDIF-ASDIAVSNQQPPPQEDVKGGTEEVLKAIQKPLETHGNVDPS  409

Query  571  SSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            SS  KP+  +  S F++PFIKQAS MLG IPAPPA ASE P KDAALR+ +A+  SSS+H
Sbjct  410  SSKQKPDAMEFDSGFKYPFIKQASHMLGKIPAPPALASEFPSKDAALRIQSAS--SSSIH  467

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVS---HGK---M  260
            VTAG+I+I +++LG         K+GN  +I SF   Q    P S  P++    GK   +
Sbjct  468  VTAGMIRIENMSLGGNGAEWSFGKNGNIDVIFSFGLPQQEGGPASWVPMTSLFSGKAESV  527

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +S GW + + FWVLILS+S K+GT I A+
Sbjct  528  VSRGWLFLMFFWVLILSVSYKIGTCICAK  556



>ref|XP_011101545.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Sesamum 
indicum]
 ref|XP_011101546.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Sesamum 
indicum]
Length=459

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 127/200 (64%), Gaps = 13/200 (7%)
 Frame = -1

Query  748  YDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D +  D  +D  + +G+++ + +++    K  C+ TE+A+LP  K +D +  ND A
Sbjct  259  FDANDGNSLDFAYDPALMLGSEDLVPDKAKLPHKGLCEGTEKAILPMGKLMD-DINNDAA  317

Query  571  SS-SKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            S   + +     SDFQ+ F+++ASQMLGNIPAP AFA+E P KDA LRLN++TQ+SSSVH
Sbjct  318  SVFDEKQSENNQSDFQYQFVRKASQMLGNIPAPSAFAAEFPSKDAILRLNSSTQSSSSVH  377

Query  397  VTAGLIQISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLSGGW  245
            VT+G+IQI +L      +KH N  I+LSF  S+      SLE      P      +S GW
Sbjct  378  VTSGMIQIRNLNTDGAFAKHENLNILLSFGLSRSDDGSSSLESSVRILPGKVASSISKGW  437

Query  244  FYFLLFWVLILSISVKVGTF  185
            FYF+ FWVLILS+S K+ T+
Sbjct  438  FYFMFFWVLILSVSFKIATY  457



>ref|XP_011101544.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Sesamum 
indicum]
Length=542

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 127/200 (64%), Gaps = 13/200 (7%)
 Frame = -1

Query  748  YDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D +  D  +D  + +G+++ + +++    K  C+ TE+A+LP  K +D +  ND A
Sbjct  342  FDANDGNSLDFAYDPALMLGSEDLVPDKAKLPHKGLCEGTEKAILPMGKLMD-DINNDAA  400

Query  571  SS-SKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            S   + +     SDFQ+ F+++ASQMLGNIPAP AFA+E P KDA LRLN++TQ+SSSVH
Sbjct  401  SVFDEKQSENNQSDFQYQFVRKASQMLGNIPAPSAFAAEFPSKDAILRLNSSTQSSSSVH  460

Query  397  VTAGLIQISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLSGGW  245
            VT+G+IQI +L      +KH N  I+LSF  S+      SLE      P      +S GW
Sbjct  461  VTSGMIQIRNLNTDGAFAKHENLNILLSFGLSRSDDGSSSLESSVRILPGKVASSISKGW  520

Query  244  FYFLLFWVLILSISVKVGTF  185
            FYF+ FWVLILS+S K+ T+
Sbjct  521  FYFMFFWVLILSVSFKIATY  540



>ref|XP_011101543.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Sesamum 
indicum]
Length=547

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 127/200 (64%), Gaps = 13/200 (7%)
 Frame = -1

Query  748  YDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D +  D  +D  + +G+++ + +++    K  C+ TE+A+LP  K +D +  ND A
Sbjct  347  FDANDGNSLDFAYDPALMLGSEDLVPDKAKLPHKGLCEGTEKAILPMGKLMD-DINNDAA  405

Query  571  SS-SKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            S   + +     SDFQ+ F+++ASQMLGNIPAP AFA+E P KDA LRLN++TQ+SSSVH
Sbjct  406  SVFDEKQSENNQSDFQYQFVRKASQMLGNIPAPSAFAAEFPSKDAILRLNSSTQSSSSVH  465

Query  397  VTAGLIQISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLSGGW  245
            VT+G+IQI +L      +KH N  I+LSF  S+      SLE      P      +S GW
Sbjct  466  VTSGMIQIRNLNTDGAFAKHENLNILLSFGLSRSDDGSSSLESSVRILPGKVASSISKGW  525

Query  244  FYFLLFWVLILSISVKVGTF  185
            FYF+ FWVLILS+S K+ T+
Sbjct  526  FYFMFFWVLILSVSFKIATY  545



>ref|XP_011024334.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=556

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 127/208 (61%), Gaps = 21/208 (10%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D  +++ FD    +G++  + +Q     +D    TE+    ++  ++T    D +S
Sbjct  354  FDAVD--ENLSFDPSDILGSETAVSDQQLPPQEDVKGRTEELSTASQNLLETHGTIDPSS  411

Query  568  SS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  395
            S  KPE  K  SDF++PFIKQAS  LGNIPAPPA ASE P KDAALRL+ A+  SSS++V
Sbjct  412  SKQKPEGMKFDSDFKYPFIKQASHRLGNIPAPPALASEFPSKDAALRLHPAS--SSSINV  469

Query  394  TAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH---GK---ML  257
            TAG+I+I +++LG         K+GN  IILSF   Q    P SL P++    GK   ++
Sbjct  470  TAGMIRIENMSLGGNEMQWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFLGKTESVV  528

Query  256  SGGWFYFLLFWVLILSISVKVGTFIYAR  173
            S GW Y + FWVLILS+S K GT I A+
Sbjct  529  SRGWLYLMFFWVLILSVSYKFGTCICAK  556



>gb|AIA57516.1| NAC domain-containing protein [Boehmeria nivea]
Length=631

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 131/210 (62%), Gaps = 23/210 (11%)
 Frame = -1

Query  748  YDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLP-NEKAVDTEHKN-D  578
            +DA++ + Q    DS   +G +  + EQ P        T E  +LP   K V   H N  
Sbjct  422  FDAEEGNIQFPALDSSQNVGVENSVTEQEPQK----LVTGEAELLPMGTKQVVEAHDNIH  477

Query  577  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  407
            +ASSS  K E TK  SDF+HP +KQASQMLG+IPAPPAFASE P K+AALRL++A QASS
Sbjct  478  VASSSNKKAEVTKSESDFKHPLLKQASQMLGSIPAPPAFASEFPTKEAALRLHSAAQASS  537

Query  406  SVHVTAGLIQISDL---------TLGSKHGNYTIILS-FDFSQGAQSPGSLEPVS--HGK  263
            SVHVTAG+I+I +L         + G K+G+  ++LS +   Q   S  ++ P+S   G 
Sbjct  538  SVHVTAGMIRIRNLNPEGNAMDWSFG-KNGDVDLLLSYYSMPQADVSTSAMVPLSGKTGC  596

Query  262  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +++ GWF F+  WVLI+S+S KVG+F+Y R
Sbjct  597  VVTKGWFMFMFIWVLIMSVSFKVGSFMYTR  626



>ref|XP_008232318.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Prunus 
mume]
Length=591

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 120/210 (57%), Gaps = 18/210 (9%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTEQAVLPNEKAVDTEHKNDI  575
            +DA DD    + FDS   +G +  + +QSP   K   +  TEQ  +  E     E  ND 
Sbjct  382  FDADDDISQYIDFDSCGMMGVENSVPDQSPVDQKQLVNGETEQLPMGVEHLAQAEDTNDA  441

Query  574  ASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            +SS +    KL SD  +PFIK+AS M LGNIPAPPAFASE P KDA LRLN+ + +SS V
Sbjct  442  SSSEQKPEFKLESDVNYPFIKKASHMMLGNIPAPPAFASEFPAKDAILRLNSGSASSSPV  501

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPV------SHGK  263
            H+TAG+I+I D+T           K G   ++ S   SQ   + G+L P+        G 
Sbjct  502  HITAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPMDGSLSGKTGC  561

Query  262  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            ++  GWF F+ FWVL LS+S K+G+++Y R
Sbjct  562  VVMRGWFLFMFFWVLFLSMSFKIGSYVYTR  591



>ref|XP_006436536.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485307.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Citrus 
sinensis]
 gb|ESR49776.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=549

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 21/212 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P   +   + T+Q  +  +  V+  H ND+A
Sbjct  339  FDANDDNSEYLTFDASEILGSGDNNSDQVPLTTEQVTEVTDQMSMAGQHQVEV-HGNDVA  397

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  398  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  457

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPG--SLEPVSH------  269
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   SP   S EP  +      
Sbjct  458  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSHTSFEPAGNIFSGKT  517

Query  268  GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            G ++    +  L  W++ILS+  K+G  + A+
Sbjct  518  GSVVFRSLWLLLFLWIVILSVGFKIGACVSAK  549



>emb|CDO99814.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 110/172 (64%), Gaps = 20/172 (12%)
 Frame = -1

Query  640  DTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFAS  461
            ++ E+A    E +     + D+ASSSK EPTK    FQ+PFIKQAS+MLG+IPAPPAFAS
Sbjct  415  ESEEKAQSAEESSEKLLGRGDVASSSKEEPTK--EYFQYPFIKQASRMLGSIPAPPAFAS  472

Query  460  EIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------KHGNYTIILSFDFSQ  308
            E P +DA L L+ ++  SS+ HVTAG+IQI ++  GS        KHG Y ++LSF  S+
Sbjct  473  EFPSEDATLLLDPSS--SSTAHVTAGMIQIGNIGPGSHGMDWLFGKHGRYNVVLSFGLSR  530

Query  307  GAQSPGSLEPV---SHGKM----LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            G  +  +LE V     GK     +S GWF F+ FWVLILS+  K+GT I AR
Sbjct  531  GDDNSTTLESVVSIRPGKAAASGMSRGWFCFIFFWVLILSVGFKIGTCICAR  582



>ref|XP_006378789.1| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|ERP56586.1| NAC domain-containing protein 78 [Populus trichocarpa]
Length=554

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 130/209 (62%), Gaps = 24/209 (11%)
 Frame = -1

Query  748  YDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D  ++M FD SDIF G++  + +Q P  + D    TE+    +   ++T    D +
Sbjct  353  FDAVD--ENMSFDPSDIF-GSETAVSDQLPPQE-DVKGQTEELSTASLNLLETHGTIDPS  408

Query  571  SSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            SS  KPE  K  SDF++PFIKQAS  LGNIPAPPA ASE P KDAAL L+ A+  SSS++
Sbjct  409  SSKQKPEAMKFDSDFKYPFIKQASHRLGNIPAPPALASEFPSKDAALHLHPAS--SSSIN  466

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH---GK---M  260
            VTAG+I+I +++LG         K+GN  IILSF   Q    P SL P++    GK   +
Sbjct  467  VTAGMIRIENMSLGGNEMEWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFPGKTESV  525

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +S GW Y + FWVLILS+S K+GT I A+
Sbjct  526  VSRGWLYLMFFWVLILSVSYKIGTCICAK  554



>ref|XP_011024333.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=558

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 23/210 (11%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D  +++ FD    +G++  + +Q     +D    TE+    ++  ++T    D +S
Sbjct  354  FDAVD--ENLSFDPSDILGSETAVSDQQLPPQEDVKGRTEELSTASQNLLETHGTIDPSS  411

Query  568  SS-KPEPTKL--GSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S  KPE  K   G+DF++PFIKQAS  LGNIPAPPA ASE P KDAALRL+ A+  SSS+
Sbjct  412  SKQKPEGMKFDSGADFKYPFIKQASHRLGNIPAPPALASEFPSKDAALRLHPAS--SSSI  469

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH---GK---  263
            +VTAG+I+I +++LG         K+GN  IILSF   Q    P SL P++    GK   
Sbjct  470  NVTAGMIRIENMSLGGNEMQWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFLGKTES  528

Query  262  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            ++S GW Y + FWVLILS+S K GT I A+
Sbjct  529  VVSRGWLYLMFFWVLILSVSYKFGTCICAK  558



>ref|XP_006436534.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 gb|ESR49774.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=476

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 22/212 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  267  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  324

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  325  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  384

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPG--SLEPVSH------  269
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   SP   S EP  +      
Sbjct  385  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSHTSFEPAGNIFSGKT  444

Query  268  GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            G ++    +  L  W++ILS+  K+G  + A+
Sbjct  445  GSVVFRSLWLLLFLWIVILSVGFKIGACVSAK  476



>ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
 gb|EEF01509.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
Length=556

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 131/211 (62%), Gaps = 26/211 (12%)
 Frame = -1

Query  748  YDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D  ++M FD SDIF G++  + +Q P  + D    TE+    +   ++T    D +
Sbjct  353  FDAVD--ENMSFDPSDIF-GSETAVSDQLPPQE-DVKGQTEELSTASLNLLETHGTIDPS  408

Query  571  SSS-KPEPTKL--GSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
            SS  KPE  K   G+DF++PFIKQAS  LGNIPAPPA ASE P KDAAL L+ A+  SSS
Sbjct  409  SSKQKPEAMKFDSGADFKYPFIKQASHRLGNIPAPPALASEFPSKDAALHLHPAS--SSS  466

Query  403  VHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH---GK--  263
            ++VTAG+I+I +++LG         K+GN  IILSF   Q    P SL P++    GK  
Sbjct  467  INVTAGMIRIENMSLGGNEMEWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFPGKTE  525

Query  262  -MLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
             ++S GW Y + FWVLILS+S K+GT I A+
Sbjct  526  SVVSRGWLYLMFFWVLILSVSYKIGTCICAK  556



>ref|XP_006436535.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485308.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Citrus 
sinensis]
 gb|ESR49775.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=548

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 22/212 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  339  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  396

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  397  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  456

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPG--SLEPVSH------  269
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   SP   S EP  +      
Sbjct  457  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSHTSFEPAGNIFSGKT  516

Query  268  GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            G ++    +  L  W++ILS+  K+G  + A+
Sbjct  517  GSVVFRSLWLLLFLWIVILSVGFKIGACVSAK  548



>ref|XP_009346099.1| PREDICTED: NAC domain-containing protein 78-like [Pyrus x bretschneideri]
Length=230

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 124/224 (55%), Gaps = 34/224 (15%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTE------QAVLPNEKAVDT  593
            +DA DD    + FDS   +G + ++ +++P+  K   +  TE      + V P  + +  
Sbjct  9    FDANDDISQYIDFDSCGMMGVENYVPDEAPADQKQLVNGETEPQPMGGEHVQPEPQPMGG  68

Query  592  EH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  437
            EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  
Sbjct  69   EHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMR  128

Query  436  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE  281
            RLN+   +SSSVHVTAG+I+I D+T           K G   ++ S    Q   + G+L 
Sbjct  129  RLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNLV  188

Query  280  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  189  PV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  230



>ref|XP_002265345.2| PREDICTED: NAC domain-containing protein 78 [Vitis vinifera]
 emb|CBI31389.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 121/206 (59%), Gaps = 19/206 (9%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK-  560
            D+ Q M F S   +G++  L + +P  D++  +   + +    + +   + +  ASSSK 
Sbjct  355  DNLQQMAFGSFEMMGSENPLSDLAP-LDQEPVNGGAEKLPIGSQQLSEAYGDSGASSSKK  413

Query  559  -PEPTKLGSDFQHPFIKQAS-QMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTA  389
             PE T+  SD  +PFIKQAS Q+LG IPAP A AS+ P KD ALRLN+A Q+SSSVH+TA
Sbjct  414  NPEATEFESDIPYPFIKQASYQLLGGIPAPFASASDAPTKDVALRLNSAMQSSSSVHLTA  473

Query  388  GLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH------GKMLSG  251
            G+IQI D TL          K GN   +LSF   QG  +  SLEP++       G ++S 
Sbjct  474  GMIQIRDTTLSGNGVDWSYGKSGNINFMLSFGLPQGETNSASLEPIASLMSGKAGPVISR  533

Query  250  GWFYFLLFWVLILSISVKVGTFIYAR  173
              FY +  WVLILS+S K+GT I +R
Sbjct  534  AGFYLIFIWVLILSVSYKIGTCICSR  559



>ref|XP_009346651.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Pyrus 
x bretschneideri]
Length=607

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 123/223 (55%), Gaps = 33/223 (15%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE------QAVLPNEKAVDTE  590
            +DA DD    + FDS   +G + ++ +++P+  K     TE      + V P  + +  E
Sbjct  387  FDANDDISQYIDFDSCGMMGVENYVPDEAPADQKLVNGETEPQPMGGEHVQPEPQPMGGE  446

Query  589  H------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAALR  434
            H       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  R
Sbjct  447  HLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMRR  506

Query  433  LNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEP  278
            LN+   +SSSVHVTAG+I+I D+T           K G   ++ S    Q   + G+L P
Sbjct  507  LNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNLVP  566

Query  277  VSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            V  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  567  V--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  607



>gb|ADL36811.1| NAC domain class transcription factor [Malus domestica]
Length=607

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 123/223 (55%), Gaps = 33/223 (15%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE------QAVLPNEKAVDTE  590
            +DA DD    + FDS   +G + ++ +++P+  K     TE      + V P  + +  E
Sbjct  387  FDANDDISQYIDFDSYGMMGVENYVPDEAPADQKLVNGETEPQPMGGEHVQPEPQPLGGE  446

Query  589  H------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAALR  434
            H       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  R
Sbjct  447  HLVQPVDTDDASSSKKTAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMRR  506

Query  433  LNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEP  278
            LN+   +SSSVHVTA +I+I D+T           K G   ++ S   SQ   + G+L P
Sbjct  507  LNSGAASSSSVHVTAAMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQDDGNSGNLVP  566

Query  277  VSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            V  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  567  V--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  607



>ref|XP_006379522.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
 gb|ERP57319.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
Length=581

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 129/210 (61%), Gaps = 24/210 (11%)
 Frame = -1

Query  748  YDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D  ++M FD SDIF  +D  +  Q P   +D    T++ +   +K ++T H N   
Sbjct  378  FDADD--ENMSFDPSDIF-ASDTAVSNQQPPPQEDVKGGTDEVLKAIQKPLET-HGNVGP  433

Query  571  SSSK--PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            SSSK  PE  +  SDF++PFIKQAS MLG IPAPPA ASE P KDAALR    + +SSS+
Sbjct  434  SSSKQKPEAMEFDSDFKYPFIKQASHMLGKIPAPPALASEFPSKDAALR--LRSASSSSI  491

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVS---HGK---  263
            HVTAG+I+I +++LG         K+GN  +ILSF   Q    P S  P++    GK   
Sbjct  492  HVTAGVIRIENMSLGGNGTEWSFGKNGNVDVILSFGLPQQEGGPASWVPMTSLFSGKAES  551

Query  262  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            ++S GW + + FWVLILS+S K+GT I A+
Sbjct  552  VVSRGWLFLMFFWVLILSVSYKIGTCICAK  581



>ref|XP_009346652.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Pyrus 
x bretschneideri]
Length=607

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 124/224 (55%), Gaps = 34/224 (15%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTE------QAVLPNEKAVDT  593
            +DA DD    + FDS   +G + ++ +++P+  K   +  TE      + V P  + +  
Sbjct  386  FDANDDISQYIDFDSCGMMGVENYVPDEAPADQKQLVNGETEPQPMGGEHVQPEPQPMGG  445

Query  592  EH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  437
            EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  
Sbjct  446  EHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMR  505

Query  436  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE  281
            RLN+   +SSSVHVTAG+I+I D+T           K G   ++ S    Q   + G+L 
Sbjct  506  RLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNLV  565

Query  280  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  566  PV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  607



>ref|XP_009346650.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Pyrus 
x bretschneideri]
Length=608

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 124/224 (55%), Gaps = 34/224 (15%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTE------QAVLPNEKAVDT  593
            +DA DD    + FDS   +G + ++ +++P+  K   +  TE      + V P  + +  
Sbjct  387  FDANDDISQYIDFDSCGMMGVENYVPDEAPADQKQLVNGETEPQPMGGEHVQPEPQPMGG  446

Query  592  EH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  437
            EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  
Sbjct  447  EHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMR  506

Query  436  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE  281
            RLN+   +SSSVHVTAG+I+I D+T           K G   ++ S    Q   + G+L 
Sbjct  507  RLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNLV  566

Query  280  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  567  PV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  608



>ref|XP_010543581.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=567

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 117/205 (57%), Gaps = 17/205 (8%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +D  D+    L FD+   +G ++ +       +K   +  E+     E  V+ + K D A
Sbjct  367  FDIDDEITAQLSFDASQLVGTEDSVPRLEDLTEKAEREGLEKETTTCEHLVEGKDK-DEA  425

Query  571  SSSK--PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S SK  P+ T   SD ++PF+K+AS MLG IPAPPAFASE P KDAA+RL++A Q+S SV
Sbjct  426  SCSKHDPDATPFESDSKYPFLKKASHMLGGIPAPPAFASEFPTKDAAIRLHSAAQSSGSV  485

Query  400  HVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGG  248
            HVTAG+I+IS +T+           K+GN  ++ S    QGA +  S +    G  LS  
Sbjct  486  HVTAGMIRISSMTVAEGSGMDWSYGKNGNLNVVFSLGLVQGADTGLSGKT---GATLSRA  542

Query  247  WFYFLLFWVLILSISVKVGTFIYAR  173
                + FWVLILS+S KVGT + AR
Sbjct  543  MLILVCFWVLILSVSFKVGTIVSAR  567



>ref|XP_002311983.2| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|EEE89350.2| NAC domain-containing protein 78 [Populus trichocarpa]
Length=568

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 123/204 (60%), Gaps = 25/204 (12%)
 Frame = -1

Query  748  YDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA D  ++M FD SDIF  +D  +  Q P   +D    T++ +   +K ++T H N   
Sbjct  378  FDADD--ENMSFDPSDIF-ASDTAVSNQQPPPQEDVKGGTDEVLKAIQKPLET-HGNVGP  433

Query  571  SSSK--PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            SSSK  PE  +  SDF++PFIKQAS MLG IPAPPA ASE P KDAALR    + +SSS+
Sbjct  434  SSSKQKPEAMEFDSDFKYPFIKQASHMLGKIPAPPALASEFPSKDAALR--LRSASSSSI  491

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGW  245
            HVTAG+I+I +++LG         K+GN  +ILSF   Q    P          ++S GW
Sbjct  492  HVTAGVIRIENMSLGGNGTEWSFGKNGNVDVILSFGLPQQEGGPAK-------SVVSRGW  544

Query  244  FYFLLFWVLILSISVKVGTFIYAR  173
             + + FWVLILS+S K+GT I A+
Sbjct  545  LFLMFFWVLILSVSYKIGTCICAK  568



>gb|KDO47584.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=549

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 17/180 (9%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P   +   + T+Q  +  +  V+  H ND+A
Sbjct  339  FDANDDNSEYLTFDASEILGSGDNNSDQVPLTTEQVTEVTDQMSMAGQHQVEV-HGNDVA  397

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  398  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  457

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  458  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  515



>ref|XP_008345397.1| PREDICTED: NAC domain-containing protein 78-like [Malus domestica]
Length=609

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 123/225 (55%), Gaps = 35/225 (16%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE------QAVLPNEKAVDTE  590
            +DA DD    + FDS   +G + ++ +++P+  K     TE      + V P  + +  E
Sbjct  387  FDANDDISQYIDFDSXGMMGVENYVPDEAPADQKLVNGETEPQPMGGEXVQPEPQPLGGE  446

Query  589  H-----KNDIASSSKPEPT---KLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAA  440
            H       D AS+S  + T   K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A 
Sbjct  447  HLVQPVDTDDASASSSKKTXEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAM  506

Query  439  LRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSL  284
             RLN+   +SSSVHVTA +I+I D+T           K G   ++ S   SQ   + G+L
Sbjct  507  RRLNSGAASSSSVHVTAAMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQDDGNSGNL  566

Query  283  EPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
             PV  G  LSG        GWF F+ FWVL LS+S+K+G++I  R
Sbjct  567  VPV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIXTR  609



>ref|XP_010032131.1| PREDICTED: NAC domain-containing protein 78 [Eucalyptus grandis]
 gb|KCW51525.1| hypothetical protein EUGRSUZ_J01038 [Eucalyptus grandis]
Length=538

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = -1

Query  580  DIASSSKP--EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  410
            D AS+SKP  +     S  ++PF+K ASQMLG+ PAPPAFA+E P KDAALRLN+A Q S
Sbjct  391  DCASTSKPHLDSKDPESSIKYPFMKAASQMLGSFPAPPAFAAEFPVKDAALRLNSAAQPS  450

Query  409  SSVHVTAGLIQISDLTL-GS-------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLS  254
            SSVHVTAG+I+I ++ L GS       K+G   I+LSF  SQ   SP      S      
Sbjct  451  SSVHVTAGMIRIRNMNLVGSGMDWSIGKNGELNIVLSFGMSQADISPTDSGLRSRKTPSV  510

Query  253  GGWFY-FLLFWVLILSISVKVGTFIYAR  173
              W + FL FW+++LS+ VKVGT IY+R
Sbjct  511  ASWTWCFLFFWIILLSVGVKVGTSIYSR  538



>ref|XP_010552948.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=568

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 122/204 (60%), Gaps = 18/204 (9%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +D  D+F   L F++   +G +  +       +K   +  E+    ++  ++ + K++ +
Sbjct  371  FDGDDEFTPQLTFNASQLVGTEGSVPHVEGITEKAVPEVLEKEASTSKHVMEEKDKSEAS  430

Query  571  SSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
             S + P+  K  SD ++PF+K+AS+MLG IPAPPAFASE P K AA+ L++A Q+S SVH
Sbjct  431  CSRQDPDALKFESDSKYPFLKKASEMLGAIPAPPAFASEFPTKVAAMHLHSAAQSSGSVH  490

Query  397  VTAGLIQISDLTLGS---------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGW  245
            VTAG+I+IS++T+ +         K+G+  ++LS    +  ++ G L     G+ LS   
Sbjct  491  VTAGMIRISNMTIAAGSGMDWSYGKNGSLNVVLSLGLVEQTET-GKL-----GRTLSRAM  544

Query  244  FYFLLFWVLILSISVKVGTFIYAR  173
              F+ FWVLILS+S KVGTF+ AR
Sbjct  545  LIFVCFWVLILSVSFKVGTFVSAR  568



>gb|KJB60503.1| hypothetical protein B456_009G309000 [Gossypium raimondii]
Length=591

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 125/211 (59%), Gaps = 25/211 (12%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            YDA D  Q + FD D  +G++  + +Q P  +    + TEQ +  +E     EH N  AS
Sbjct  384  YDADD--QSLAFDCDEIVGSEIPVSDQEPLTETHTNEGTEQDLNASEHV--EEHGNSDAS  439

Query  568  SSKPE--PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVH  398
            SSK E   T+     ++PF+K+AS MLG++PAPPAFASE  PKDAA++LN+A+ ASSSVH
Sbjct  440  SSKQELEATEFDLGTKYPFMKRASHMLGSLPAPPAFASEFPPKDAAIKLNSASHASSSVH  499

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG---  251
            V AG+I+I+D T           K+GN  I+LSF   QG     S  P++   +LSG   
Sbjct  500  VMAGMIRITDTTSSGNRLDWSYGKNGNLNIVLSFSLPQGDIDSSSFLPMA--SLLSGKTG  557

Query  250  -----GWFYFLLFWVLILSISVKVGTFIYAR  173
                 GWF+ +LF VLI+S SVK+GT    R
Sbjct  558  PVSARGWFFLMLFSVLIISASVKIGTCFCTR  588



>ref|XP_006297351.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
 gb|EOA30249.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
Length=558

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 113/192 (59%), Gaps = 14/192 (7%)
 Frame = -1

Query  727  QDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---P  557
            Q++ FD    +GN++   +Q     +   +  ++     +K V  E + D AS SK    
Sbjct  374  QNLTFDPSQLMGNEDAFVDQEELFQEIETEELKKEETIGDKQVVEEKEKDEASCSKQFDA  433

Query  556  EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLI  380
            + T+   D+++PF+K+AS MLG IPAPPAFASE P KDAA+RLNA  Q+S SVHVTAG+I
Sbjct  434  DATEFEPDYKYPFLKKASDMLGAIPAPPAFASEFPTKDAAIRLNAG-QSSGSVHVTAGMI  492

Query  379  QISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILS  209
             ISD  +G    K+ N  +ILS+ F Q   + G L     G  L+     F+ FW+L+LS
Sbjct  493  TISDSNMGWSYDKNVNRDLILSYHFVQ-ENASGKL-----GNSLTRAMLIFMCFWILLLS  546

Query  208  ISVKVGTFIYAR  173
            +S KV T + +R
Sbjct  547  VSFKVSTLVASR  558



>gb|KDO47590.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=463

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  254  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  311

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  312  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  371

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  372  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  429



>gb|KDO47589.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=476

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  267  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  324

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  325  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  384

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  385  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  442



>ref|XP_006407560.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
 gb|ESQ49013.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
Length=553

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 111/192 (58%), Gaps = 14/192 (7%)
 Frame = -1

Query  727  QDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---P  557
            Q++ FD    +G D+ + +Q    +K   +  E+      K +  E + D AS  K    
Sbjct  369  QNLTFDPSQLMGTDDVIADQEEPLEKAETEKLEKEESSGGKQLMGEKEMDAASCMKLVDA  428

Query  556  EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLI  380
            + T+L  D++ PF+K+AS MLG IP+PPAFASE P KDAA+RL+AA Q+S SVHVTAGLI
Sbjct  429  DATELEPDYKDPFLKKASHMLGAIPSPPAFASEFPTKDAAIRLHAA-QSSGSVHVTAGLI  487

Query  379  QISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILS  209
             ISD  +G    K+GN+ +I SF   Q      S   ++   ++S      + FW L+LS
Sbjct  488  TISDSYMGWSYRKNGNFDLIFSFGLVQENGIEKSGNSLTRAMLMS------MCFWFLVLS  541

Query  208  ISVKVGTFIYAR  173
            +S KV T + +R
Sbjct  542  VSFKVSTLVSSR  553



>gb|AGC27316.1| NAC domain protein 13 [Gossypium hirsutum]
Length=591

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 124/209 (59%), Gaps = 20/209 (10%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +D  DD Q + FD D  +G++  +  Q P  +    + TEQ +   E     EH N  AS
Sbjct  383  FDDADD-QSLAFDYDEIVGSEIPVSGQEPLTETHTNEGTEQDLNAGEHV--EEHGNSDAS  439

Query  568  SSKPE--PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVH  398
            SSK E   T+     ++PF+K+AS MLG++PAPPAFASE  PKDAA++LN+A+ ASSSVH
Sbjct  440  SSKQELEATEFDLGTKYPFMKRASHMLGSLPAPPAFASEFPPKDAAIKLNSASHASSSVH  499

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH------GKM  260
            V AG+I+I+D T           K+GN  I+LSF   QG  +  S  P++       G +
Sbjct  500  VMAGMIRITDTTSSGNRLDWSYGKNGNLNIVLSFSLPQGDINSSSFLPMASLLTGKTGPV  559

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            L+ GWF+ +LF VLI+S SVK+GT    R
Sbjct  560  LARGWFFLMLFSVLIISASVKIGTCFCTR  588



>gb|KDO47587.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=536

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  327  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  384

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  385  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  444

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  445  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  502



>gb|KDO47586.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=528

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  319  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  376

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  377  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  436

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  437  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  494



>gb|KDO47585.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=548

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  339  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  396

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  397  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  456

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  457  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  514



>gb|KDO47583.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=596

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND+A
Sbjct  387  FDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGNDVA  444

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            S+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SSSV
Sbjct  445  STSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSSSV  504

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQG--AQSPGSLEPVSHGKMLSG  251
            HVTAG+I+I ++TL          K+G+  I+ SFD SQ   + SP S EP   G + SG
Sbjct  505  HVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIFSG  562



>dbj|BAJ34165.1| unnamed protein product [Thellungiella halophila]
Length=501

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 117/200 (59%), Gaps = 14/200 (7%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKP  557
            +D Q++  D    +G+++ L +Q       + +  E+ V   ++AV+ + +N   SSSK 
Sbjct  304  EDTQNLTLDVSQLMGSEDALPDQEGLDQNPSPEEVEKEVAEGKEAVE-KTENGEGSSSKQ  362

Query  556  EP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAG  386
            E   T   S  ++PF+K+AS M G IPAPP+FAS+   KDAA+RL++A Q+S SVHVTAG
Sbjct  363  EADVTDFESASKYPFLKKASHMFGAIPAPPSFASQFQSKDAAIRLHSA-QSSGSVHVTAG  421

Query  385  LIQISDLTLGS---------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  233
            +I+IS++TL +         K+GN  ++LSF   Q     GS    + G   +     F+
Sbjct  422  MIRISNMTLAADSGMGWSYDKNGNLNVVLSFGLVQRDDEMGSSGSKTGGTTATRAMLIFM  481

Query  232  LFWVLILSISVKVGTFIYAR  173
              WVL+LS+S K+GT + AR
Sbjct  482  CLWVLLLSVSFKIGTMVSAR  501



>gb|KFK38438.1| hypothetical protein AALP_AA3G113300 [Arabis alpina]
Length=558

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 112/198 (57%), Gaps = 17/198 (9%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK-  560
            +D +++ FD    IG ++ + +Q     K      E+      K V  E + D AS SK 
Sbjct  368  EDDENLTFDPSQLIGTEDVIPDQEELFQKAETKELEKEEASGGKQVVEEKEKDEASCSKQ  427

Query  559  --PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTA  389
                 T+   D+++ F+K+AS MLG IPAPPAFASE P KDA+++L+AA Q+S SVHVTA
Sbjct  428  VDAYATEFEPDYKYSFLKKASNMLGAIPAPPAFASEFPAKDASIQLHAA-QSSGSVHVTA  486

Query  388  GLIQISDLTLG-----SKHGNYTIILSFDFSQG-AQSPGSLEPVSHGKMLSGGWFYFLLF  227
            G+I ISD           +GN  +ILSF  +QG A S  S      G  L+   F F+ F
Sbjct  487  GMITISDSNTSWSYGKDGNGNLELILSFGLAQGNAASEKS------GNSLTRAMFMFMCF  540

Query  226  WVLILSISVKVGTFIYAR  173
            WVL+LSIS KV T + +R
Sbjct  541  WVLVLSISFKVSTLVSSR  558



>ref|XP_009361439.1| PREDICTED: NAC domain-containing protein 78-like [Pyrus x bretschneideri]
Length=589

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 113/211 (54%), Gaps = 27/211 (13%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA DD    + FDS  ++       +Q PS  K     TE   +  E  V  E  +D +
Sbjct  387  FDANDDISQYIDFDSCGYVP------DQGPSDQKLLNGETELQPMGGEHLVQPEDTDDAS  440

Query  571  SSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
             + K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A LRLN+   +SSSVH
Sbjct  441  LTKKMPECKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPAKEAMLRLNSGASSSSSVH  500

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG---  251
            VTA +I+I D+T           K G   ++ S   SQ   + G+L PV  G  LSG   
Sbjct  501  VTAAMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPV--GGSLSGKTG  558

Query  250  -----GWFYFLLFWVLILSISVKVGTFIYAR  173
                 GWF F+  WVL LS+S K+G++I  R
Sbjct  559  CVVMRGWFLFMFLWVLFLSMSYKIGSYICTR  589



>ref|XP_006398899.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
 gb|ESQ40352.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
Length=572

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 116/199 (58%), Gaps = 12/199 (6%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVD-TEHKNDIASSSK  560
            +D Q++  D    +G+++ L +Q       + +  E+ V   ++AV+ TE+    +S  +
Sbjct  375  EDTQNLTLDVSQLMGSEDALPDQEGLDQNPSPEEVEKEVAEGKEAVEKTENGEGSSSKQE  434

Query  559  PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAGL  383
             + T   S  ++PF+K+AS M G IPAPP+FAS+   KDAA+RL++A Q+S SVHVTAG+
Sbjct  435  ADVTDFESASKYPFLKKASHMFGAIPAPPSFASQFQSKDAAIRLHSA-QSSGSVHVTAGM  493

Query  382  IQISDLTLGS---------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLL  230
            I+IS++TL +         K+GN  ++LSF   Q     GS    + G   +     F+ 
Sbjct  494  IRISNMTLAADSGMGWSYDKNGNLNVVLSFGLVQRDDEMGSSGSKTGGTTATRAMLIFMC  553

Query  229  FWVLILSISVKVGTFIYAR  173
             WVL+LS+S K+GT + AR
Sbjct  554  LWVLLLSVSFKIGTMVSAR  572



>ref|XP_011469276.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=596

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 111/209 (53%), Gaps = 19/209 (9%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDI-FIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  575
            +DA DD    + FDS    +GN+  +  +     K      E     ++  V+    ND 
Sbjct  390  FDADDDISQYIDFDSCCEMLGNENTVSSEPLVEQKSVMGEMEPLSTGSQHLVEAHDVNDA  449

Query  574  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
            +SS +    + GSD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   +SSSVH
Sbjct  450  SSSKQKPDMQFGSDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVASSSSVH  509

Query  397  VTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPV------SHGKM  260
              AG+I+I D+T           K G   ++ S    Q   +  +L P+        G +
Sbjct  510  --AGMIRIRDITSSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVSGKTGSV  567

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +  GW  F+ FWVL +SIS K+G++IYA+
Sbjct  568  VMRGWVLFMFFWVLFISISFKMGSYIYAK  596



>ref|XP_010486664.1| PREDICTED: NAC domain-containing protein 78 [Camelina sativa]
Length=555

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 105/187 (56%), Gaps = 26/187 (14%)
 Frame = -1

Query  721  MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---PEP  551
            ++ D D+F+  +E   E     DK+     +Q V   EK        D AS SK    + 
Sbjct  385  LMGDEDVFVDQEELFQE----VDKEETTGDKQVVEEKEK--------DEASCSKQVDADA  432

Query  550  TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQI  374
            T+   D+++PF+K+AS MLG IPAPPAFASE P K AA+RLNA  Q+S SVHVTAG+I I
Sbjct  433  TEFEPDYKYPFLKKASHMLGAIPAPPAFASEFPTKAAAIRLNAG-QSSGSVHVTAGMITI  491

Query  373  SDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSIS  203
            SD  +G    K  N  +ILS+   Q   S G L     G  L+     F+ FWVL+LS+S
Sbjct  492  SDSNMGWSYDKIANRELILSYRLVQENAS-GKL-----GNSLTRAMLIFMCFWVLLLSVS  545

Query  202  VKVGTFI  182
             KV T +
Sbjct  546  FKVSTLV  552



>emb|CAN70406.1| hypothetical protein VITISV_021988 [Vitis vinifera]
Length=573

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 112/197 (57%), Gaps = 19/197 (10%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKP  557
            D+ Q M F S   +G++  L + +P  D++  +   +      + +   + +  ASSSK 
Sbjct  355  DNLQQMAFGSFEMMGSENPLSDLAP-LDQEPVNGGAEKXPIGSQQLSEAYGDSGASSSKK  413

Query  556  EP--TKLGSDFQHPFIKQAS-QMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTA  389
             P  T+  SD  +PFIKQAS Q+LG IPAP A AS+ P KD ALRLN+A Q+SSSVH+TA
Sbjct  414  NPXATEFESDIPYPFIKQASYQLLGGIPAPFASASDAPTKDVALRLNSAMQSSSSVHLTA  473

Query  388  GLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH------GKMLSG  251
            G+IQI D TL          K GN   +LSF   QG  +  SLEP++       G ++S 
Sbjct  474  GMIQIRDTTLSGNGVDWSYGKSGNINFMLSFGLPQGETNSASLEPIASLMSGKAGPVISR  533

Query  250  GWFYFLLFWVLILSISV  200
              FY +  WVLILS ++
Sbjct  534  AGFYLIFIWVLILSRAL  550



>ref|XP_008339779.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Malus 
domestica]
Length=602

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 120/224 (54%), Gaps = 40/224 (18%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE-------QAVLPNEKAVDT  593
            +DA DD    + FDS    GN   + +Q+PS  K     TE         V P  + +  
Sbjct  387  FDANDDISQYIDFDS---CGN---VPDQAPSNQKLLNGETEPQPMGGDHLVQPEPQPMGG  440

Query  592  EH-----KNDIASSSKPEP-TKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  437
            EH       D AS SK  P +K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A L
Sbjct  441  EHLVQPEDTDDASLSKKMPESKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPAKEAML  500

Query  436  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE  281
            RLN+   +SSSVHVTAG+I+I D+T           K G   ++ S   SQ   + G+L 
Sbjct  501  RLNSGASSSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLV  560

Query  280  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            PV  G  LSG        GWF F+  WVL LS+S K+G++I  R
Sbjct  561  PV--GGSLSGKTGCVVMRGWFLFMFLWVLFLSMSFKIGSYICTR  602



>ref|XP_008339778.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Malus 
domestica]
Length=603

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 120/224 (54%), Gaps = 40/224 (18%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE-------QAVLPNEKAVDT  593
            +DA DD    + FDS    GN   + +Q+PS  K     TE         V P  + +  
Sbjct  388  FDANDDISQYIDFDS---CGN---VPDQAPSNQKLLNGETEPQPMGGDHLVQPEPQPMGG  441

Query  592  EH-----KNDIASSSKPEP-TKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  437
            EH       D AS SK  P +K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A L
Sbjct  442  EHLVQPEDTDDASLSKKMPESKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPAKEAML  501

Query  436  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLE  281
            RLN+   +SSSVHVTAG+I+I D+T           K G   ++ S   SQ   + G+L 
Sbjct  502  RLNSGASSSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLV  561

Query  280  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
            PV  G  LSG        GWF F+  WVL LS+S K+G++I  R
Sbjct  562  PV--GGSLSGKTGCVVMRGWFLFMFLWVLFLSMSFKIGSYICTR  603



>ref|XP_010464726.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=556

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 106/190 (56%), Gaps = 25/190 (13%)
 Frame = -1

Query  721  MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---PEP  551
            ++ D D+F+  +E   E     DK+     +Q V   EK        D AS SK    + 
Sbjct  385  LMGDEDVFVDQEELFQE----VDKEETTGDKQVVEAKEK--------DEASCSKQVDADA  432

Query  550  TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQI  374
            T+   D+++PF+K+AS MLG IPAPPAFASE P K AA+RLNA  Q+S SVHVTAG+I I
Sbjct  433  TEFEPDYKYPFLKKASHMLGAIPAPPAFASEFPTKAAAIRLNAG-QSSGSVHVTAGMITI  491

Query  373  SDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSIS  203
            SD  +G    K+ N  +IL +   Q   S G L        L+     F+ FWVL+LS+S
Sbjct  492  SDSNMGWSYDKNANRDLILFYRLVQENAS-GKL----GNSFLTRAMLIFICFWVLLLSVS  546

Query  202  VKVGTFIYAR  173
             KV T + +R
Sbjct  547  FKVSTLVTSR  556



>ref|XP_011469274.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=597

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 114/210 (54%), Gaps = 20/210 (10%)
 Frame = -1

Query  748  YDAKDDFQDML-FDSDI-FIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  575
            +DA DD    + FDS    +GN+  +  +     K +     + +    + +   H  + 
Sbjct  390  FDADDDISQYIDFDSCCEMLGNENTVSSEPLVEQKQSVMGEMEPLSTGSQHLVEAHDVND  449

Query  574  ASSSKPEP-TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            ASSSK +P  + GSD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   +SSSV
Sbjct  450  ASSSKQKPDMQFGSDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVASSSSV  509

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPV------SHGK  263
            H  AG+I+I D+T           K G   ++ S    Q   +  +L P+        G 
Sbjct  510  H--AGMIRIRDITSSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVSGKTGS  567

Query  262  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            ++  GW  F+ FWVL +SIS K+G++IYA+
Sbjct  568  VVMRGWVLFMFFWVLFISISFKMGSYIYAK  597



>ref|XP_004307017.1| PREDICTED: NAC domain-containing protein 78 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=559

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 105/197 (53%), Gaps = 18/197 (9%)
 Frame = -1

Query  715  FDSDI-FIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLG  539
            FDS    +GN+  +  +     K      E     ++  V+    ND +SS +    + G
Sbjct  365  FDSCCEMLGNENTVSSEPLVEQKSVMGEMEPLSTGSQHLVEAHDVNDASSSKQKPDMQFG  424

Query  538  SDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT  362
            SD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   +SSSVH  AG+I+I D+T
Sbjct  425  SDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVASSSSVH--AGMIRIRDIT  482

Query  361  LG--------SKHGNYTIILSFDFSQGAQSPGSLEPV------SHGKMLSGGWFYFLLFW  224
                       K G   ++ S    Q   +  +L P+        G ++  GW  F+ FW
Sbjct  483  SSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVSGKTGSVVMRGWVLFMFFW  542

Query  223  VLILSISVKVGTFIYAR  173
            VL +SIS K+G++IYA+
Sbjct  543  VLFISISFKMGSYIYAK  559



>ref|XP_002532627.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29758.1| conserved hypothetical protein [Ricinus communis]
Length=514

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 84/126 (67%), Gaps = 16/126 (13%)
 Frame = -1

Query  514  KQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLGS-----  353
            ++AS MLG+IPAPPAFASE P K  AL+LN A  +SSS+ VTAG+I+I  +T GS     
Sbjct  387  EKASHMLGSIPAPPAFASEFPLKGTALQLNGAP-SSSSIRVTAGMIRIESITFGSDGMDW  445

Query  352  ---KHGNYTIILSFDFSQGAQSPGSLEPVSH---GK---MLSGGWFYFLLFWVLILSISV  200
               K+GN  I+LSF  SQG  SP    P  +   GK   ++S GWF+ + FWVLILS+S 
Sbjct  446  SFGKNGNVNIVLSFVMSQGNVSPAGSAPAGNSFSGKTWSLVSRGWFFLMFFWVLILSVSY  505

Query  199  KVGTFI  182
            K+GT+I
Sbjct  506  KIGTYI  511



>ref|XP_011469277.1| PREDICTED: NAC domain-containing protein 78 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=560

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 18/155 (12%)
 Frame = -1

Query  589  HKNDIASSSKPEP-TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQ  416
            H  + ASSSK +P  + GSD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   
Sbjct  408  HDVNDASSSKQKPDMQFGSDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVA  467

Query  415  ASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPV-----  275
            +SSSVH  AG+I+I D+T           K G   ++ S    Q   +  +L P+     
Sbjct  468  SSSSVH--AGMIRIRDITSSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVS  525

Query  274  -SHGKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
               G ++  GW  F+ FWVL +SIS K+G++IYA+
Sbjct  526  GKTGSVVMRGWVLFMFFWVLFISISFKMGSYIYAK  560



>ref|XP_010485001.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010485043.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
 ref|XP_010485093.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
Length=555

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 106/188 (56%), Gaps = 26/188 (14%)
 Frame = -1

Query  724  DMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---PE  554
            +++ D D+F+  +E   E     +K+     +Q V   EK        D AS SK    +
Sbjct  384  ELMGDEDVFVDQEELFQE----VEKEETTGDKQVVEAKEK--------DEASCSKQVDAD  431

Query  553  PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQ  377
             T+   D+++PF+K+A+ MLG IPAPPAFASE P K AA +LNA  Q+S SVHVTAG+I 
Sbjct  432  ATEFEPDYKYPFLKKATHMLGAIPAPPAFASEFPTKAAAFQLNAG-QSSGSVHVTAGMIT  490

Query  376  ISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSI  206
            IS+  +G    K+ N  +ILS+   Q   + G L     G  L+     F+ FWVLILS+
Sbjct  491  ISESNMGWSYDKNANRDLILSYRLVQ-ENASGKL-----GNSLTRAMLIFMCFWVLILSV  544

Query  205  SVKVGTFI  182
            S KV T +
Sbjct  545  SFKVSTLV  552



>ref|XP_010694513.1| PREDICTED: NAC domain-containing protein 78 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 120/216 (56%), Gaps = 41/216 (19%)
 Frame = -1

Query  715  FDSDIFIGNDEFLGEQSP----SADKDACDTTEQAVL------PNEKAVDTEHKND-IAS  569
             D DI IG   +L   SP      D D   +T+Q V+      P+      E  ND IAS
Sbjct  331  LDDDIDIG--PYLNFDSPLEVTDNDADQVFSTKQHVIDATWQIPSASQQLPETGNDGIAS  388

Query  568  SS-------KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQA  413
            SS       K +P++  +D Q+P + QAS+ LGNIPAPPAFASE+P KD A RL+AA Q+
Sbjct  389  SSEQVKELSKAKPSE--TDVQYPVMNQASRFLGNIPAPPAFASELPSKDMAARLSAAVQS  446

Query  412  SSSVHVTAGLIQISDLTLG----------SKHGNYTIILSFDFSQGAQSPGSLEPVS---  272
            S+SVHVTA +I+I D+ +G           K GN  ++LSFD  + A SP  LE  +   
Sbjct  447  STSVHVTANMIRIRDMPIGVSGSGLHWSFDKTGNVNVLLSFDLPE-AVSPVGLESFTSLL  505

Query  271  HGKM---LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
              KM    S GW  F +F +   +IS+KVGT IYA+
Sbjct  506  SSKMSTAASRGWLCF-MFCIAFAAISIKVGTCIYAK  540



>gb|AGV29480.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=367

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 94/154 (61%), Gaps = 25/154 (16%)
 Frame = -1

Query  580  DIASSSKP--EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  410
            D ASSSKP  E  K   D  +PFI   ++MLGNIPAPPAFA+E P K+ A RLNAA   S
Sbjct  221  DDASSSKPVVEVQKSKRDLVYPFI---NRMLGNIPAPPAFAAEFPAKNVAARLNAA---S  274

Query  409  SSVHVTAGLIQISDLT---------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSH---G  266
             SV VT G+++I + T         LG K G   ++LSF   +   SP  L+ +S    G
Sbjct  275  DSVRVTTGMVRIKNTTASGNGMQWFLG-KDGIVNVVLSFAVPESVVSPVGLKYLSGVLGG  333

Query  265  KM---LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            K    +S GWFYFL FWVL+L+I+ K+GT IYA+
Sbjct  334  KAASAVSRGWFYFLFFWVLVLAITAKIGTCIYAK  367



>ref|NP_566376.1| NAC domain containing protein 53 [Arabidopsis thaliana]
 gb|AAK93680.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85076.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74917.1| NAC domain containing protein 53 [Arabidopsis thaliana]
Length=549

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 108/200 (54%), Gaps = 19/200 (10%)
 Frame = -1

Query  733  DFQDML------FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            DF+D L      FD    +GN++   +Q     +      E+      K V  E + D A
Sbjct  356  DFEDYLTFFDETFDPSQLMGNEDVFFDQEELFQEVETKELEKEETSRSKHVVEEKEKDEA  415

Query  571  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
            S SK    + T+   D+++P +K+AS MLG IPAP A ASE P KDAA+RL+AA Q+S S
Sbjct  416  SCSKQVDADATEFEPDYKYPLLKKASHMLGAIPAPLANASEFPTKDAAIRLHAA-QSSGS  474

Query  403  VHVTAGLIQISDLTLGSKHG---NYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  233
            VHVTAG+I ISD  +G  +G   N  +ILS    QG  +P      S   ML      F+
Sbjct  475  VHVTAGMITISDSNMGWSYGKNENLDLILSLGLVQGNTAPEKSGNSSAWAML-----IFM  529

Query  232  LFWVLILSISVKVGTFIYAR  173
             FWVL+LS+S KV   + +R
Sbjct  530  CFWVLLLSVSFKVSILVSSR  549



>gb|AAM65338.1| NAC, putative [Arabidopsis thaliana]
Length=549

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 108/200 (54%), Gaps = 19/200 (10%)
 Frame = -1

Query  733  DFQDML------FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            DF+D L      FD    +GN++   +Q     +      E+      K V  E + D A
Sbjct  356  DFEDYLTFFDETFDPSQLMGNEDVFFDQEELFQEVETKELEKEETSRSKHVVEEKEKDEA  415

Query  571  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
            S SK    + T+   D+++P +K+AS MLG IPAP A ASE P KDAA+RL+AA Q+S S
Sbjct  416  SCSKQVDADATEFEPDYKYPLLKKASHMLGAIPAPLANASEFPTKDAAIRLHAA-QSSGS  474

Query  403  VHVTAGLIQISDLTLGSKHG---NYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  233
            VHVTAG+I ISD  +G  +G   N  +ILS    QG  +P      S   ML      F+
Sbjct  475  VHVTAGMITISDSNMGWSYGKNENLDLILSLGLVQGNTAPEKSGNSSAWAML-----IFM  529

Query  232  LFWVLILSISVKVGTFIYAR  173
             FWVL+LS+S KV   + +R
Sbjct  530  CFWVLLLSVSFKVSILVSSR  549



>ref|XP_004496134.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cicer 
arietinum]
Length=577

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 116/206 (56%), Gaps = 16/206 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQ-SPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            Y A D  + + FDS + IG +  +     P  +++  D    + L N++  + +  N+  
Sbjct  369  YPAGDISKHISFDSPLSIGCESPIANPVQPFIEQNVEDEANGSSLANKQVSEAQSSNEAI  428

Query  571  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  395
             +  PE +   S   +PF+KQA+++L ++PA PAFASE P K+ ALR++ A Q+SSS H+
Sbjct  429  PTEDPEVSSWVSGDTNPFVKQANKLLASLPAAPAFASEFPTKEFALRIHPAAQSSSSAHI  488

Query  394  TAGLIQISDLT--------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSH------GKML  257
            TAG+I I+D+T        +  K+G +  I+S  FSQ   +  +LEP+S         +L
Sbjct  489  TAGMISITDITFRGNAMDWMVGKNGGFNTIMSTGFSQTDGNSATLEPISDLVCSKAAFVL  548

Query  256  SGGWFYFLLFWVLILSISVKVGTFIY  179
            S  W +   F V++LS+S K+G+ +Y
Sbjct  549  SHSWVFLTGFSVVVLSLSFKIGSLMY  574



>ref|XP_004496133.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cicer 
arietinum]
Length=578

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 116/206 (56%), Gaps = 16/206 (8%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQ-SPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            Y A D  + + FDS + IG +  +     P  +++  D    + L N++  + +  N+  
Sbjct  370  YPAGDISKHISFDSPLSIGCESPIANPVQPFIEQNVEDEANGSSLANKQVSEAQSSNEAI  429

Query  571  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  395
             +  PE +   S   +PF+KQA+++L ++PA PAFASE P K+ ALR++ A Q+SSS H+
Sbjct  430  PTEDPEVSSWVSGDTNPFVKQANKLLASLPAAPAFASEFPTKEFALRIHPAAQSSSSAHI  489

Query  394  TAGLIQISDLT--------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSH------GKML  257
            TAG+I I+D+T        +  K+G +  I+S  FSQ   +  +LEP+S         +L
Sbjct  490  TAGMISITDITFRGNAMDWMVGKNGGFNTIMSTGFSQTDGNSATLEPISDLVCSKAAFVL  549

Query  256  SGGWFYFLLFWVLILSISVKVGTFIY  179
            S  W +   F V++LS+S K+G+ +Y
Sbjct  550  SHSWVFLTGFSVVVLSLSFKIGSLMY  575



>ref|XP_010423584.1| PREDICTED: NAC domain-containing protein 78 isoform X3 [Camelina 
sativa]
Length=490

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 119/209 (57%), Gaps = 27/209 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ + + +
Sbjct  292  FNFEDYLNDFNFDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKERGE  346

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S S
Sbjct  347  GSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSSGS  405

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQ---GAQSPGSLEPVSHGKM  260
            VHVTAG+I+IS++TL +         K+GN  ++LSF   Q   G  + GS    +  + 
Sbjct  406  VHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDGLNASGSKTGTTETRA  465

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +      F+  WVL+LS+S K+GT + AR
Sbjct  466  M----LIFMCLWVLLLSVSFKIGTLVSAR  490



>ref|XP_010423582.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Camelina 
sativa]
Length=563

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 119/209 (57%), Gaps = 27/209 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ + + +
Sbjct  365  FNFEDYLNDFNFDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKERGE  419

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S S
Sbjct  420  GSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSSGS  478

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQ---GAQSPGSLEPVSHGKM  260
            VHVTAG+I+IS++TL +         K+GN  ++LSF   Q   G  + GS    +  + 
Sbjct  479  VHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDGLNASGSKTGTTETRA  538

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +      F+  WVL+LS+S K+GT + AR
Sbjct  539  M----LIFMCLWVLLLSVSFKIGTLVSAR  563



>ref|XP_010423583.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Camelina 
sativa]
Length=562

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 119/209 (57%), Gaps = 27/209 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ + + +
Sbjct  364  FNFEDYLNDFNFDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKERGE  418

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S S
Sbjct  419  GSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSSGS  477

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQ---GAQSPGSLEPVSHGKM  260
            VHVTAG+I+IS++TL +         K+GN  ++LSF   Q   G  + GS    +  + 
Sbjct  478  VHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDGLNASGSKTGTTETRA  537

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +      F+  WVL+LS+S K+GT + AR
Sbjct  538  M----LIFMCLWVLLLSVSFKIGTLVSAR  562



>ref|XP_010452336.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
Length=563

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 115/206 (56%), Gaps = 21/206 (10%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +   +
Sbjct  365  FNFEDYLNDFNFDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKESGE  419

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S S
Sbjct  420  GSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSSGS  478

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG  251
            VHVTAG+I+IS++TL +         K+GN  ++LSF   Q    P +      G   + 
Sbjct  479  VHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDEPNA-SGSKTGTTETR  537

Query  250  GWFYFLLFWVLILSISVKVGTFIYAR  173
                F+  WVL+LS+S K+GT + AR
Sbjct  538  AMLIFMFLWVLVLSVSFKIGTMVSAR  563



>ref|XP_010452337.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=562

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 115/206 (56%), Gaps = 21/206 (10%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +   +
Sbjct  364  FNFEDYLNDFNFDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKESGE  418

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S S
Sbjct  419  GSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSSGS  477

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG  251
            VHVTAG+I+IS++TL +         K+GN  ++LSF   Q    P +      G   + 
Sbjct  478  VHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDEPNA-SGSKTGTTETR  536

Query  250  GWFYFLLFWVLILSISVKVGTFIYAR  173
                F+  WVL+LS+S K+GT + AR
Sbjct  537  AMLIFMFLWVLVLSVSFKIGTMVSAR  562



>ref|XP_004173168.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
Length=566

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 110/212 (52%), Gaps = 28/212 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA  D  DM FD        E LG  SP  D+ +A     +    +++  D  H N  +
Sbjct  363  FDADGDNVDMSFDPS------EILGSGSPIPDQTEAVGGATEHASASKQTADLRHDNGAS  416

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            SSS  +PE  K  SD ++PF+K  S MLG+IPAP  FAS+   KDAA+ LN+A QASSSV
Sbjct  417  SSSMQRPEDPKSESDIKYPFLKHTSHMLGSIPAP--FASQFTSKDAAIHLNSAPQASSSV  474

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGG-  248
             VTAG++ I ++ L          K+ +  II  +   +G      L P + G   S   
Sbjct  475  RVTAGMLVIRNIALNGYEVNNMYGKNSDLNIIYLYGIVEGNIDSSQLLPNAAGVNSSKSE  534

Query  247  -------WFYFLLFWVLILSISVKVGTFIYAR  173
                    ++F+LFWVLILS S KV   I++R
Sbjct  535  PLISRYFLYFFILFWVLILSASFKVARCIHSR  566



>gb|KGN52230.1| hypothetical protein Csa_5G622470 [Cucumis sativus]
Length=562

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 112/212 (53%), Gaps = 28/212 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA  D  DM FD        E LG  SP  D+ +A     +    +++  D  H N  +
Sbjct  359  FDADGDNVDMSFDPS------EILGSGSPIPDQTEAVGGATEHASASKQTADLRHDNGAS  412

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            SSS  +PE  K  SD ++PF+K  S MLG+IPAP  FAS+   KDAA+ LN+A QASSSV
Sbjct  413  SSSMQRPEDPKSESDIKYPFLKHTSHMLGSIPAP--FASQFTSKDAAIHLNSAPQASSSV  470

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHG-------  266
             VTAG++ I ++ L          K+ +  II  +   +G      L P + G       
Sbjct  471  RVTAGMLVIRNIALNGYEVNNMYGKNSDLNIIYLYGIVEGNIDSSQLLPNAAGVNSSKSE  530

Query  265  KMLSGGWFY-FLLFWVLILSISVKVGTFIYAR  173
             ++S  + Y F+LFWVLILS S KV   I++R
Sbjct  531  PLISRYFLYFFILFWVLILSASFKVARCIHSR  562



>gb|AAG51388.1|AC011560_20 unknown protein; 75639-73470 [Arabidopsis thaliana]
 gb|AAF76351.1| NAC, putative [Arabidopsis thaliana]
Length=558

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 108/209 (52%), Gaps = 28/209 (13%)
 Frame = -1

Query  733  DFQDML------FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            DF+D L      FD    +GN++   +Q     +      E+      K V  E + D A
Sbjct  356  DFEDYLTFFDETFDPSQLMGNEDVFFDQEELFQEVETKELEKEETSRSKHVVEEKEKDEA  415

Query  571  SSSKP--------EP----TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRL  431
            S SK         EP        +D+++P +K+AS MLG IPAP A ASE P KDAA+RL
Sbjct  416  SCSKQVDADATEFEPDDGSISENADYKYPLLKKASHMLGAIPAPLANASEFPTKDAAIRL  475

Query  430  NAATQASSSVHVTAGLIQISDLTLGSKHG---NYTIILSFDFSQGAQSPGSLEPVSHGKM  260
            +AA Q+S SVHVTAG+I ISD  +G  +G   N  +ILS    QG  +P      S   M
Sbjct  476  HAA-QSSGSVHVTAGMITISDSNMGWSYGKNENLDLILSLGLVQGNTAPEKSGNSSAWAM  534

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            L      F+ FWVL+LS+S KV   + +R
Sbjct  535  L-----IFMCFWVLLLSVSFKVSILVSSR  558



>ref|XP_010243195.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 102/170 (60%), Gaps = 30/170 (18%)
 Frame = -1

Query  595  TEHKNDIASSSKPEPTKLGSDFQHP------FIKQASQMLGNIPAPPAFASEIP-KDAAL  437
            T+  +  +SS +PE T+   D Q+        +K+ S+MLG+I APPAFA+E P K+AA+
Sbjct  389  TQGSDGASSSKQPETTQFTPDVQYDEGWDSNIVKRVSRMLGSIHAPPAFAAEFPVKEAAI  448

Query  436  RLNAATQASSSVHVTAGLIQISDLTLGSKHGNYT--------IILSFDFSQGAQ------  299
              N++ +AS+ VHVTAG+I+IS +T+ S  GNY+        ++LS+  ++G        
Sbjct  449  GQNSSAEASNPVHVTAGMIRISGMTIRSA-GNYSSFGKNNVDLLLSYGMTRGDMIAAKQL  507

Query  298  --SPGSLEPVSH------GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
                 + +P+++      G ++  G FYF+ FWVLILS+S K+ ++IY R
Sbjct  508  IGGTAATDPMANILSGKAGSVMIHGGFYFIFFWVLILSVSFKIASYIYTR  557



>ref|XP_010243196.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nelumbo 
nucifera]
Length=556

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 102/170 (60%), Gaps = 30/170 (18%)
 Frame = -1

Query  595  TEHKNDIASSSKPEPTKLGSDFQHP------FIKQASQMLGNIPAPPAFASEIP-KDAAL  437
            T+  +  +SS +PE T+   D Q+        +K+ S+MLG+I APPAFA+E P K+AA+
Sbjct  388  TQGSDGASSSKQPETTQFTPDVQYDEGWDSNIVKRVSRMLGSIHAPPAFAAEFPVKEAAI  447

Query  436  RLNAATQASSSVHVTAGLIQISDLTLGSKHGNYT--------IILSFDFSQGAQ------  299
              N++ +AS+ VHVTAG+I+IS +T+ S  GNY+        ++LS+  ++G        
Sbjct  448  GQNSSAEASNPVHVTAGMIRISGMTIRSA-GNYSSFGKNNVDLLLSYGMTRGDMIAAKQL  506

Query  298  --SPGSLEPVSH------GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
                 + +P+++      G ++  G FYF+ FWVLILS+S K+ ++IY R
Sbjct  507  IGGTAATDPMANILSGKAGSVMIHGGFYFIFFWVLILSVSFKIASYIYTR  556



>ref|XP_010267268.1| PREDICTED: NAC domain-containing protein 78-like [Nelumbo nucifera]
Length=589

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 92/162 (57%), Gaps = 28/162 (17%)
 Frame = -1

Query  574  ASSSKPEPTKLGSDFQH------PFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQ  416
            +S  KP+ TK   D QH        +K  S+MLG+IPAPP+FA+E P K+AA+  N A +
Sbjct  428  SSKQKPDTTKFSPDVQHGNGWDNNLVKHVSRMLGSIPAPPSFAAEFPLKEAAIGQNKANE  487

Query  415  ASSSVHVTAGLIQISDLTLGSKHGNYTI-------ILSFDFSQGA--------QSPGSLE  281
            AS+ V VTAG+IQIS +T+      Y++        LS+  ++           +  +LE
Sbjct  488  ASNPVRVTAGMIQISGMTVSGGRKCYSLGKSNADLFLSYGMARDGVMAAEQLINNSVALE  547

Query  280  PVSH------GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            P+++      G ++    FYF  FWVLILS+S K+G++IY R
Sbjct  548  PMANILSGKSGSLMIRCGFYFTFFWVLILSVSFKIGSYIYTR  589



>ref|XP_008446811.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis melo]
Length=561

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 110/212 (52%), Gaps = 29/212 (14%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDAC--DTTEQAVLPNEKAVDTEHKNDI  575
            +DA  D  DM FD        E LG  SP  D+       TE A    + A D  H N+ 
Sbjct  359  FDADGDNADMSFDPS------EILGSGSPIPDQTEVVGGATEHASTSKQTA-DLHHDNEA  411

Query  574  ASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
            +SSS  +PE  K   D ++PF+K  S MLG+IPAP  FAS+   KDAA+ LN+A QASSS
Sbjct  412  SSSSMQRPEDPKSEPDIKYPFLKHTSHMLGSIPAP--FASQFTSKDAAIHLNSAPQASSS  469

Query  403  VHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEP-----VSHGK  263
            V VTAG++ I ++ L          K+ +  +I  +   +G      L P      S  +
Sbjct  470  VRVTAGMLIIRNIALNGYEVNNMYGKNSDLNVIYLYGIVEGNIDSSQLLPNAGVNSSKSE  529

Query  262  MLSGGWF--YFLLFWVLILSISVKVGTFIYAR  173
             L   +F  +F+LFWVLILS S KV   I++R
Sbjct  530  PLISRYFLYFFILFWVLILSASFKVARCIHSR  561



>ref|XP_008456549.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cucumis 
melo]
Length=555

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 121/203 (60%), Gaps = 15/203 (7%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D+ Q     SDIF G++E +  Q+ S +K   +  E+  +  +++  T   +   S
Sbjct  355  FDADDNLQLAFDPSDIF-GSEEPISSQTISEEK-VNEVAEKEFMAAKQSSVTFLNDASTS  412

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
               P+  + GSD + PF K+AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVT
Sbjct  413  KQNPKAIETGSDSKSPFFKRASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVT  472

Query  391  AGLIQISDLT---------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSHGKML--SGGW  245
            AG+I I +LT         L  K+ +  +ILSF   Q  Q     +   +G ++   G  
Sbjct  473  AGMIHIRNLTSNGDLVNNPLYGKNADVNLILSFAQHQ-HQVESDHQSEKNGIIVGSRGFL  531

Query  244  FYFLLFWVLILSISVKVGTFIYA  176
            F+FLLFWVLILS+S KVG+ IY+
Sbjct  532  FFFLLFWVLILSVSFKVGSCIYS  554



>ref|XP_008456548.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cucumis 
melo]
Length=556

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 121/203 (60%), Gaps = 15/203 (7%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D+ Q     SDIF G++E +  Q+ S +K   +  E+  +  +++  T   +   S
Sbjct  356  FDADDNLQLAFDPSDIF-GSEEPISSQTISEEK-VNEVAEKEFMAAKQSSVTFLNDASTS  413

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
               P+  + GSD + PF K+AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVT
Sbjct  414  KQNPKAIETGSDSKSPFFKRASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVT  473

Query  391  AGLIQISDLT---------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSHGKML--SGGW  245
            AG+I I +LT         L  K+ +  +ILSF   Q  Q     +   +G ++   G  
Sbjct  474  AGMIHIRNLTSNGDLVNNPLYGKNADVNLILSFAQHQ-HQVESDHQSEKNGIIVGSRGFL  532

Query  244  FYFLLFWVLILSISVKVGTFIYA  176
            F+FLLFWVLILS+S KVG+ IY+
Sbjct  533  FFFLLFWVLILSVSFKVGSCIYS  555



>gb|KFK24891.1| hypothetical protein AALP_AA8G038000 [Arabis alpina]
Length=580

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 103/185 (56%), Gaps = 34/185 (18%)
 Frame = -1

Query  634  TEQAVLPNEKAVD-----TEHKNDIA--------------SSSKPEP--TKLGSDFQHPF  518
            +E A+LPN++ +D      E + ++A              SSSK +   T   S  ++PF
Sbjct  399  SEAALLPNQEGLDQKPSSEELEKEVAEVKETVEKIESGEGSSSKQDADVTDFDSASKYPF  458

Query  517  IKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLGS----  353
             K+AS M G IPAPP FASE   KD+A+RL+AA Q+S SVHVTAG+I+ISD+TL +    
Sbjct  459  FKKASHMFGAIPAPP-FASECKSKDSAIRLHAA-QSSGSVHVTAGMIRISDMTLSADSGM  516

Query  352  -----KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGT  188
                 K GN  ++LSF   Q   +  S    + G   +     F+  WVL+LS+S K+GT
Sbjct  517  GWSYDKSGNLNVVLSFGLVQRENAMSSTGSKT-GTTATRAMLIFICLWVLLLSVSYKIGT  575

Query  187  FIYAR  173
             + AR
Sbjct  576  IVSAR  580



>ref|NP_196061.1| NAC family transcriptional activator [Arabidopsis thaliana]
 sp|Q84K00.2|NAC78_ARATH RecName: Full=NAC domain-containing protein 78; Short=ANAC078 
[Arabidopsis thaliana]
 emb|CAB85547.1| putative protein [Arabidopsis thaliana]
 gb|AAM20460.1| putative protein [Arabidopsis thaliana]
 gb|AAM91259.1| putative protein [Arabidopsis thaliana]
 gb|AED90739.1| NAC family transcriptional activator [Arabidopsis thaliana]
Length=567

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 110/200 (55%), Gaps = 18/200 (9%)
 Frame = -1

Query  733  DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPE  554
            D + + FD  + +G ++FL  Q     K A    E+ V   ++AV+ +   + +SS +  
Sbjct  373  DDEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVAGGKEAVEEKESGEGSSSKQDT  432

Query  553  PTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQ  377
              K   S  ++PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S SVHVTAG+++
Sbjct  433  DFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSSGSVHVTAGMMR  491

Query  376  ISDLTLGS---------KHGNYTIILSFDFSQ---GAQSPGSLEPVSHGKMLSGGWFYFL  233
            IS++TL +         K+GN  ++LSF   Q      + GS   ++  + +      F+
Sbjct  492  ISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQQDDAMTASGSKTGITATRAM----LVFM  547

Query  232  LFWVLILSISVKVGTFIYAR  173
              WVL+LS+S K+ T + AR
Sbjct  548  CLWVLLLSVSFKIVTMVSAR  567



>ref|XP_010490950.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
 ref|XP_010490951.1| PREDICTED: NAC domain-containing protein 78-like isoform X4 [Camelina 
sativa]
Length=562

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 117/209 (56%), Gaps = 28/209 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +   +
Sbjct  365  FNFEDYLNDFNFDEDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKDSGE  419

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG+IPAP +FAS+   KDAA+RL+  +++S S
Sbjct  420  GSSSKQDADLTDFDSASKYPFLKKTSHMLGSIPAPSSFASQFKSKDAAIRLH--SESSGS  477

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQG---AQSPGSLEPVSHGKM  260
            VHVTAG+I+IS++TL +         K+GN  +ILSF   Q      + GS    +  + 
Sbjct  478  VHVTAGMIRISNMTLAADSSMGWSYDKNGNLNVILSFGVVQRDDELNATGSKTGTTETRA  537

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +      F+  WVL+LS+S K+GT + AR
Sbjct  538  M----LIFMCLWVLVLSVSFKIGTMVSAR  562



>ref|XP_010490948.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010490949.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=563

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 117/209 (56%), Gaps = 28/209 (13%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++ +D   D  FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +   +
Sbjct  366  FNFEDYLNDFNFDEDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKDSGE  420

Query  577  IASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
             +SS +  + T   S  ++PF+K+ S MLG+IPAP +FAS+   KDAA+RL+  +++S S
Sbjct  421  GSSSKQDADLTDFDSASKYPFLKKTSHMLGSIPAPSSFASQFKSKDAAIRLH--SESSGS  478

Query  403  VHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQG---AQSPGSLEPVSHGKM  260
            VHVTAG+I+IS++TL +         K+GN  +ILSF   Q      + GS    +  + 
Sbjct  479  VHVTAGMIRISNMTLAADSSMGWSYDKNGNLNVILSFGVVQRDDELNATGSKTGTTETRA  538

Query  259  LSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +      F+  WVL+LS+S K+GT + AR
Sbjct  539  M----LIFMCLWVLVLSVSFKIGTMVSAR  563



>ref|XP_002871092.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47351.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
Length=568

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 117/211 (55%), Gaps = 30/211 (14%)
 Frame = -1

Query  733  DFQDML--FDSDIFIGND-EFLGEQSPSADKDACDTT------EQAVLPNEKAVDTEHKN  581
            +F+D L  FD + F  +D + +G ++   + +  D        E+ V   ++AV+ +   
Sbjct  364  NFEDYLNFFDDESFTLDDSQLMGPEAALPNLEGLDQKPTPEELEKEVAGGKEAVEEKESG  423

Query  580  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASS  407
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+   KDAA+RL+AA Q+S 
Sbjct  424  EGSSSKQDADVKDFDSASKYPFLKKTSHMLGAIPTPSSFASQFQTKDAAMRLHAA-QSSG  482

Query  406  SVHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQG----AQSPGSLEPVSHG  266
            SVHVTAG+I+IS++TL +         K+GN  ++LSF   Q     + S    E  +  
Sbjct  483  SVHVTAGMIRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQRDDALSASGSKTETTATR  542

Query  265  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
             ML      F+  WVL+LS+S K+ T ++AR
Sbjct  543  AML-----VFMCLWVLLLSVSFKIVTMVFAR  568



>gb|KEH17171.1| NAC transcription factor-like protein [Medicago truncatula]
Length=539

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 83/128 (65%), Gaps = 11/128 (9%)
 Frame = -1

Query  529  QHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT---  362
            ++ F+KQA+++L  IPAPPAFASE P K+ A+ +++A + S+S H+T G+I I+D+T   
Sbjct  409  ENAFVKQANKLLAGIPAPPAFASEFPSKEFAVGMHSAAEFSNSAHITTGIISITDITYSG  468

Query  361  -----LGSKHGNYTIILSFDFSQGA--QSPGSLEPVSHGKMLSGGWFYFLLFWVLILSIS  203
                 +  K+G +  I+S +FSQ A   S   L       MLS GW Y + F V+ILS+S
Sbjct  469  NMMDWMAGKNGGFDTIMSNEFSQTAAINSATGLVCRKTACMLSHGWVYLMGFSVVILSMS  528

Query  202  VKVGTFIY  179
            +K+G+F+Y
Sbjct  529  LKIGSFMY  536



>gb|EYU32441.1| hypothetical protein MIMGU_mgv1a002437mg [Erythranthe guttata]
Length=675

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 105/201 (52%), Gaps = 34/201 (17%)
 Frame = -1

Query  748  YDAKDDFQDMLF--DSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  575
            +DA DD   + F  DS    G D  + EQ     K+  + T QA+LPN + +   + N++
Sbjct  498  FDANDD-NSLYFANDSASMFGTDGLVSEQPLLPHKEMTEETAQAILPNGQHIANNNNNEV  556

Query  574  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  398
              S K E  K  S   +PFIKQAS++LGN+PAPPAFA+E P K+A LRLN          
Sbjct  557  LPSDKQESAKQYSGLDYPFIKQASKILGNLPAPPAFAAEFPSKNAILRLN----------  606

Query  397  VTAGLIQISDLTLGSKHGNYTIILSFDFSQGAQSPGSLEP---VSHGK----MLSGGWFY  239
                         G+K  N+ +I+SF +S+G     +LE    +  GK     +S GW +
Sbjct  607  -------------GAKDENFNVIVSFGYSRGNDGSSNLESSVRIQTGKAASSAMSRGWLF  653

Query  238  FLLFWVLILSISVKVGTFIYA  176
            F+ F+ +  S++ K GT++ A
Sbjct  654  FVFFFFVFFSMTFKYGTYLCA  674



>ref|XP_006286823.1| hypothetical protein CARUB_v10003768mg [Capsella rubella]
 gb|EOA19721.1| hypothetical protein CARUB_v10003768mg [Capsella rubella]
Length=623

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 110/201 (55%), Gaps = 24/201 (12%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKP  557
            +D+ +   D    + + +F+G +    D++  D   Q V+     +  +  + I   S P
Sbjct  434  EDYLNFCDDEGFILDDSQFMGSEDALPDQEGLD---QKVMVRYSLIHRKANHLI--DSDP  488

Query  556  EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLI  380
              TK  +  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S SVHVTAG+I
Sbjct  489  SKTKSAAS-KYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSSGSVHVTAGMI  546

Query  379  QISDLTLGS---------KHGNYTIILSFDFSQG---AQSPGSLEPVSHGKMLSGGWFYF  236
            +IS++TL +         K+GN  ++LSF   Q      + GS    +  + +      F
Sbjct  547  RISNMTLAADSSMGWSYDKNGNLNVVLSFGVVQRDDELSASGSKTATTATRAM----LIF  602

Query  235  LLFWVLILSISVKVGTFIYAR  173
            +  WVL+LS+S K+ T + AR
Sbjct  603  MCLWVLLLSVSFKIVTMVSAR  623



>ref|XP_002882677.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58936.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 107/189 (57%), Gaps = 13/189 (7%)
 Frame = -1

Query  727  QDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---P  557
            Q++ FD    +GN++   +Q     +      ++      K V  E + D AS SK    
Sbjct  375  QNLTFDPSQLMGNEDIFVDQEELFQEVETKELKKEETSGSKHVVEEKEKDEASCSKQVDA  434

Query  556  EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLI  380
            + T+   D+++PF+K+AS ML  IPAPPAFASE+P KDAA+RL+AA Q+S SVHVTAG+I
Sbjct  435  DATEFEPDYKYPFLKKASHMLAAIPAPPAFASELPTKDAAIRLHAA-QSSGSVHVTAGMI  493

Query  379  QISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILS  209
             ISD  +G    K+GN+ +ILS    QG  +       S   ML      F+  WVL+LS
Sbjct  494  TISDGNMGWSYGKNGNFDLILSLGLVQGNTASEKSGNSSAWAML-----IFMCLWVLVLS  548

Query  208  ISVKVGTFI  182
            +S KV   +
Sbjct  549  VSFKVSILV  557



>ref|XP_004150380.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
 ref|XP_004164210.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
 gb|KGN62198.1| hypothetical protein Csa_2G327500 [Cucumis sativus]
Length=555

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 117/203 (58%), Gaps = 15/203 (7%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  569
            +DA D+ Q + FD      ++E +  Q+ S +K   +  E+  +  +++  T   +   S
Sbjct  355  FDADDNLQ-LAFDPSDLFDSEEPISSQTTSEEK-VSEVAEKEFMAAKQSSVTFVNDASTS  412

Query  568  SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVT  392
               P+  +  SD + PF K AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVT
Sbjct  413  KQDPKAIETSSDSKSPFFKGASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVT  472

Query  391  AGLIQISDLT---------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSHGKML--SGGW  245
            AG+I I +LT         L  K+ +  +ILSF   Q  Q     +   +G ++   G  
Sbjct  473  AGMIHIRNLTSNGDLVNDPLYGKNADVNLILSFAQHQ-HQVESDHQSEKNGTIVGSRGFL  531

Query  244  FYFLLFWVLILSISVKVGTFIYA  176
            F+FLLFWVLILS+S KVG+ IY+
Sbjct  532  FFFLLFWVLILSVSFKVGSCIYS  554



>gb|KEH43320.1| NAC transcription factor-like protein [Medicago truncatula]
Length=452

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 18/129 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  362
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  324  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  380

Query  361  --LGSKHGNYTIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  206
              +  K+G +  ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  381  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  440

Query  205  SVKVGTFIY  179
            S K+G+F+Y
Sbjct  441  SFKIGSFMY  449



>gb|KEH43318.1| NAC transcription factor-like protein [Medicago truncatula]
Length=492

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 18/129 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  362
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  364  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  420

Query  361  --LGSKHGNYTIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  206
              +  K+G +  ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  421  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  480

Query  205  SVKVGTFIY  179
            S K+G+F+Y
Sbjct  481  SFKIGSFMY  489



>gb|KEH43319.1| NAC transcription factor-like protein [Medicago truncatula]
Length=589

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 18/129 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  362
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  461  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  517

Query  361  --LGSKHGNYTIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  206
              +  K+G +  ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  518  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  577

Query  205  SVKVGTFIY  179
            S K+G+F+Y
Sbjct  578  SFKIGSFMY  586



>gb|AAM34772.1|AF509872_1 nam-like protein 9 [Petunia x hybrida]
Length=462

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 82/123 (67%), Gaps = 7/123 (6%)
 Frame = -1

Query  748  YDAKDDFQDMLFDS---DIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  578
            ++A   F++M FD     + IGND  + +Q+   +K+  +  +Q   P+++    EHKN 
Sbjct  338  FEAMITFRNMGFDGFDPSVLIGNDGHVSDQASLLEKNIGEVAQQVTAPSQQLA--EHKNT  395

Query  577  IASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  404
            IASSS  +PTK + +D Q+ F+K+ASQMLG+IPAPPAFASE P KDAAL LN+   +++S
Sbjct  396  IASSSMEKPTKFVTADDQYRFMKRASQMLGSIPAPPAFASEFPTKDAALHLNSMPHSANS  455

Query  403  VHV  395
            V V
Sbjct  456  VRV  458



>gb|KEH43317.1| NAC transcription factor-like protein [Medicago truncatula]
Length=629

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 18/129 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  362
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  501  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  557

Query  361  --LGSKHGNYTIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  206
              +  K+G +  ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  558  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  617

Query  205  SVKVGTFIY  179
            S K+G+F+Y
Sbjct  618  SFKIGSFMY  626



>gb|KEH43321.1| NAC transcription factor-like protein [Medicago truncatula]
Length=630

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 18/129 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  362
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  502  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  558

Query  361  --LGSKHGNYTIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  206
              +  K+G +  ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  559  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  618

Query  205  SVKVGTFIY  179
            S K+G+F+Y
Sbjct  619  SFKIGSFMY  627



>gb|KHN00951.1| NAC domain-containing protein 78 [Glycine soja]
Length=479

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 109/200 (55%), Gaps = 16/200 (8%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQ-SPSADKDA-CDTTEQAVLPNEKAVDTEHKNDIASSS  563
            D ++ + FDS     ++ F+  Q SP   ++   +T ++AV+ N  + +++ +N+ +S  
Sbjct  279  DIYKYISFDSPQIQESENFIPNQGSPFTRQNVEGETADKAVVSNHNS-ESQTRNEASSVQ  337

Query  562  KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAG  386
                 K      +P +KQA   L +IPA PA A E P K+ AL L+   Q+S   H+T G
Sbjct  338  NTHEAKFAPGSTNPLVKQAYGWLASIPAAPAHAMEFPAKEIALGLHPVAQSSHPAHITTG  397

Query  385  LIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFY  239
            +I I+D+TL          K+G ++ ++S  F Q   +  +L PVS GK   +LS GW +
Sbjct  398  MISITDITLRGNAMDWTMGKNGGFSTVISTGFCQPDVNSDALIPVS-GKTAFVLSHGWIF  456

Query  238  FLLFWVLILSISVKVGTFIY  179
               F VLILS+S K+G+ +Y
Sbjct  457  LTGFSVLILSLSCKIGSIMY  476



>ref|XP_010485171.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=106

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 68/110 (62%), Gaps = 11/110 (10%)
 Frame = -1

Query  499  MLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG---SKHGNYTI  332
            MLG IPAPPAFASE P K AA +LNA  Q+S SVHVTAG+I IS+  +G    K+ N  +
Sbjct  1    MLGAIPAPPAFASEFPTKAAAFQLNAG-QSSGSVHVTAGMITISESNMGWSYDKNANRDL  59

Query  331  ILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTFI  182
            ILS+   Q   + G L     G  L+     F+ FWVLILS+S KV T +
Sbjct  60   ILSYRLVQ-ENASGKL-----GNSLTRAMLIFMCFWVLILSVSFKVSTLV  103



>ref|XP_003556302.1| PREDICTED: NAC domain-containing protein 78-like [Glycine max]
Length=604

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 108/200 (54%), Gaps = 16/200 (8%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQ-SPSADKDA-CDTTEQAVLPNEKAVDTEHKNDIASSS  563
            D ++ + FDS     ++ F+  Q SP   ++   +T ++AV+ N  + +++ +N+ +S  
Sbjct  404  DIYKYISFDSPQIQESENFIPNQGSPFTRQNVEGETADKAVVSNHNS-ESQTRNEASSVQ  462

Query  562  KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAG  386
                 K      +P +KQA   L  IPA PA A E P K+ AL L+   Q+S   H+T G
Sbjct  463  NTHEAKFAPGSTNPLVKQAYGWLAGIPAAPAHAMEFPAKEIALGLHPVAQSSHPAHITTG  522

Query  385  LIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFY  239
            +I I+D+TL          K+G ++ ++S  F Q   +  +L PVS GK   +LS GW +
Sbjct  523  MISITDITLRGNAMDWTMGKNGGFSTVISTGFCQPDVNSDALIPVS-GKTAFVLSHGWIF  581

Query  238  FLLFWVLILSISVKVGTFIY  179
               F VLILS+S K+G+ +Y
Sbjct  582  LTGFSVLILSLSCKIGSIMY  601



>gb|AGV29486.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=185

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 95/160 (59%), Gaps = 27/160 (17%)
 Frame = -1

Query  595  TEHKNDIASSSKP--EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNA  425
            T    + ASSSKP  E  +  S+ ++PFI   +++LGNIPAPPAFA+E P KD A RLNA
Sbjct  34   TASSGNDASSSKPVAEVPESESELEYPFI---NRVLGNIPAPPAFAAEFPTKDLAARLNA  90

Query  424  ATQASSSVHVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSH  269
            A   S ++ VTAG+++I + T          SK G   ++LSF+  +    P  L+ +S 
Sbjct  91   A---SDTIRVTAGMVRIRNTTANGNGTRWSLSKDGKVNVVLSFNVPESVVGPVGLDHLSG  147

Query  268  GKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  173
              MLSG        GWF F  F VL+L+ISVK+GT IYA+
Sbjct  148  --MLSGKAASTVARGWFGFFFFLVLLLAISVKMGTCIYAK  185



>gb|AAF09254.1|AF201456_1 NAC2 [Arabidopsis thaliana]
Length=569

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 110/211 (52%), Gaps = 38/211 (18%)
 Frame = -1

Query  733  DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPE  554
            D + + FD  + +G ++FL    P+ +     T EQ   P E   +   +   +S  K +
Sbjct  373  DDEGLTFDESLLMGPEDFL----PNPE-----TLEQKPAPKEMEKERGRRRQRSSGGKGK  423

Query  553  PTKL-----GSDFQ-------HPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQAS  410
              K+      +DF+       +PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S
Sbjct  424  WRKIFFQNKYTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSS  482

Query  409  SSVHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQ---GAQSPGSLEPVSHG  266
             SVHVTAG+++IS++TL +         K+GN  ++LSF   Q      + GS   ++  
Sbjct  483  GSVHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQQDDAMTASGSKTGITAT  542

Query  265  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            + +      F+  WVL+LS+S K+ T + AR
Sbjct  543  RAM----LVFMCLWVLLLSVSFKIVTMVSAR  569



>ref|XP_009125558.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=505

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 102/199 (51%), Gaps = 40/199 (20%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKP  557
            +D Q+   D    +G++E L ++ PS              P E   + E     +S    
Sbjct  334  EDAQNWSLDVSQLLGSEEGLDQKQPS--------------PEELEKEKESGEGSSSKQDA  379

Query  556  EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI--PKDAALRLNAATQASSSVHVTAGL  383
            + T L S  +HPF+K+ S M     APP+FAS     K+AA+RL+AA Q+S SVHVTAG+
Sbjct  380  DVTDLDSASKHPFLKKGSHMF----APPSFASSQFQTKEAAIRLHAA-QSSGSVHVTAGM  434

Query  382  IQISDLT-------LG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  233
            I+IS++T       +G    K+GN  ++LS          G ++  + G   +   F F+
Sbjct  435  IRISNMTTLAAESSMGWSYDKNGNLNVVLSL---------GLVQSKTGGTTATRAMFIFM  485

Query  232  LFWVLILSISVKVGTFIYA  176
             FW+L+L +S K+GT + A
Sbjct  486  CFWILLLYVSFKIGTIVSA  504



>ref|XP_007144249.1| hypothetical protein PHAVU_007G140500g [Phaseolus vulgaris]
 gb|ESW16243.1| hypothetical protein PHAVU_007G140500g [Phaseolus vulgaris]
Length=588

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 100/185 (54%), Gaps = 22/185 (12%)
 Frame = -1

Query  670  QSPSADKDACDTTEQAVLPNE---KAVDTEHKNDIASSSKP------EPTKLGSDFQHPF  518
            +S ++D +      Q  L  E   KAV ++H +D  +S +       E  KL  +  +PF
Sbjct  402  ESENSDSNQGSPLTQQTLEGETADKAVVSKHDSDAQTSKEAFSVQNREEEKLAPENSNPF  461

Query  517  IKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG-----  356
            +K+A   L +IPA PA A E P KD  L +++A Q+S + H+T G+I I+D+T       
Sbjct  462  VKEAYGWLASIPAAPAHAFEFPAKDITLGIHSAAQSSHTAHITTGMISITDITFRGNAMD  521

Query  355  ---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFYFLLFWVLILSISVKV  194
                K G +   +S +FSQ   +  +L P+S GK   +LS GW +   F VLILS+S K+
Sbjct  522  WPMGKSGGFNTAISTEFSQPDVNCAALIPLS-GKTAFVLSHGWIFLTGFSVLILSLSFKI  580

Query  193  GTFIY  179
            G+ +Y
Sbjct  581  GSMMY  585



>emb|CDY58437.1| BnaC03g71220D [Brassica napus]
Length=556

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 105/197 (53%), Gaps = 15/197 (8%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK-  560
            +D Q++  D    +G+++ L +Q  S    + +  E+ V   ++AV+ +   + +SS + 
Sbjct  366  EDAQNLTLDVSQLLGSEDALPDQEGSDQMPSSEDLEKNVAEGKEAVEKDESGEGSSSKQD  425

Query  559  PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAGL  383
             + T   S  ++PF+K+ASQM G   A  +FAS+   KD  L    A Q+S SVHVTAG+
Sbjct  426  ADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKDGRLH---AGQSSGSVHVTAGI  479

Query  382  IQISDLTLGS-------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFW  224
            I+IS++ L +       K+ N  ++LSF   Q      S    + G   +     F+  W
Sbjct  480  IRISNMNLAADMGWSYDKNNNLNVVLSFGLVQRDDGMSSSVNKTGGVPATRAMLIFICLW  539

Query  223  VLILSISVKVGTFIYAR  173
            VL+LS+S K+GT + AR
Sbjct  540  VLLLSVSFKIGTMVSAR  556



>gb|AHA84185.1| NAC domain-containing protein 78 [Phaseolus vulgaris]
Length=572

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 100/185 (54%), Gaps = 22/185 (12%)
 Frame = -1

Query  670  QSPSADKDACDTTEQAVLPNE---KAVDTEHKNDIASSSKP------EPTKLGSDFQHPF  518
            +S ++D +      Q  L  E   KAV ++H +D  +S +       E  KL  +  +PF
Sbjct  386  ESENSDSNQGSPLTQQTLEGETADKAVVSKHDSDAQTSKEAFSVQNREEEKLAPENSNPF  445

Query  517  IKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG-----  356
            +K+A   L +IPA PA A E P KD  L +++A Q+S + H+T G+I I+D+T       
Sbjct  446  VKEAYGWLASIPAAPAHAFEFPAKDITLGIHSAAQSSHTAHITTGMISITDITFRGNAMD  505

Query  355  ---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFYFLLFWVLILSISVKV  194
                K G +   +S +FSQ   +  +L P+S GK   +LS GW +   F VLILS+S K+
Sbjct  506  WPMGKSGGFNTAISTEFSQPDVNCAALIPLS-GKTAFVLSHGWIFLTGFSVLILSLSFKI  564

Query  193  GTFIY  179
            G+ ++
Sbjct  565  GSMMH  569



>ref|XP_009125559.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=504

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 93/161 (58%), Gaps = 28/161 (17%)
 Frame = -1

Query  616  PNEKAVDTEHKNDIASSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI--PK  449
            P+ + ++ E ++   SSSK +   T L S  +HPF+K+ S M     APP+FAS     K
Sbjct  357  PSPEELEKEKESGEGSSSKQDADVTDLDSASKHPFLKKGSHMF----APPSFASSQFQTK  412

Query  448  DAALRLNAATQASSSVHVTAGLIQISDLT-------LG---SKHGNYTIILSFDFSQGAQ  299
            +AA+RL+AA Q+S SVHVTAG+I+IS++T       +G    K+GN  ++LS        
Sbjct  413  EAAIRLHAA-QSSGSVHVTAGMIRISNMTTLAAESSMGWSYDKNGNLNVVLSL-------  464

Query  298  SPGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTFIYA  176
              G ++  + G   +   F F+ FW+L+L +S K+GT + A
Sbjct  465  --GLVQSKTGGTTATRAMFIFMCFWILLLYVSFKIGTIVSA  503



>emb|CDY44853.1| BnaC09g50530D [Brassica napus]
Length=560

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 110/208 (53%), Gaps = 33/208 (16%)
 Frame = -1

Query  733  DFQDML--FD----SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  572
            +F+D L  FD     ++ +G  + LG Q    ++++ D         ++ V  + ++   
Sbjct  365  NFEDYLNFFDDEDAQNLTLGVSQLLGSQDAPPEQESLDQKPSPEELEKEVVVEKKESGEG  424

Query  571  SSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSV  401
            SSSK +   T   SD ++PF+K++S M G    PP+FAS+   KDAA+RL+AA Q+S SV
Sbjct  425  SSSKQDADVTDFDSDSKYPFLKKSSHMFG---VPPSFASQFQTKDAAIRLHAA-QSSGSV  480

Query  400  HVTAGLIQISDLT------------LGSKHGNYTIILSFDFSQGAQSPGSLEPVSHGKML  257
            HVTAG+I+IS++T               K+G+ +++LSF   Q           +  K  
Sbjct  481  HVTAGMIRISNMTPAVDSDMGWANGANDKNGDLSVVLSFGLVQRDD--------AMSKTA  532

Query  256  SGGWFYFLLFWVLILSISVKVGTFIYAR  173
            +     FL  WVL+LS+S K+ T + AR
Sbjct  533  TRAMLVFLCLWVLLLSVSFKIVTMVSAR  560



>emb|CDY41354.1| BnaA01g31650D [Brassica napus]
Length=537

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 99/195 (51%), Gaps = 20/195 (10%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK-  560
            +D Q++ FD    +G ++ + +Q            E+      K V  E +ND A  SK 
Sbjct  356  EDDQNLTFDPSQLMGTEDVVPDQEELFQMAETKELEKEEASGGKQVVEEKENDEACCSKQ  415

Query  559  --PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTA  389
               + T+   D+++  +K+AS M G IP P  FASEI  KD  +RL A  Q+S SVHV+ 
Sbjct  416  VNADTTEFEPDYKNSVLKKASHMFGAIPTPTEFASEILTKDGVVRLQAG-QSSGSVHVS-  473

Query  388  GLIQISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVL  218
             +I +SD  +G   SK+G+    LSF   Q    PG  E       L+     F+ FWVL
Sbjct  474  -MITVSDSNMGWSYSKNGD----LSFGMVQ-ENVPGKSE-----NNLTRVMLIFICFWVL  522

Query  217  ILSISVKVGTFIYAR  173
            +LS+S KV T + +R
Sbjct  523  VLSVSFKVSTLVSSR  537



>emb|CDX70227.1| BnaA10g25760D [Brassica napus]
Length=554

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (59%), Gaps = 20/146 (14%)
 Frame = -1

Query  574  ASSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  404
             SSSK +   T   SD ++PF+K++S M G    PP+FAS+   KDAA+RL+AA Q+S S
Sbjct  417  GSSSKQDADVTDFDSDSKYPFLKKSSHMFG---VPPSFASQFQTKDAAIRLHAA-QSSGS  472

Query  403  VHVTAGLIQISDLT------LG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG  251
            VHVTAG+I+IS++T      +G    K G+  ++LSF   Q   +      +S  + +  
Sbjct  473  VHVTAGMIRISNMTPAVDSDMGWAYDKSGDLNVVLSFGLVQRDDAMSKTGGISATRAM--  530

Query  250  GWFYFLLFWVLILSISVKVGTFIYAR  173
                FL  WVL+LS+S K+ T + AR
Sbjct  531  --LIFLCLWVLLLSVSFKIVTMVSAR  554



>ref|XP_004142444.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
Length=524

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 91/174 (52%), Gaps = 20/174 (11%)
 Frame = -1

Query  748  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIA  572
            +DA  D  DM FD        E LG  SP  D+ +A     +    +++  D  H N  +
Sbjct  359  FDADGDNVDMSFDPS------EILGSGSPIPDQTEAVGGATEHASASKQTADLRHDNGAS  412

Query  571  SSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  401
            SSS  +PE  K  SD ++PF+K  S MLG+IPAP  FAS+   KDAA+ LN+A QASSSV
Sbjct  413  SSSMQRPEDPKSESDIKYPFLKHTSHMLGSIPAP--FASQFTSKDAAIHLNSAPQASSSV  470

Query  400  HVTAGLIQISDLTLG--------SKHGNYTIILSFDFSQGAQSPGSLEPVSHGK  263
             VTAG++ I ++ L          K+ +  II  +   +G      L P + GK
Sbjct  471  RVTAGMLVIRNIALNGYEVNNMYGKNSDLNIIYLYGIVEGNIDSSQLLPNAAGK  524



>ref|XP_009122601.1| PREDICTED: NAC domain-containing protein 78-like [Brassica rapa]
Length=554

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 20/146 (14%)
 Frame = -1

Query  574  ASSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  404
             SSSK +   T   SD ++PF+K++S M G    PP+FAS+   KDAA+RL+AA Q+S S
Sbjct  417  GSSSKQDADVTDFDSDSKYPFLKKSSHMFG---VPPSFASQFQTKDAAIRLHAA-QSSGS  472

Query  403  VHVTAGLIQISDLT------LG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG  251
            VHVTAG+I+IS++T      +G    K G+  ++LSF   Q   +       + G   + 
Sbjct  473  VHVTAGMIRISNMTPAVDSDMGWAYDKSGDLNVVLSFGLVQRDDAMSK----TGGTSATR  528

Query  250  GWFYFLLFWVLILSISVKVGTFIYAR  173
                FL  WVL+LS+S K+ T + AR
Sbjct  529  AMLIFLCLWVLLLSVSFKIVTMVSAR  554



>gb|AAN46239.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46240.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46241.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46242.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46243.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46244.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46245.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46246.1| unknown protein, partial [Arabidopsis thaliana]
Length=358

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 88/152 (58%), Gaps = 11/152 (7%)
 Frame = -1

Query  733  DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPE  554
            D + + FD  + +G ++FL +Q     K A    E+ V   ++AV+ +   + +SS +  
Sbjct  196  DDEGLTFDDSLLMGPEDFLPDQEALDQKPAPKELEKEVAGGKEAVEEKESGEGSSSKQDT  255

Query  553  PTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQ  377
              K   S  ++PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S SVHVTAG+++
Sbjct  256  DFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSSGSVHVTAGMMR  314

Query  376  ISDLTLGS---------KHGNYTIILSFDFSQ  308
            IS++TL +         K+GN  ++LSF   Q
Sbjct  315  ISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQ  346



>gb|AAN46238.1| unknown protein, partial [Arabidopsis thaliana]
Length=358

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 87/152 (57%), Gaps = 11/152 (7%)
 Frame = -1

Query  733  DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPE  554
            D + + FD  + +G ++FL  Q     K A    E+ V   ++AV+ +   + +SS +  
Sbjct  196  DDEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVAGGKEAVEEKESGEGSSSKQDT  255

Query  553  PTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQ  377
              K   S  ++PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S SVHVTAG+++
Sbjct  256  DFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSSGSVHVTAGMMR  314

Query  376  ISDLTLGS---------KHGNYTIILSFDFSQ  308
            IS++TL +         K+GN  ++LSF   Q
Sbjct  315  ISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQ  346



>emb|CDY14157.1| BnaC02g02740D [Brassica napus]
Length=516

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 91/160 (57%), Gaps = 31/160 (19%)
 Frame = -1

Query  616  PNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI--PKDA  443
            P+ + ++ E ++   SSS+ +     +D   PF+K+AS M     APP+F+S     KDA
Sbjct  376  PSPEELEKEKESGEGSSSRQD-----ADVTDPFLKKASHMF----APPSFSSSQFQTKDA  426

Query  442  ALRLNAATQASSSVHVTAGLIQISDLT-------LG---SKHGNYTIILSFDFSQGAQSP  293
            A+RL+AA Q+S SVHVTAG+++IS++T       +G    K+GN  I++S          
Sbjct  427  AIRLHAA-QSSGSVHVTAGMMRISNMTTLAAESSMGWSYDKNGNLNIVMSL---------  476

Query  292  GSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  173
            G ++  + G   +     F+ FW+L+L IS K+GT + AR
Sbjct  477  GLVQSKTGGITTTRAMLIFMCFWILLLYISFKIGTIVSAR  516



>gb|EPS65703.1| nam-like protein 9 [Genlisea aurea]
Length=542

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 13/131 (10%)
 Frame = -1

Query  535  DFQHPFIKQASQMLGNIPAPPAFASE--IPKDAALRLNAATQASSSVHVTAGLIQISD--  368
            D + PF+K+A++MLG+  APPAFASE       +L LN  + AS SV VTAG+I+ISD  
Sbjct  409  DLESPFVKRANRMLGSFDAPPAFASEPSFSSKDSLSLNLLSGASGSVRVTAGMIRISDGY  468

Query  367  ---LTLGSKHGNYTIILSFDFSQGAQSPGSLE------PVSHGKMLSGGWFYFLLFWVLI  215
                     H    I++S  F +G     SLE      P      +S  WFYF    +++
Sbjct  469  DEASAKYDDHSKLNIVVSLGFCRGDDGSASLESSVRILPGKAVAAISRSWFYFTCLCIVL  528

Query  214  LSISVKVGTFI  182
             SI++K+G  +
Sbjct  529  FSITIKLGMCV  539



>ref|XP_009130822.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=566

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 102/197 (52%), Gaps = 15/197 (8%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIASSSK  560
            +D Q++  D    +G+++ L EQ    ++  +    E+ V   ++AV+ +   + ++S  
Sbjct  376  EDGQNLTLDVSQLLGSEDALPEQEGGLEQIPSSGDLEKEVAQGKEAVEKDESGEGSTSKH  435

Query  559  -PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGL  383
              + T   S  ++PF+K+ASQM G   A  +FAS+    A L    A Q S SVHVTAG+
Sbjct  436  DADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKARLH---AGQPSGSVHVTAGI  489

Query  382  IQISDLTLGS-------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFW  224
            I+IS++ L +       K+ N  ++LSF   Q      S    + G   +     FL  W
Sbjct  490  IRISNMNLAADMGWSYDKNNNLNVVLSFGSVQRDDGMSSSVNKTGGVPATRAMLIFLCLW  549

Query  223  VLILSISVKVGTFIYAR  173
            +L+LS+S K+GT + AR
Sbjct  550  ILLLSVSFKIGTMVSAR  566



>ref|XP_009130821.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=567

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 102/198 (52%), Gaps = 16/198 (8%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADK--DACDTTEQAVLPNEKAVDTEHKNDIASSS  563
            +D Q++  D    +G+++ L EQ    ++   +    E+ V   ++AV+ +   + ++S 
Sbjct  376  EDGQNLTLDVSQLLGSEDALPEQEGGLEQIQPSSGDLEKEVAQGKEAVEKDESGEGSTSK  435

Query  562  K-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAG  386
               + T   S  ++PF+K+ASQM G   A  +FAS+    A L    A Q S SVHVTAG
Sbjct  436  HDADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKARLH---AGQPSGSVHVTAG  489

Query  385  LIQISDLTLGS-------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLF  227
            +I+IS++ L +       K+ N  ++LSF   Q      S    + G   +     FL  
Sbjct  490  IIRISNMNLAADMGWSYDKNNNLNVVLSFGSVQRDDGMSSSVNKTGGVPATRAMLIFLCL  549

Query  226  WVLILSISVKVGTFIYAR  173
            W+L+LS+S K+GT + AR
Sbjct  550  WILLLSVSFKIGTMVSAR  567



>gb|AAN46250.1| unknown protein, partial [Arabidopsis lyrata]
Length=359

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 94/162 (58%), Gaps = 21/162 (13%)
 Frame = -1

Query  733  DFQDML--FDSDIFIGND-EFLGEQSPSADKDACDTT------EQAVLPNEKAVDTEHKN  581
            +F+D L  FD + F  +D +F+G +    + +  D        E+ V   ++AV+ +   
Sbjct  187  NFEDYLNFFDDESFTLDDSQFMGPEDALPNLEGLDQKPTPEELEKEVAGGKEAVEEKESG  246

Query  580  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASS  407
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+   KDAA+RL+AA Q+S 
Sbjct  247  EGSSSKQDADVKDFDSASKYPFLKKTSHMLGAIPTPSSFASQFQTKDAAMRLHAA-QSSG  305

Query  406  SVHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQ  308
            SVHVTAG+I+IS++TL +         K+GN  ++LSF   Q
Sbjct  306  SVHVTAGMIRISNMTLSADSGMGWSYDKNGNLNVVLSFGVVQ  347



>ref|XP_009122853.1| PREDICTED: NAC domain-containing protein 78 [Brassica rapa]
Length=537

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 98/195 (50%), Gaps = 20/195 (10%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK-  560
            +D Q++ FD    +G ++ + +Q            E+      K V  E +ND A  SK 
Sbjct  356  EDDQNLTFDPSQLMGTEDVVPDQEELFQMAEAKEVEKEEASGGKQVVEEKENDEACCSKQ  415

Query  559  --PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTA  389
               + T+   D ++  +K+AS M G IP P  FASEI  KD  +RL A  Q+S SVHV+ 
Sbjct  416  VNADTTEFEPDNKNSVLKKASHMFGAIPTPTEFASEILTKDGVVRLQAG-QSSGSVHVS-  473

Query  388  GLIQISDLTLG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVL  218
             +I +SD  +G   SK+G+    LSF   Q    PG  E      ML      F+ FWVL
Sbjct  474  -MITVSDSNMGWSYSKNGD----LSFGMVQ-ENVPGKSENNLTRMML-----IFVCFWVL  522

Query  217  ILSISVKVGTFIYAR  173
            +LS+S KV T + +R
Sbjct  523  VLSVSFKVSTLVSSR  537



>emb|CDY11289.1| BnaA03g01250D [Brassica napus]
Length=566

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 106/198 (54%), Gaps = 17/198 (9%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIASSSK  560
            +D Q++  D    +G+++ L EQ    ++  +    E+ V   ++AV+ +   + ++S  
Sbjct  376  EDGQNLTLDVSQLLGSEDALPEQEGGLEQIPSSGDLEKEVAQGKEAVEKDESGEGSTSKH  435

Query  559  -PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAG  386
              + T   S  ++PF+K+ASQM G   A  +FAS+   KD   RL+A  Q+S SVHVTAG
Sbjct  436  DADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKD---RLHAG-QSSGSVHVTAG  488

Query  385  LIQISDLTLGS-------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLF  227
            +I+IS++ L +       K+ N  ++LSF   Q      S    + G   +     FL  
Sbjct  489  IIRISNMNLAADMGWSYDKNNNLNVVLSFGSVQRDDGMSSSVNKTGGVPATRAMLIFLCL  548

Query  226  WVLILSISVKVGTFIYAR  173
            W+L+LS+S K+GT + AR
Sbjct  549  WILLLSVSFKIGTMVSAR  566



>gb|AAN46247.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46248.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46249.1| unknown protein, partial [Arabidopsis lyrata]
Length=359

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 75/119 (63%), Gaps = 12/119 (10%)
 Frame = -1

Query  631  EQAVLPNEKAVDTEHKNDIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEI  455
            E+ V   ++AV+ +   + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+ 
Sbjct  230  EKEVAGGKEAVEEKESGEGSSSKQDADVKDFDSASKYPFLKKTSHMLGAIPTPSSFASQF  289

Query  454  -PKDAALRLNAATQASSSVHVTAGLIQISDLTLGS---------KHGNYTIILSFDFSQ  308
              KDAA+RL+AA Q+S SVHVTAG+I+IS+LTL +         K+GN  ++LSF   Q
Sbjct  290  QTKDAAMRLHAA-QSSGSVHVTAGMIRISNLTLAADSGMGWSYDKNGNLNVVLSFGVVQ  347



>gb|AAN46251.1| unknown protein, partial [Arabidopsis lyrata]
Length=359

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 11/84 (13%)
 Frame = -1

Query  529  QHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAGLIQISDLTLGS  353
            ++PF+K+ S MLG IP P +FAS+   KDAA+RL+AA Q+S SVHVTAG+I+IS+LTL +
Sbjct  265  KYPFLKKTSHMLGAIPTPSSFASQFQTKDAAMRLHAA-QSSGSVHVTAGMIRISNLTLAA  323

Query  352  ---------KHGNYTIILSFDFSQ  308
                     K+GN  ++LSF   Q
Sbjct  324  DSGMGWSYDKNGNLNVVLSFGVVQ  347



>emb|CDY61762.1| BnaAnng17650D [Brassica napus]
Length=519

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 98/198 (49%), Gaps = 43/198 (22%)
 Frame = -1

Query  736  DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKP  557
            +D Q++  D    +G++E L +Q PS              P E   + E     +S    
Sbjct  355  EDAQNLSLDVSQLLGSEEGL-DQKPS--------------PEELEKEKESGEGSSSKQDA  399

Query  556  EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQ  377
            + T L S  ++PF+K+AS +     A   F +   KDAA+RL+AA   S SVHVTAG+I+
Sbjct  400  DVTDLDSASKYPFLKKASHIF----ASSQFQT---KDAAIRLHAAQ--SGSVHVTAGMIR  450

Query  376  ISDLT-------LG---SKHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLF  227
            IS++T       +G    K+GN  I+LS          G ++  + G   +     F+ F
Sbjct  451  ISNMTTLAADSSMGWSYDKNGNLNIVLSL---------GLVQSKTGGITATRAMLIFMCF  501

Query  226  WVLILSISVKVGTFIYAR  173
            W+L+L +S K+GT + AR
Sbjct  502  WILVLYVSFKIGTIVSAR  519



>ref|XP_010940544.1| PREDICTED: uncharacterized protein LOC105059077 [Elaeis guineensis]
Length=688

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 77/136 (57%), Gaps = 24/136 (18%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  353
              K+   MLG+I APPA A+E P  +  R+   +AT ++SS+HVT G+IQI  +T+ GS 
Sbjct  557  ITKRLVNMLGSISAPPAIAAEYPAGSEKRVGRISATHSTSSIHVTTGMIQIRGITVTGST  616

Query  352  ------KHGNYTIILSFDFSQGAQSPGSLE----------PVSHGKMLSGGWFYFLLFWV  221
                  K+G+ +++LS+  + G +   S+           PVS   +L GG + F L   
Sbjct  617  EHWSLPKNGDMSLLLSYSLA-GDEVRKSMRFDSISKLQGGPVS--MVLRGGCYLFFLS-A  672

Query  220  LILSISVKVGTFIYAR  173
            LIL+IS K+G  IY+R
Sbjct  673  LILTISYKLGLCIYSR  688



>ref|XP_006648145.1| PREDICTED: NAC domain-containing protein 78-like [Oryza brachyantha]
Length=636

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 14/129 (11%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  353
            F K+ + MLG+IPAPPA ASE+P      +   +A   +SS+ VTAG+IQ+  LT  GS 
Sbjct  509  FGKRLASMLGSIPAPPAMASELPPSTGKSVGPLSAVNPNSSIRVTAGIIQLGSLTFTGST  568

Query  352  ----KHGNYTIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  200
                K+G++ ++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  569  ERLQKNGDFNLVLSFTV-EGDVSTKSIDFEPDRQMSTTPMVFRSGMYLFFVSAMILMLSY  627

Query  199  KVGTFIYAR  173
            KVG  IY+R
Sbjct  628  KVGLCIYSR  636



>ref|XP_003570443.1| PREDICTED: NAC domain-containing protein 78 [Brachypodium distachyon]
Length=648

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 15/131 (11%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTLGS--  353
            F K+ + +LG+IPAPPA ASE P      +   +A    SS+HVTAG++Q+  LT     
Sbjct  518  FGKRFASVLGSIPAPPAMASEFPPATGKSVASLSAVNGPSSIHVTAGIVQLGGLTFSGSS  577

Query  352  ------KHGNYTIILSFDFSQ--GAQSPGSLEP---VSHGKMLSGGWFYFLLFWVLILSI  206
                  K+G+++++LSF        +S G  EP   +S   M+  G  Y      +IL  
Sbjct  578  EHWPLQKNGDFSLLLSFTVESDVSTKSVGFDEPATQLSTVPMVLRGGLYLFFVSAMILMF  637

Query  205  SVKVGTFIYAR  173
            S KVG+ IY+R
Sbjct  638  SYKVGSCIYSR  648



>ref|XP_002453065.1| hypothetical protein SORBIDRAFT_04g037720 [Sorghum bicolor]
 gb|EES06041.1| hypothetical protein SORBIDRAFT_04g037720 [Sorghum bicolor]
Length=652

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 14/130 (11%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQ-ASSSVHVTAGLIQISDLTLGS---  353
            + K+ + MLG+IPAPPA ASE P      +   +  +SSS+ VTAG+IQ+  LT  S   
Sbjct  523  YGKRLASMLGSIPAPPAMASEFPPSTGKSVGMLSAVSSSSIRVTAGIIQLDGLTFSSGSD  582

Query  352  -----KHGNYTIILSFDFSQGAQS--PGSLE---PVSHGKMLSGGWFYFLLFWVLILSIS  203
                 K+G+ ++++SF       S  P  LE    +S   M+    FY      +IL +S
Sbjct  583  RWPLQKNGDLSLLVSFAVESDVSSKLPVGLEDATRISTVPMVMRSGFYLFFMSAMILLLS  642

Query  202  VKVGTFIYAR  173
             KVG+ IY+R
Sbjct  643  YKVGSCIYSR  652



>gb|AAO72552.1| NAC-like protein [Oryza sativa Japonica Group]
Length=507

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 14/129 (11%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  353
            F K+ + MLG+IPAPPA ASE P      +   +A   SSS+ VTAG+IQ+  +T  GS 
Sbjct  380  FGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGITFTGST  439

Query  352  ----KHGNYTIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  200
                K+G++ ++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  440  EHLQKNGDFNLLLSFTV-EGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMILMLSY  498

Query  199  KVGTFIYAR  173
            KVG  IY+R
Sbjct  499  KVGLCIYSR  507



>ref|XP_008779162.1| PREDICTED: uncharacterized protein LOC103698888 [Phoenix dactylifera]
Length=688

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 18/133 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  353
              K+   MLG+I APPA A+E P  +  R    + T ++SS+HVTAG+IQI  LT+ GS 
Sbjct  557  ITKRLVNMLGSISAPPAIAAEYPAGSEKRAGQISTTNSASSIHVTAGMIQIRGLTVTGST  616

Query  352  ------KHGNYTIILSFDFSQGAQSPGSLEPVSHGKMLSG-------GWFYFLLFWVLIL  212
                  K+G+   +LS+  + G +   S+   S  KM  G       G FY      L+L
Sbjct  617  EHWSLQKNGDVGFLLSYGLA-GNEVRKSILLDSISKMQGGPVSMMLRGGFYLFFLSALLL  675

Query  211  SISVKVGTFIYAR  173
            +IS K+G  IY++
Sbjct  676  TISYKMGLCIYSK  688



>gb|EAY88066.1| hypothetical protein OsI_09496 [Oryza sativa Indica Group]
Length=633

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 14/129 (11%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  353
            F K+ + MLG+IPAPPA ASE P      +   +A   SSS+ VTAG+IQ+  +T  GS 
Sbjct  506  FGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGITFTGST  565

Query  352  ----KHGNYTIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  200
                K+G++ ++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  566  ERMQKNGDFNLLLSFTV-EGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMILMLSY  624

Query  199  KVGTFIYAR  173
            KVG  IY+R
Sbjct  625  KVGLCIYSR  633



>ref|NP_001048559.1| Os02g0822400 [Oryza sativa Japonica Group]
 dbj|BAD22894.1| putative NAC2 [Oryza sativa Japonica Group]
 dbj|BAD23126.1| putative NAC2 [Oryza sativa Japonica Group]
 dbj|BAF10473.1| Os02g0822400 [Oryza sativa Japonica Group]
 gb|EAZ25123.1| hypothetical protein OsJ_08923 [Oryza sativa Japonica Group]
 dbj|BAG95424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=632

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 14/129 (11%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  353
            F K+ + MLG+IPAPPA ASE P      +   +A   SSS+ VTAG+IQ+  +T  GS 
Sbjct  505  FGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGITFTGST  564

Query  352  ----KHGNYTIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  200
                K+G++ ++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  565  EHLQKNGDFNLLLSFTV-EGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMILMLSY  623

Query  199  KVGTFIYAR  173
            KVG  IY+R
Sbjct  624  KVGLCIYSR  632



>ref|XP_008787444.1| PREDICTED: NAC domain-containing protein 78 [Phoenix dactylifera]
Length=661

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 72/134 (54%), Gaps = 23/134 (17%)
 Frame = -1

Query  514  KQASQMLGNIPAPPAFASEIP---KDAALRLNAATQASSSVHVTAGLIQISDLTLG----  356
            K+   MLG+I APPA A+E P    +  +   + T ++SSVHVTAG+IQI DLT+     
Sbjct  531  KRLVNMLGSISAPPALAAEYPVGRSEKPVGQISETHSASSVHVTAGMIQIRDLTVTGHTK  590

Query  355  ----SKHGNYTIILSFDFSQGAQSPGSL--EPVSHGKMLSG-------GWFYFLLFWVLI  215
                 K+G+   +LS+  + G +   S+  +P+S  KM  G       G FY      LI
Sbjct  591  HWSLQKNGDADFLLSYSMA-GNEVSNSIGFDPIS--KMQGGPLSVVLRGGFYLFFLSALI  647

Query  214  LSISVKVGTFIYAR  173
            L++S +VG  I +R
Sbjct  648  LTVSYRVGLCICSR  661



>ref|XP_009418258.1| PREDICTED: uncharacterized protein LOC103998499 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 21/128 (16%)
 Frame = -1

Query  502  QMLGNIPAPPAFASEIPKDAALRL--NAATQASSSVHVTAGLIQISDLTLG--------S  353
             MLG+IPAPPAFA+E P  AA  +   +A   +SS+HVT G + I D T+          
Sbjct  551  NMLGSIPAPPAFAAEYPAGAAKSMAQTSAVHPASSIHVTTGFVYICDPTVSGSVGHWSLQ  610

Query  352  KHGNYTIILSFDFSQGAQ--------SPGSLEPVSHGKMLSGGWFYFLLFWVLILSISVK  197
            K+G+ + ILS+  +            S   ++ VS   +L GG  Y L    L L+IS K
Sbjct  611  KNGHASFILSYRMADNVSRKTSDFVPSKNQVDAVS--VVLRGG-LYVLFLLPLFLTISYK  667

Query  196  VGTFIYAR  173
            VG  I  R
Sbjct  668  VGITICGR  675



>gb|ACF82881.1| unknown [Zea mays]
Length=258

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 80/184 (43%), Gaps = 41/184 (22%)
 Frame = -1

Query  676  GEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQM  497
            G  S  + +D    TE   +P +   D  + N +AS                       M
Sbjct  100  GASSSGSHEDLYTDTEFLGVPTDDTADKTYGNRLAS-----------------------M  136

Query  496  LGNIPAPPAFASEIPKD---AALRLNAATQASSSVHVTAGLIQISDLTLGS--------K  350
            LG+IPAPPA ASE P     +A  L+A +  SSS+  TAG+IQ+  LT  S        K
Sbjct  137  LGSIPAPPAMASEFPPSTGKSAGMLSAVS--SSSIRFTAGIIQLDGLTFSSGSGQWPLQK  194

Query  349  HGNYTIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTF  185
            +G+ ++++SF       S      G    +S   M+    FY      +IL  S KVG+ 
Sbjct  195  NGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMILLFSYKVGSC  254

Query  184  IYAR  173
            IY+R
Sbjct  255  IYSR  258



>ref|XP_004954444.1| PREDICTED: NAC domain-containing protein 78-like [Setaria italica]
Length=638

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 13/129 (10%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQAS-SSVHVTAGLIQISDLTLGS---  353
            F K+ + MLG+IPAPPA ASE P      +   +  S SS+ VTAG+IQ+  L+      
Sbjct  510  FGKRFAGMLGSIPAPPAMASEFPPATGKSVGVLSAVSPSSIRVTAGIIQLDGLSFTGASE  569

Query  352  -----KHGNYTIILSF----DFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSISV  200
                 K+G+++++LSF    D S  A        +S   M+     Y      +IL +S 
Sbjct  570  RWPLQKNGDFSLLLSFTVESDMSTKAACFEQASRMSTIPMVLRSGMYLFFVSAMILVLSY  629

Query  199  KVGTFIYAR  173
            K+G+ IY+R
Sbjct  630  KIGSCIYSR  638



>gb|ACN34478.1| unknown [Zea mays]
Length=524

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 18/132 (14%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIPKD---AALRLNAATQASSSVHVTAGLIQISDLTLGS-  353
            +  + + MLG+IPAPPA ASE P     +A  L+A +  SSS+  TAG+IQ+  LT  S 
Sbjct  395  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGMLSAVS--SSSIRFTAGIIQLDGLTFSSG  452

Query  352  -------KHGNYTIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLILS  209
                   K+G+ ++++SF       S      G    +S   M+    FY      +IL 
Sbjct  453  SGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMILL  512

Query  208  ISVKVGTFIYAR  173
             S KVG+ IY+R
Sbjct  513  FSYKVGSCIYSR  524



>gb|ACN28830.1| unknown [Zea mays]
 gb|AFW63946.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|AIB04476.1| NAC transcription factor, partial [Zea mays]
Length=657

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP----KDAALRLNAATQASSSVHVTAGLIQISDLTLGS  353
            +  + + MLG+IPAPPA ASE P    K A + L+A +  SSS+  TAG+IQ+  LT  S
Sbjct  528  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGM-LSAVS--SSSIRFTAGIIQLDGLTFSS  584

Query  352  --------KHGNYTIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLIL  212
                    K+G+ ++++SF       S      G    +S   M+    FY      +IL
Sbjct  585  GSGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMIL  644

Query  211  SISVKVGTFIYAR  173
              S KVG+ IY+R
Sbjct  645  LFSYKVGSCIYSR  657



>ref|NP_001152531.1| NAC domain-containing protein 78 [Zea mays]
 gb|ACG48054.1| NAC domain-containing protein 78 [Zea mays]
Length=657

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP----KDAALRLNAATQASSSVHVTAGLIQISDLTLGS  353
            +  + + MLG+IPAPPA ASE P    K A + L+A +  SSS+  TAG+IQ+  LT  S
Sbjct  528  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGM-LSAVS--SSSIRFTAGIIQLDGLTFSS  584

Query  352  --------KHGNYTIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLIL  212
                    K+G+ ++++SF       S      G    +S   M+    FY      +IL
Sbjct  585  GSGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMIL  644

Query  211  SISVKVGTFIYAR  173
              S KVG+ IY+R
Sbjct  645  LFSYKVGSCIYSR  657



>ref|XP_010935813.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Elaeis 
guineensis]
Length=668

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (55%), Gaps = 20/132 (15%)
 Frame = -1

Query  514  KQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS---  353
            K+   MLG+I APPA A+E P  +   +   + T ++SS+H TAG+IQI  LT+ GS   
Sbjct  539  KRLVNMLGSISAPPAIAAEYPVRSEKPVGQISETHSASSIHFTAGMIQIRGLTVTGSTEH  598

Query  352  ----KHGNYTIILSF--DFSQGAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILS  209
                K+G+   +LS+  D  +  +S G  EP+S  +      +L GG FY      LIL+
Sbjct  599  WSLQKNGDVDFLLSYGMDGDEARKSIG-FEPISKIQGGLASVVLRGG-FYLFFLSALILT  656

Query  208  ISVKVGTFIYAR  173
            +S  VG  I +R
Sbjct  657  VSYGVGLCICSR  668



>ref|XP_010935812.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Elaeis 
guineensis]
Length=689

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (55%), Gaps = 20/132 (15%)
 Frame = -1

Query  514  KQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS---  353
            K+   MLG+I APPA A+E P  +   +   + T ++SS+H TAG+IQI  LT+ GS   
Sbjct  560  KRLVNMLGSISAPPAIAAEYPVRSEKPVGQISETHSASSIHFTAGMIQIRGLTVTGSTEH  619

Query  352  ----KHGNYTIILSF--DFSQGAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILS  209
                K+G+   +LS+  D  +  +S G  EP+S  +      +L GG FY      LIL+
Sbjct  620  WSLQKNGDVDFLLSYGMDGDEARKSIG-FEPISKIQGGLASVVLRGG-FYLFFLSALILT  677

Query  208  ISVKVGTFIYAR  173
            +S  VG  I +R
Sbjct  678  VSYGVGLCICSR  689



>ref|XP_008677410.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Zea mays]
Length=551

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -1

Query  520  FIKQASQMLGNIPAPPAFASEIP----KDAALRLNAATQASSSVHVTAGLIQISDLTLGS  353
            +  + + MLG+IPAPPA ASE P    K A + L+A +  SSS+  TAG+IQ+  LT  S
Sbjct  422  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGM-LSAVS--SSSIRFTAGIIQLDGLTFSS  478

Query  352  --------KHGNYTIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLIL  212
                    K+G+ ++++SF       S      G    +S   M+    FY      +IL
Sbjct  479  GSGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMIL  538

Query  211  SISVKVGTFIYAR  173
              S KVG+ IY+R
Sbjct  539  LFSYKVGSCIYSR  551



>gb|EMS63008.1| NAC domain-containing protein 78 [Triticum urartu]
Length=628

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 16/126 (13%)
 Frame = -1

Query  505  SQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTL----GS----K  350
            + MLG+ PAPPA ASE P      + AA    S + VTAG++Q+ D +     GS    K
Sbjct  504  TNMLGSYPAPPAMASEFPPTTGKSI-AALSGPSQIRVTAGIVQLGDHSFTGNEGSWPLQK  562

Query  349  HGNYTIILSFDFSQGAQSPGSL---EP----VSHGKMLSGGWFYFLLFWVLILSISVKVG  191
            +G + ++LSF       +       EP    VS   M+  G  Y      +IL +S KVG
Sbjct  563  NGVFNLLLSFTVENNVSTKSITFDDEPAATRVSTVPMVLRGGLYLFFVSAMILMLSFKVG  622

Query  190  TFIYAR  173
            + IY+R
Sbjct  623  SCIYSR  628



>gb|EMT07836.1| hypothetical protein F775_28266 [Aegilops tauschii]
Length=559

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 18/127 (14%)
 Frame = -1

Query  505  SQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTL----GS----K  350
            + MLG+ PAPPA ASE P      + AA    S + VTAG++Q+ D +     GS    K
Sbjct  404  TNMLGSYPAPPAMASEFPPTTGKSI-AALSGPSQIRVTAGIVQLGDHSFTGNEGSWPLQK  462

Query  349  HGNYTIILSFDFSQGAQS--------PGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKV  194
            +G + ++LSF       +        P +    +   +L GG + F +   +IL +S KV
Sbjct  463  NGVFNLLLSFTVESNVSTKSISFGDEPATTRVSAVPTVLRGGLYLFFV-SAMILMLSFKV  521

Query  193  GTFIYAR  173
            G+ IY+R
Sbjct  522  GSCIYSR  528



>dbj|BAJ97673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=641

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 18/127 (14%)
 Frame = -1

Query  505  SQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------K  350
            + MLG+ PAPPA ASE P      + AA    S + VTAG++Q+ D +           K
Sbjct  517  ANMLGSYPAPPAMASEFPPTTGKSI-AALSGPSQIRVTAGIVQLGDHSFTGNSDNWPLQK  575

Query  349  HGNYTIILSFDFSQGAQS--------PGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKV  194
            +G + ++LSF       +        P +    +   +L GG + F +   +IL +S KV
Sbjct  576  NGVFNLLLSFTVESNVSTKLIGFDDEPATTRVSTVPTVLRGGLYLFFVS-AMILMLSFKV  634

Query  193  GTFIYAR  173
            G+ IY+R
Sbjct  635  GSCIYSR  641



>ref|XP_009383919.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=672

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 63/134 (47%), Gaps = 23/134 (17%)
 Frame = -1

Query  514  KQASQMLGNIPAPPAFASEIPKDAALRLNA--ATQASSSVHVTAGLIQISDLTLGS----  353
            K    MLG+IPAPPA A+E P  +   +       ++SS+HVTAG   I   T+      
Sbjct  542  KHLLNMLGSIPAPPACAAEFPSGSGKSVAQIPGNHSASSIHVTAGFFHICGSTMSENAGY  601

Query  352  ----KHGNYTIILSFD----------FSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLI  215
                K+G+  +ILS++             G  +   ++ VS   ML  G + F L   LI
Sbjct  602  WSLQKNGHVDLILSYNSMADNLVRKTVGPGCIAKNQVDVVS--VMLRVGLYVFFL-SALI  658

Query  214  LSISVKVGTFIYAR  173
            L+IS KVG  I  R
Sbjct  659  LTISHKVGMSICGR  672



>ref|XP_009383926.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 63/134 (47%), Gaps = 23/134 (17%)
 Frame = -1

Query  514  KQASQMLGNIPAPPAFASEIPKDAALRLNA--ATQASSSVHVTAGLIQISDLTLGS----  353
            K    MLG+IPAPPA A+E P  +   +       ++SS+HVTAG   I   T+      
Sbjct  514  KHLLNMLGSIPAPPACAAEFPSGSGKSVAQIPGNHSASSIHVTAGFFHICGSTMSENAGY  573

Query  352  ----KHGNYTIILSFD----------FSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLI  215
                K+G+  +ILS++             G  +   ++ VS   ML  G + F L   LI
Sbjct  574  WSLQKNGHVDLILSYNSMADNLVRKTVGPGCIAKNQVDVVS--VMLRVGLYVFFL-SALI  630

Query  214  LSISVKVGTFIYAR  173
            L+IS KVG  I  R
Sbjct  631  LTISHKVGMSICGR  644



>ref|XP_009418629.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 28/126 (22%)
 Frame = -1

Query  502  QMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------KH  347
             MLG+I APPAFA+E P  A+L          S HVT G++ +  L+  S        K+
Sbjct  544  NMLGSISAPPAFAAEYP--ASLE---------STHVTVGMVDVHGLSATSSTGHCSLQKN  592

Query  346  GNYTIILSFDFSQ--GAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILSISVKVG  191
            GN  ++LS+  ++  G +     +P    +      +L GG + F L   L+L+IS KVG
Sbjct  593  GNGDLLLSYSIAENLGRKKSSGFQPFRKIQDWTVSFLLRGGCYPFFL-SALVLTISYKVG  651

Query  190  TFIYAR  173
              IY +
Sbjct  652  MCIYGK  657



>ref|XP_009418630.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 28/126 (22%)
 Frame = -1

Query  502  QMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------KH  347
             MLG+I APPAFA+E P  A+L          S HVT G++ +  L+  S        K+
Sbjct  503  NMLGSISAPPAFAAEYP--ASLE---------STHVTVGMVDVHGLSATSSTGHCSLQKN  551

Query  346  GNYTIILSFDFSQ--GAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILSISVKVG  191
            GN  ++LS+  ++  G +     +P    +      +L GG + F L   L+L+IS KVG
Sbjct  552  GNGDLLLSYSIAENLGRKKSSGFQPFRKIQDWTVSFLLRGGCYPFFL-SALVLTISYKVG  610

Query  190  TFIYAR  173
              IY +
Sbjct  611  MCIYGK  616



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630