BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018B18

Length=793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009760820.1|  PREDICTED: uncharacterized protein LOC104213...    107   2e-22   Nicotiana sylvestris
ref|XP_006347316.1|  PREDICTED: uncharacterized protein LOC102605066  95.9    9e-19   Solanum tuberosum [potatoes]
ref|XP_009759914.1|  PREDICTED: uncharacterized protein LOC104212382  87.8    1e-18   Nicotiana sylvestris
ref|XP_009608176.1|  PREDICTED: uncharacterized protein LOC104102223  87.0    2e-18   Nicotiana tomentosiformis
gb|AAM47025.1|  nam-like protein 1                                    92.4    1e-17   Petunia x hybrida [garden petunia]
ref|XP_009596681.1|  PREDICTED: NAC domain-containing protein 74-...  84.0    8e-15   Nicotiana tomentosiformis
gb|AGY49286.1|  putative membrane bound NAC transcription factor 1    73.6    2e-14   Nicotiana benthamiana
emb|CDP04976.1|  unnamed protein product                              82.0    3e-14   Coffea canephora [robusta coffee]
ref|XP_011075874.1|  PREDICTED: NAC domain-containing protein 45      76.6    7e-13   Sesamum indicum [beniseed]
ref|NP_001274765.1|  uncharacterized LOC102593794                     78.2    7e-13   Solanum tuberosum [potatoes]
ref|XP_010318064.1|  PREDICTED: uncharacterized protein LOC101253566  75.5    5e-12   
ref|XP_004241429.1|  PREDICTED: uncharacterized protein LOC101257973  62.8    7e-08   
gb|EYU45332.1|  hypothetical protein MIMGU_mgv1a003123mg              62.0    1e-07   Erythranthe guttata [common monkey flower]



>ref|XP_009760820.1| PREDICTED: uncharacterized protein LOC104213101 isoform X1 [Nicotiana 
sylvestris]
Length=645

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 100/188 (53%), Gaps = 16/188 (9%)
 Frame = -2

Query  693  SEEVTQMLAEPVG---FENELFVTNNQEALLQRQVNYVANSLVGTFGTPTMGSDHQNWNL  523
            SE   Q++ EPVG   FE E+   N+ +  L R+VN VA ++   F TP + +DH   NL
Sbjct  384  SESKAQVMQEPVGTDFFEPEVLRGNSAQTALTREVNSVATTVEVAFATPNVSNDHSMGNL  443

Query  522  DLQNNNYLGQSLFSSVSNGTVAPQMVFPQ----AETVGNISSSAPAITLRTRQPQNQRGD  355
            D  NN+Y G +  S+ S G   P ++  +      TVG+ S     I LRTR  QNQ  D
Sbjct  444  DFLNNDYPGDAALSAGSGGMQVPFLLNVEDSSTYSTVGSDSGFGTGIKLRTRLKQNQPDD  503

Query  354  QQ--SAAQGTAPRRIRFQKKLQVGPVQCLRPQTTPEDN-------TVSKEDASTVDKPNS  202
            +Q  S  QGT+ RRIRFQ KLQ G VQC  P  + +         TVS+ D  +++  ++
Sbjct  504  KQFGSGTQGTSHRRIRFQMKLQAGSVQCRTPIDSDKGGANYKGLLTVSESDKFSIEDSST  563

Query  201  TASATAQD  178
              +A + D
Sbjct  564  AGAAISSD  571



>ref|XP_006347316.1| PREDICTED: uncharacterized protein LOC102605066 [Solanum tuberosum]
Length=630

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 91/176 (52%), Gaps = 8/176 (5%)
 Frame = -2

Query  681  TQMLAEPVG---FENELFVTNNQEALLQRQVNYVANSLVGTFGTPTMGSDHQNWNLDLQN  511
            +Q+  EPV    FE EL + N  E  + R+VN VA ++   F TP + +DH   NLD  N
Sbjct  376  SQVTQEPVRRDFFEPELLLGNYGETAVMREVNSVATTVDEAFATPYVRNDHSMANLDFLN  435

Query  510  NNYLGQSLFSSVSNGT-VAPQMVFPQAETVGNI-SSSAPAITLRTRQPQNQRGDQQ--SA  343
            N Y G+ + S+ S G  V   + F ++    N+ + SA  IT RTRQ QNQ  D Q  S 
Sbjct  436  NGYPGEVILSAGSGGMQVDSSLNFDESNGYSNVGTDSAFGITRRTRQVQNQPDDSQLGSG  495

Query  342  AQGTAPRRIRFQKKLQVGPVQCLRPQTTPEDNTVSKEDASTVDKPNSTASATAQDP  175
             QGT  RRIR+Q KLQ G V+C  P T  +      E  STV +     +  A  P
Sbjct  496  MQGTTVRRIRYQVKLQAGRVECRMP-TDSDQGGADHEGLSTVSESEKFFNEEASTP  550



>ref|XP_009759914.1| PREDICTED: uncharacterized protein LOC104212382 [Nicotiana sylvestris]
Length=640

 Score = 87.8 bits (216),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 98/198 (49%), Gaps = 19/198 (10%)
 Frame = -2

Query  723  PAALVSSDG---ESE-EVTQMLAEPVGFENELFVTNNQEALLQRQVNYVANSLVGTFGT-  559
            P A +   G   ESE EVTQ L EP  FE E+    ++E  ++R+VN +  ++    G+ 
Sbjct  373  PCAPIKDSGSCSESEAEVTQRLVEPDFFEPEVLGNFDRETAVKREVNSIGATVQEARGSA  432

Query  558  PTMGSDHQNWNLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAETVGNISS-------SAP  400
            P +  DH   NLD   ++Y GQ+++ +  +    P   FP  E  G  S+       S  
Sbjct  433  PYVSHDHAMGNLDFFEHSYPGQNIYPAGYSAIQVPN--FPSVEQSGGYSNVVSSDSGSGT  490

Query  399  AITLRTRQPQNQRGDQQSAAQGTAPRRIRFQKKLQVGPVQCLRPQTT----PEDNTVSKE  232
             I LR RQ QNQ  D+Q   QGTA RRIR Q KLQVG V+  R  T     PE +    E
Sbjct  491  GIKLRPRQMQNQSDDRQFRTQGTANRRIRLQVKLQVGSVE-PRSHTDSSQGPESHQAVTE  549

Query  231  DASTVDKPNSTASATAQD  178
                 D+ +S+ S   +D
Sbjct  550  AEKASDEHSSSTSDETRD  567


 Score = 33.1 bits (74),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -3

Query  788  SHYNDVQFQYGTNGFDPNEF  729
            ++  DVQFQYGTN FD NEF
Sbjct  321  AYQKDVQFQYGTNAFDINEF  340



>ref|XP_009608176.1| PREDICTED: uncharacterized protein LOC104102223 [Nicotiana tomentosiformis]
Length=636

 Score = 87.0 bits (214),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 99/199 (50%), Gaps = 20/199 (10%)
 Frame = -2

Query  723  PAALVSSDG---ESE-EVTQMLAEPVGFENELFVTN-NQEALLQRQVNYVANSLVGTFGT  559
            P A +   G   ESE EVTQ L EP  FE E+ + N ++E  ++R+VN +  ++    G+
Sbjct  368  PGAPIKDSGSCSESEAEVTQRLVEPDFFEPEVLLGNFDREIAVKREVNSIGATVQEACGS  427

Query  558  -PTMGSDHQNWNLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAETVGNISS-------SA  403
             P + +DH   NLD   ++Y GQ+++ +       P   FP  E  G  S+       S 
Sbjct  428  APYVSNDHAMGNLDFFQHSYPGQNVYPAGYGAIQVPN--FPSVEQSGGYSNVVSSDSGSG  485

Query  402  PAITLRTRQPQNQRGDQQSAAQGTAPRRIRFQKKLQVGPVQCLRPQTT----PEDNTVSK  235
              I LR RQ QNQ  D+Q   QGTA RRIR Q KLQVG V+  R  T     PE      
Sbjct  486  TGIKLRPRQMQNQSDDRQFRTQGTANRRIRLQMKLQVGRVES-RSHTDSSQGPESRLAVT  544

Query  234  EDASTVDKPNSTASATAQD  178
            E     D+ +S+ S   +D
Sbjct  545  EAEKDSDEHSSSTSDETRD  563


 Score = 33.1 bits (74),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -3

Query  788  SHYNDVQFQYGTNGFDPNEF  729
            ++  DVQFQYGTN FD NEF
Sbjct  321  AYQKDVQFQYGTNAFDINEF  340



>gb|AAM47025.1| nam-like protein 1 [Petunia x hybrida]
Length=585

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 81/155 (52%), Gaps = 7/155 (5%)
 Frame = -2

Query  723  PAALVSSDGESE-EVTQMLAEPVGFENELFVTN-NQEALLQRQVNYVANSLVGTFGTPTM  550
            P     S  ESE EVTQ L EP  FE E+ + N +Q   ++  VN +  ++    G P  
Sbjct  375  PVKDSGSCSESEAEVTQRLVEPDFFEPEILLGNFDQATDVKGGVNSIQTTVQDAAGAPYF  434

Query  549  GSDHQNWNLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAE-----TVGNISSSAPAITLR  385
             +DH   N+    N Y+GQ+ FS+   G   P  +  Q        V + S S   I LR
Sbjct  435  SNDHVMGNVGFLQNTYIGQNDFSAGYGGIQVPNFLTVQESGGYNNVVSSDSGSGTGIKLR  494

Query  384  TRQPQNQRGDQQSAAQGTAPRRIRFQKKLQVGPVQ  280
            TRQ QNQ  D+QS  QGTA RRIR Q KLQVGPV+
Sbjct  495  TRQMQNQPDDRQSRMQGTANRRIRLQMKLQVGPVK  529



>ref|XP_009596681.1| PREDICTED: NAC domain-containing protein 74-like [Nicotiana tomentosiformis]
Length=638

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 93/185 (50%), Gaps = 17/185 (9%)
 Frame = -2

Query  693  SEEVTQMLAEPVGFENELFVTNNQEALLQRQVNYVANSLVGTFGTPTMGSDHQNWNLDLQ  514
            SE   Q+  EPVG   +LF    +E  L R+VN VA ++   F TP + +DH   NLD  
Sbjct  384  SESKAQVTQEPVG--TDLF--EPKETALMREVNPVATTVEEAFATPYVSNDHSVANLDFL  439

Query  513  NNNYLGQSLFSSVSNGTVAPQMVFPQAETVGNISSS----APAITLRTRQPQNQRGDQQ-  349
            NN Y G +  S+ S G   P ++  +  +     SS       I LRTR  QNQ  D+Q 
Sbjct  440  NNGYPGDAALSAGSGGMQVPNVLNVEDSSSYRTGSSDSGFGTGIKLRTRLKQNQPDDEQF  499

Query  348  -SAAQGTAPRRIRFQKKLQVGPVQCLRPQTT------PED-NTVSKEDASTVDKPNSTAS  193
             S  QGT+ RRIRFQ K + G  +C  P  +      PE+  TVS+ +  +++  ++  +
Sbjct  500  GSGMQGTSHRRIRFQVKRRAGRAECDVPTDSDMGGENPEELLTVSESEKFSIEDSSTAGA  559

Query  192  ATAQD  178
            A   D
Sbjct  560  AICGD  564



>gb|AGY49286.1| putative membrane bound NAC transcription factor 1 [Nicotiana 
benthamiana]
Length=630

 Score = 73.6 bits (179),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 78/161 (48%), Gaps = 26/161 (16%)
 Frame = -2

Query  723  PAALVSSDG---ESE-EVTQMLAEPVGFENELFVTN-NQEALLQRQVNYVANSL-VGTFG  562
            P A +   G   ESE EVTQ L EP  FE E+ + N ++E  ++R+VN +  ++      
Sbjct  373  PGAPIKDSGSCSESEVEVTQRLVEPDFFEPEVLLGNFDRETAVKREVNSIGATVQEARES  432

Query  561  TPTMGSDHQNWNLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAE-------TVGNISSSA  403
             P +  DH         N+YL       V N        FP  E        VG+ S S 
Sbjct  433  APYVSHDHAT-----GQNSYLAGYGAIQVPN--------FPSVEQSGGYNNVVGSDSGSG  479

Query  402  PAITLRTRQPQNQRGDQQSAAQGTAPRRIRFQKKLQVGPVQ  280
              I LR RQ QNQ  D+Q   QGTA RRIR Q KLQVGPV+
Sbjct  480  TGIKLRPRQMQNQSDDRQFRTQGTANRRIRLQVKLQVGPVE  520


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -3

Query  788  SHYNDVQFQYGTNGFDPNEF  729
            ++  DVQFQYGTN FD NEF
Sbjct  321  AYQKDVQFQYGTNAFDINEF  340



>emb|CDP04976.1| unnamed protein product [Coffea canephora]
Length=631

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 99/188 (53%), Gaps = 20/188 (11%)
 Frame = -2

Query  708  SSDGESEEVTQMLAEPVGFENELFVTNNQEALLQRQVNYVANSLVGTFGTPTMGSDHQNW  529
             SD E+E VTQ   E   FE+ELF+ N +     +  N   ++         +  D+Q  
Sbjct  374  CSDSEAE-VTQGQFEAGFFESELFMGNIEGYGTLQMANMEQDA-----HRADVSIDNQEG  427

Query  528  NLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAETV-----GNISSSAPAITLRTRQPQNQ  364
             L+L  NN+LG + +++V NG+V P ++  +   V     G  S+S   I LR+RQ Q+ 
Sbjct  428  KLNLAGNNHLGHNAYAAVFNGSVVPDLLSTEVPGVHNNDTGTDSTSGTGIKLRSRQFQSF  487

Query  363  RGDQQSAAQGTAPRRIRFQKKLQVGPVQC--LRPQTTPED-----NTVSKEDASTVDKPN  205
              +   AA G APRR+R Q KLQ+GPVQC  LR     E+     + V++++ +T  K N
Sbjct  488  SSNPTFAAHGIAPRRLRLQNKLQIGPVQCSLLRESVCTEEIDDGQSAVTEDEKAT--KRN  545

Query  204  STASATAQ  181
            + A+ T +
Sbjct  546  TDAAYTEE  553



>ref|XP_011075874.1| PREDICTED: NAC domain-containing protein 45 [Sesamum indicum]
Length=623

 Score = 76.6 bits (187),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 89/175 (51%), Gaps = 12/175 (7%)
 Frame = -2

Query  705  SDGESE-EVTQ--MLAEPVGFENELFVTN-NQEALLQRQVNYVANSLVGTFGTPTMGSDH  538
            S+ ESE EV+Q  +  EP   + EL   N  QE+  Q +V     ++  +      G+++
Sbjct  366  SNSESEGEVSQRNVNVEPSILQCELIEENIKQESPFQSEVTSDMAAVQQSVNNSHFGNNY  425

Query  537  QNWNLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAETVGNI------SSSAPAITLRTRQ  376
             + +LD  NN++   + F++VS     P +     E  G        ++S P I +RTRQ
Sbjct  426  GHRSLDFANNSFKVPNDFTTVSASNQIPYL--SNIEEAGAYRPALGDATSGPGIKIRTRQ  483

Query  375  PQNQRGDQQSAAQGTAPRRIRFQKKLQVGPVQCLRPQTTPEDNTVSKEDASTVDK  211
              NQ   Q S AQGTAPRRIR QKK Q+GPV+C  P  + +   + + +    DK
Sbjct  484  IPNQSSIQNSVAQGTAPRRIRLQKKFQIGPVECRLPNESTDSKIIHEGEPIQDDK  538


 Score = 25.0 bits (53),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = -3

Query  776  DVQFQYGTNGFDPNEF  729
            ++ FQYGTN  D NEF
Sbjct  312  NIPFQYGTNASDINEF  327



>ref|NP_001274765.1| uncharacterized LOC102593794 [Solanum tuberosum]
 gb|AGY49284.1| putative membrane bound NAC transcription factor 1 [Solanum tuberosum]
Length=639

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 94/191 (49%), Gaps = 13/191 (7%)
 Frame = -2

Query  696  ESE-EVTQMLAEPVGFENELFVTN-NQEALLQRQVNYVANSLVGT---FGTPTMGSDHQN  532
            ESE EVTQ   +P  F+ E+   N ++EA ++R+VN + ++++      G    G+D+  
Sbjct  383  ESEAEVTQGQVDPGFFDPEVLWDNFDREAAVKREVNSLEHTVLKARSPLGPSYDGNDYAV  442

Query  531  WNLDLQNNNYLGQSLFSSVSNGTVAPQMVFPQAETVGN-----ISSSAPAITLRTRQPQN  367
             NL    N Y G   + +   G+  P  +  +   V N      S S   I LRTRQ  N
Sbjct  443  GNLGFFQNTYPGHYGYPASIGGSQVPNFLKVEQSGVRNNVVSTESGSGTGIKLRTRQMHN  502

Query  366  QRGDQQSAAQGTAPRRIRFQKKLQVGPVQC-LRPQTT--PEDNTVSKEDASTVDKPNSTA  196
            Q  D QS  QGTA RRIR   K+QVGPV+C +R  ++   E +    E     D+ +ST 
Sbjct  503  QPDDTQSRPQGTAHRRIRLGVKMQVGPVECRMRSVSSQGAEIHQAVAEGEKACDEHSSTT  562

Query  195  SATAQDPILEG  163
            S       LEG
Sbjct  563  SDNTTHKDLEG  573



>ref|XP_010318064.1| PREDICTED: uncharacterized protein LOC101253566 [Solanum lycopersicum]
Length=644

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 80/158 (51%), Gaps = 18/158 (11%)
 Frame = -2

Query  696  ESE-EVTQMLAEPVGFENELFVTN-NQEALLQRQVNYVANSLVGT---FGTPTMGSDHQN  532
            ESE EVTQ L EP  F+ E+   N ++EA ++R+VN +  + +      G   +G+D+  
Sbjct  383  ESEAEVTQGLVEPDFFDPEVLWDNFDREAAVKREVNSLEATALKARSPLGLSYVGNDYAV  442

Query  531  WNLDLQNNNYLGQSLFSSVSNGTVAPQMV-FPQAETVGNISS----SAPAITLRTRQPQN  367
             NL    N Y G   + +   G+  P  +   Q+    N++S    S   I LRTRQ  N
Sbjct  443  GNLGFFQNTYPGHYGYPASIGGSQVPNFLKVEQSGVRNNVASTESGSGTGIKLRTRQMHN  502

Query  366  QRGDQQ--------SAAQGTAPRRIRFQKKLQVGPVQC  277
            Q  D Q        S  QGTA RRIR   K+QVGPV+C
Sbjct  503  QLDDTQFNQPDNTQSRQQGTAHRRIRLHMKMQVGPVEC  540



>ref|XP_004241429.1| PREDICTED: uncharacterized protein LOC101257973 [Solanum lycopersicum]
Length=595

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 64/140 (46%), Gaps = 42/140 (30%)
 Frame = -2

Query  681  TQMLAEPVG---FENELFVTNNQEALLQRQVNYVANSLVGTFGTPTMGSDHQNWNLDLQN  511
            +Q+  EPV    FE EL + N  E  L R+VN VA S+   F TP   +DH         
Sbjct  377  SQVTQEPVRRDIFEPELLLGNCGETALMREVNSVATSVDEVFATPYFRNDH---------  427

Query  510  NNYLGQSLFSSVSNGTVAPQMVFPQAETVGNI-SSSAPAITLRTRQPQNQRGDQQ--SAA  340
                                       ++GN+ + SA  ITLRTR+ QNQ  + Q  S  
Sbjct  428  ---------------------------SMGNVGTDSAFGITLRTRRTQNQPDNSQPGSGM  460

Query  339  QGTAPRRIRFQKKLQVGPVQ  280
            QGT  RRIR+Q KLQ G V+
Sbjct  461  QGTTVRRIRYQVKLQTGRVE  480



>gb|EYU45332.1| hypothetical protein MIMGU_mgv1a003123mg [Erythranthe guttata]
Length=606

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = -2

Query  429  TVGNISSSAPAITLRTRQPQNQRGDQQSAAQGTAPRRIRFQKKLQVGPVQCLRPQTTPED  250
            TVG+ ++S   I  RTRQ  NQ   Q  A  GTAPRRIR QKK QVGPVQC  P  + E 
Sbjct  463  TVGD-ATSGTGIIRRTRQIPNQIDAQNPANHGTAPRRIRLQKKFQVGPVQCRLPSESTEV  521

Query  249  NTVSKEDASTVDKPNSTASATAQD  178
              V  +   T     +T + T  +
Sbjct  522  EFVHHQGKETTQDEKATNTNTVDE  545



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385