BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018B13

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00228.1|  unnamed protein product                                302   1e-95   Coffea canephora [robusta coffee]
ref|XP_011086470.1|  PREDICTED: uncharacterized protein LOC105168199    297   2e-93   Sesamum indicum [beniseed]
gb|KJB61190.1|  hypothetical protein B456_009G345200                    293   2e-93   Gossypium raimondii
ref|XP_006660599.1|  PREDICTED: uncharacterized protein LOC102705746    291   1e-92   
ref|XP_008353107.1|  PREDICTED: uncharacterized protein LOC103416654    291   2e-92   
ref|XP_004238724.1|  PREDICTED: uncharacterized protein LOC101243707    294   2e-92   Solanum lycopersicum
gb|EYU28651.1|  hypothetical protein MIMGU_mgv1a004456mg                294   2e-92   Erythranthe guttata [common monkey flower]
ref|XP_004504499.1|  PREDICTED: uncharacterized protein LOC101510072    294   3e-92   Cicer arietinum [garbanzo]
gb|KHN01126.1|  hypothetical protein glysoja_008028                     293   3e-92   Glycine soja [wild soybean]
ref|XP_006357209.1|  PREDICTED: uncharacterized protein LOC102581459    293   4e-92   Solanum tuberosum [potatoes]
ref|XP_003517865.1|  PREDICTED: uncharacterized protein LOC100805887    293   4e-92   Glycine max [soybeans]
gb|KJB61188.1|  hypothetical protein B456_009G345200                    293   5e-92   Gossypium raimondii
ref|XP_010533011.1|  PREDICTED: uncharacterized protein LOC104808873    293   5e-92   Tarenaya hassleriana [spider flower]
gb|KHG00924.1|  Protein FAM69A                                          293   9e-92   Gossypium arboreum [tree cotton]
ref|XP_009605574.1|  PREDICTED: uncharacterized protein LOC104100114    292   1e-91   Nicotiana tomentosiformis
ref|XP_003552001.1|  PREDICTED: uncharacterized protein LOC100815535    292   1e-91   Glycine max [soybeans]
gb|EAZ08986.1|  hypothetical protein OsI_31250                          292   2e-91   Oryza sativa Indica Group [Indian rice]
ref|NP_001063085.1|  Os09g0392000                                       292   2e-91   
ref|XP_006378189.1|  hypothetical protein POPTR_0010s04630g             291   2e-91   
ref|XP_004297675.1|  PREDICTED: uncharacterized protein LOC101296656    291   3e-91   Fragaria vesca subsp. vesca
ref|XP_003519794.1|  PREDICTED: uncharacterized protein LOC100779863    291   4e-91   Glycine max [soybeans]
ref|XP_008244965.1|  PREDICTED: uncharacterized protein LOC103343066    291   5e-91   Prunus mume [ume]
ref|XP_007222590.1|  hypothetical protein PRUPE_ppa004148mg             291   5e-91   Prunus persica
ref|XP_006378188.1|  hypothetical protein POPTR_0010s04630g             291   8e-91   
ref|XP_007153681.1|  hypothetical protein PHAVU_003G055900g             290   1e-90   Phaseolus vulgaris [French bean]
ref|XP_008389573.1|  PREDICTED: uncharacterized protein LOC103451910    290   1e-90   
ref|XP_003613417.1|  hypothetical protein MTR_5g036420                  289   2e-90   Medicago truncatula
ref|XP_011015682.1|  PREDICTED: uncharacterized protein LOC105119255    289   3e-90   Populus euphratica
ref|XP_008339979.1|  PREDICTED: uncharacterized protein LOC103402967    288   3e-90   
ref|XP_011012739.1|  PREDICTED: uncharacterized protein LOC105116927    289   3e-90   Populus euphratica
ref|XP_008446261.1|  PREDICTED: uncharacterized protein LOC103489044    288   4e-90   Cucumis melo [Oriental melon]
ref|XP_010913432.1|  PREDICTED: uncharacterized protein LOC105039...    288   5e-90   Elaeis guineensis
ref|XP_009757019.1|  PREDICTED: uncharacterized protein LOC104250177    288   6e-90   Nicotiana sylvestris
dbj|BAD94699.1|  hypothetical protein                                   279   8e-90   Arabidopsis thaliana [mouse-ear cress]
gb|KDP21286.1|  hypothetical protein JCGZ_21757                         287   9e-90   Jatropha curcas
ref|XP_006438501.1|  hypothetical protein CICLE_v10031248mg             287   9e-90   Citrus clementina [clementine]
ref|XP_004135222.1|  PREDICTED: uncharacterized protein LOC101209749    287   1e-89   Cucumis sativus [cucumbers]
ref|XP_002460179.1|  hypothetical protein SORBIDRAFT_02g024000          287   1e-89   Sorghum bicolor [broomcorn]
ref|XP_007044484.1|  Zinc finger MYND domain-containing protein 1...    286   2e-89   
ref|XP_008798032.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    286   3e-89   
ref|XP_004956736.1|  PREDICTED: uncharacterized protein LOC101782072    286   3e-89   Setaria italica
ref|XP_006300446.1|  hypothetical protein CARUB_v10020126mg             285   5e-89   Capsella rubella
ref|XP_002887283.1|  hypothetical protein ARALYDRAFT_476140             284   1e-88   
ref|XP_010471012.1|  PREDICTED: uncharacterized protein LOC104750861    285   1e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010652908.1|  PREDICTED: uncharacterized protein LOC100251...    281   2e-88   
ref|XP_010415693.1|  PREDICTED: uncharacterized protein LOC104701657    284   2e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010512094.1|  PREDICTED: uncharacterized protein LOC104788107    284   2e-88   Camelina sativa [gold-of-pleasure]
dbj|BAJ33873.1|  unnamed protein product                                283   4e-88   Eutrema halophilum
ref|XP_009360447.1|  PREDICTED: uncharacterized protein LOC103950916    283   6e-88   
emb|CDY03761.1|  BnaA02g14760D                                          283   6e-88   
ref|XP_009127775.1|  PREDICTED: uncharacterized protein LOC103852633    283   6e-88   Brassica rapa
ref|XP_006390921.1|  hypothetical protein EUTSA_v10018393mg             283   7e-88   Eutrema salsugineum [saltwater cress]
emb|CDY42991.1|  BnaC02g19650D                                          282   9e-88   Brassica napus [oilseed rape]
emb|CDY38797.1|  BnaA07g28690D                                          282   1e-87   Brassica napus [oilseed rape]
ref|XP_009105692.1|  PREDICTED: uncharacterized protein LOC103831561    282   1e-87   Brassica rapa
ref|NP_001142383.1|  uncharacterized protein LOC100274556 precursor     281   2e-87   Zea mays [maize]
ref|XP_002270582.1|  PREDICTED: uncharacterized protein LOC100251...    281   2e-87   Vitis vinifera
tpg|DAA61320.1|  TPA: hypothetical protein ZEAMMB73_635026              281   2e-87   
gb|EPS61168.1|  hypothetical protein M569_13630                         272   2e-87   Genlisea aurea
ref|XP_010683317.1|  PREDICTED: uncharacterized protein LOC104898021    281   2e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK41436.1|  hypothetical protein AALP_AA2G130200                    281   3e-87   Arabis alpina [alpine rockcress]
gb|EMS45474.1|  hypothetical protein TRIUR3_21271                       278   3e-87   Triticum urartu
ref|XP_002520208.1|  conserved hypothetical protein                     280   5e-87   Ricinus communis
ref|XP_009419908.1|  PREDICTED: uncharacterized protein LOC103999...    281   5e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG40083.1|  hypothetical protein                                    280   6e-87   Zea mays [maize]
gb|AAB61100.1|  ESTs gb|R30459,gb|N38441 come from this gene            280   7e-87   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564985.1|  uncharacterized protein                               280   9e-87   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11612.1|  BnaC06g31270D                                          279   1e-86   Brassica napus [oilseed rape]
ref|XP_003578075.1|  PREDICTED: uncharacterized protein LOC100824338    279   3e-86   Brachypodium distachyon [annual false brome]
gb|EEC83605.1|  hypothetical protein OsI_29292                          278   4e-86   Oryza sativa Indica Group [Indian rice]
ref|NP_001061835.1|  Os08g0425000                                       278   5e-86   
dbj|BAJ97125.1|  predicted protein                                      275   4e-85   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010272086.1|  PREDICTED: uncharacterized protein LOC104607...    275   5e-85   Nelumbo nucifera [Indian lotus]
ref|XP_006856897.1|  hypothetical protein AMTR_s00055p00212390          275   7e-85   Amborella trichopoda
gb|ACN36261.1|  unknown                                                 270   9e-85   Zea mays [maize]
dbj|BAJ99018.1|  predicted protein                                      275   1e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010043827.1|  PREDICTED: uncharacterized protein LOC104432932    275   1e-84   Eucalyptus grandis [rose gum]
ref|XP_002444358.1|  hypothetical protein SORBIDRAFT_07g020660          275   1e-84   
ref|XP_004973463.1|  PREDICTED: uncharacterized protein LOC101781133    274   3e-84   Setaria italica
dbj|BAJ91369.1|  predicted protein                                      272   9e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659410.1|  PREDICTED: uncharacterized protein LOC102708916    268   1e-83   
ref|NP_001143255.1|  uncharacterized protein LOC100275783 precursor     270   3e-83   Zea mays [maize]
ref|XP_008676929.1|  PREDICTED: uncharacterized protein LOC100275...    270   4e-83   Zea mays [maize]
ref|XP_006858155.1|  hypothetical protein AMTR_s00062p00137330          269   1e-82   Amborella trichopoda
ref|XP_003574496.1|  PREDICTED: uncharacterized protein LOC100845920    268   3e-82   Brachypodium distachyon [annual false brome]
ref|XP_010445104.1|  PREDICTED: uncharacterized protein LOC104727724    258   4e-82   Camelina sativa [gold-of-pleasure]
gb|ABK24649.1|  unknown                                                 266   1e-81   Picea sitchensis
ref|XP_010267678.1|  PREDICTED: uncharacterized protein LOC104604833    265   5e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010276049.1|  PREDICTED: uncharacterized protein LOC104610902    264   1e-80   Nelumbo nucifera [Indian lotus]
gb|EAZ42788.1|  hypothetical protein OsJ_27372                          262   2e-80   Oryza sativa Japonica Group [Japonica rice]
gb|KCW70170.1|  hypothetical protein EUGRSUZ_F03459                     259   4e-80   Eucalyptus grandis [rose gum]
gb|KDO82633.1|  hypothetical protein CISIN_1g0101752mg                  250   5e-80   Citrus sinensis [apfelsine]
ref|XP_006401517.1|  hypothetical protein EUTSA_v10013232mg             261   1e-79   Eutrema salsugineum [saltwater cress]
ref|XP_010482896.1|  PREDICTED: uncharacterized protein LOC104761505    261   1e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006280251.1|  hypothetical protein CARUB_v10026167mg             261   3e-79   
gb|KCW67126.1|  hypothetical protein EUGRSUZ_F00907                     250   3e-79   Eucalyptus grandis [rose gum]
ref|XP_010448765.1|  PREDICTED: uncharacterized protein LOC104731172    260   4e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009143005.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    259   5e-79   Brassica rapa
gb|AGV54795.1|  hypothetical protein                                    259   6e-79   Phaseolus vulgaris [French bean]
ref|XP_002864361.1|  hypothetical protein ARALYDRAFT_331828             259   7e-79   Arabidopsis lyrata subsp. lyrata
emb|CDX89285.1|  BnaA01g16080D                                          258   8e-79   
ref|XP_009120015.1|  PREDICTED: uncharacterized protein LOC103844940    258   1e-78   Brassica rapa
ref|XP_010438669.1|  PREDICTED: uncharacterized protein LOC104722227    258   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_002867528.1|  hypothetical protein ARALYDRAFT_913846             258   2e-78   Arabidopsis lyrata subsp. lyrata
emb|CDY29265.1|  BnaC01g19170D                                          257   2e-78   Brassica napus [oilseed rape]
gb|KFK29208.1|  hypothetical protein AALP_AA7G103200                    258   2e-78   Arabis alpina [alpine rockcress]
emb|CDY19873.1|  BnaC09g31390D                                          258   2e-78   Brassica napus [oilseed rape]
ref|NP_200298.1|  uncharacterized protein                               258   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371266.1|  PREDICTED: uncharacterized protein LOC103434697    257   4e-78   
ref|XP_010446119.1|  PREDICTED: uncharacterized protein LOC104728896    261   4e-78   
ref|XP_006413116.1|  hypothetical protein EUTSA_v10024847mg             258   4e-78   Eutrema salsugineum [saltwater cress]
ref|XP_008349941.1|  PREDICTED: uncharacterized protein LOC103413239    257   5e-78   
ref|XP_010913435.1|  PREDICTED: uncharacterized protein LOC105039...    255   5e-78   
ref|XP_010433417.1|  PREDICTED: uncharacterized protein LOC104717532    256   7e-78   Camelina sativa [gold-of-pleasure]
emb|CDY17285.1|  BnaA10g09190D                                          257   7e-78   Brassica napus [oilseed rape]
ref|XP_009127046.1|  PREDICTED: uncharacterized protein LOC103851917    256   8e-78   Brassica rapa
ref|XP_010448183.1|  PREDICTED: uncharacterized protein LOC104730687    257   1e-77   
ref|XP_008385988.1|  PREDICTED: uncharacterized protein LOC103448506    256   1e-77   
ref|XP_007211818.1|  hypothetical protein PRUPE_ppa004230mg             255   2e-77   Prunus persica
ref|XP_006283454.1|  hypothetical protein CARUB_v10004499mg             256   2e-77   
emb|CDY06624.1|  BnaC02g13480D                                          257   2e-77   
emb|CDY20800.1|  BnaA02g09400D                                          257   3e-77   Brassica napus [oilseed rape]
gb|ABR17461.1|  unknown                                                 254   4e-77   Picea sitchensis
gb|ACF87807.1|  unknown                                                 249   4e-77   Zea mays [maize]
ref|XP_009378549.1|  PREDICTED: uncharacterized protein LOC103967027    254   5e-77   Pyrus x bretschneideri [bai li]
ref|XP_008226932.1|  PREDICTED: uncharacterized protein LOC103326477    254   6e-77   Prunus mume [ume]
ref|XP_010064377.1|  PREDICTED: uncharacterized protein LOC104451417    249   7e-77   
ref|XP_006452283.1|  hypothetical protein CICLE_v10008210mg             252   9e-77   Citrus clementina [clementine]
ref|XP_004970230.1|  PREDICTED: uncharacterized protein LOC101777...    253   2e-76   Setaria italica
ref|XP_004491367.1|  PREDICTED: uncharacterized protein LOC101492149    253   2e-76   Cicer arietinum [garbanzo]
gb|KJB62763.1|  hypothetical protein B456_009G435000                    253   2e-76   Gossypium raimondii
gb|KDP39105.1|  hypothetical protein JCGZ_00862                         253   2e-76   Jatropha curcas
gb|KHN38290.1|  hypothetical protein glysoja_003955                     250   2e-76   Glycine soja [wild soybean]
ref|XP_009420606.1|  PREDICTED: uncharacterized protein LOC104000320    253   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004970229.1|  PREDICTED: uncharacterized protein LOC101777...    253   3e-76   Setaria italica
gb|KCW67171.1|  hypothetical protein EUGRSUZ_F00962                     249   3e-76   Eucalyptus grandis [rose gum]
ref|XP_004252023.1|  PREDICTED: uncharacterized protein LOC101252754    252   3e-76   Solanum lycopersicum
ref|XP_006475148.1|  PREDICTED: uncharacterized protein LOC102609098    252   3e-76   Citrus sinensis [apfelsine]
ref|XP_006367536.1|  PREDICTED: uncharacterized protein LOC102597542    252   3e-76   Solanum tuberosum [potatoes]
gb|KHG29749.1|  Transcription activator gutR                            252   4e-76   Gossypium arboreum [tree cotton]
ref|XP_009334822.1|  PREDICTED: uncharacterized protein LOC103927611    252   4e-76   Pyrus x bretschneideri [bai li]
dbj|BAB89049.1|  unknown protein                                        252   4e-76   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044498.2|  Os01g0793500                                       252   5e-76   
ref|XP_003617489.1|  hypothetical protein MTR_5g092140                  251   6e-76   Medicago truncatula
ref|XP_010545218.1|  PREDICTED: uncharacterized protein LOC104817662    251   7e-76   Tarenaya hassleriana [spider flower]
ref|XP_002522970.1|  conserved hypothetical protein                     251   7e-76   Ricinus communis
gb|EYU19247.1|  hypothetical protein MIMGU_mgv1a004499mg                251   1e-75   Erythranthe guttata [common monkey flower]
gb|KJB13649.1|  hypothetical protein B456_002G087800                    251   1e-75   Gossypium raimondii
gb|KHG01773.1|  Tryptophan synthase alpha chain                         251   1e-75   Gossypium arboreum [tree cotton]
ref|XP_007211816.1|  hypothetical protein PRUPE_ppa004222mg             250   2e-75   Prunus persica
ref|XP_003519567.1|  PREDICTED: uncharacterized protein LOC100789...    250   2e-75   Glycine max [soybeans]
ref|NP_194432.1|  uncharacterized protein                               249   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008654687.1|  PREDICTED: uncharacterized protein LOC100275...    250   3e-75   Zea mays [maize]
ref|XP_010060409.1|  PREDICTED: uncharacterized protein LOC104448324    249   3e-75   Eucalyptus grandis [rose gum]
ref|XP_008226933.1|  PREDICTED: uncharacterized protein LOC103326478    249   4e-75   Prunus mume [ume]
ref|XP_007142263.1|  hypothetical protein PHAVU_008G266000g             249   5e-75   Phaseolus vulgaris [French bean]
ref|XP_002280959.1|  PREDICTED: uncharacterized protein LOC100267...    249   6e-75   Vitis vinifera
gb|KCW67034.1|  hypothetical protein EUGRSUZ_F00801                     245   6e-75   Eucalyptus grandis [rose gum]
gb|ACN29289.1|  unknown                                                 249   7e-75   Zea mays [maize]
ref|NP_001143111.1|  uncharacterized protein LOC100275589               249   7e-75   Zea mays [maize]
ref|XP_007020905.1|  Inositol-1,4,5-trisphosphate 5-phosphatase 4...    249   8e-75   
ref|XP_002316997.1|  hypothetical protein POPTR_0011s14080g             248   1e-74   
ref|XP_011097895.1|  PREDICTED: uncharacterized protein LOC105176701    248   2e-74   
ref|XP_011040240.1|  PREDICTED: uncharacterized protein LOC105136541    246   4e-74   Populus euphratica
ref|XP_006346228.1|  PREDICTED: uncharacterized protein LOC102585922    246   5e-74   Solanum tuberosum [potatoes]
ref|XP_008454551.1|  PREDICTED: uncharacterized protein LOC103494941    247   5e-74   Cucumis melo [Oriental melon]
ref|XP_006370687.1|  hypothetical protein POPTR_0001s44890g             248   5e-74   
ref|XP_009769049.1|  PREDICTED: uncharacterized protein LOC104219979    246   5e-74   Nicotiana sylvestris
gb|KHN11935.1|  hypothetical protein glysoja_019908                     245   6e-74   Glycine soja [wild soybean]
ref|XP_001775460.1|  predicted protein                                  246   6e-74   
ref|XP_004295816.2|  PREDICTED: uncharacterized protein LOC101297130    246   7e-74   Fragaria vesca subsp. vesca
ref|XP_003564372.1|  PREDICTED: uncharacterized protein LOC100827...    246   7e-74   Brachypodium distachyon [annual false brome]
ref|XP_003564373.1|  PREDICTED: uncharacterized protein LOC100827...    246   9e-74   Brachypodium distachyon [annual false brome]
ref|XP_004151958.1|  PREDICTED: uncharacterized protein LOC101214437    246   1e-73   Cucumis sativus [cucumbers]
ref|XP_003544978.1|  PREDICTED: uncharacterized protein LOC100796964    246   1e-73   Glycine max [soybeans]
ref|XP_009774573.1|  PREDICTED: uncharacterized protein LOC104224588    245   1e-73   Nicotiana sylvestris
ref|XP_006644833.1|  PREDICTED: uncharacterized protein LOC102706146    245   2e-73   Oryza brachyantha
ref|XP_011030808.1|  PREDICTED: uncharacterized protein LOC105130143    245   2e-73   Populus euphratica
ref|XP_011095372.1|  PREDICTED: uncharacterized protein LOC105174849    245   3e-73   Sesamum indicum [beniseed]
dbj|BAJ95380.1|  predicted protein                                      245   3e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM84540.1|  unnamed protein product                                244   3e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009599364.1|  PREDICTED: uncharacterized protein LOC104095030    244   3e-73   Nicotiana tomentosiformis
ref|XP_009607397.1|  PREDICTED: uncharacterized protein LOC104101619    244   4e-73   Nicotiana tomentosiformis
ref|XP_010675677.1|  PREDICTED: uncharacterized protein LOC104891653    242   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002965264.1|  hypothetical protein SELMODRAFT_143057             242   2e-72   
ref|XP_004244131.1|  PREDICTED: uncharacterized protein LOC101251602    242   2e-72   Solanum lycopersicum
ref|XP_002986592.1|  hypothetical protein SELMODRAFT_124354             242   2e-72   
gb|EMT03744.1|  hypothetical protein F775_19554                         244   3e-72   
ref|XP_004244132.1|  PREDICTED: uncharacterized protein LOC101251905    242   3e-72   Solanum lycopersicum
ref|XP_006346229.1|  PREDICTED: uncharacterized protein LOC102586255    241   6e-72   Solanum tuberosum [potatoes]
ref|XP_010930250.1|  PREDICTED: uncharacterized protein LOC105051...    241   1e-71   Elaeis guineensis
ref|XP_008812430.1|  PREDICTED: uncharacterized protein LOC103723322    239   3e-71   Phoenix dactylifera
emb|CDP05764.1|  unnamed protein product                                239   4e-71   Coffea canephora [robusta coffee]
gb|EMS65818.1|  hypothetical protein TRIUR3_10678                       232   3e-70   Triticum urartu
ref|XP_010092131.1|  hypothetical protein L484_017819                   239   3e-70   
ref|XP_009614697.1|  PREDICTED: uncharacterized protein LOC104107...    236   8e-70   Nicotiana tomentosiformis
ref|XP_002278686.1|  PREDICTED: uncharacterized protein LOC100241...    235   1e-69   Vitis vinifera
ref|XP_009801187.1|  PREDICTED: uncharacterized protein LOC104246...    235   1e-69   Nicotiana sylvestris
ref|XP_010644425.1|  PREDICTED: uncharacterized protein LOC100241...    235   2e-69   
emb|CBI26611.3|  unnamed protein product                                235   5e-69   Vitis vinifera
ref|XP_001781611.1|  predicted protein                                  232   1e-68   
gb|EMT12587.1|  hypothetical protein F775_11937                         228   8e-68   
ref|XP_009614695.1|  PREDICTED: uncharacterized protein LOC104107...    229   2e-67   Nicotiana tomentosiformis
gb|EMS49816.1|  hypothetical protein TRIUR3_06457                       229   7e-67   Triticum urartu
ref|XP_008454552.1|  PREDICTED: uncharacterized protein LOC103494942    227   1e-66   
ref|XP_004158483.1|  PREDICTED: uncharacterized LOC101212346            224   2e-66   
ref|XP_004152029.1|  PREDICTED: uncharacterized protein LOC101212346    225   8e-66   
ref|XP_010644428.1|  PREDICTED: uncharacterized protein LOC100241...    223   7e-65   
emb|CAN60720.1|  hypothetical protein VITISV_022056                     219   4e-63   Vitis vinifera
gb|KCW67120.1|  hypothetical protein EUGRSUZ_F00901                     213   9e-63   Eucalyptus grandis [rose gum]
ref|XP_006438500.1|  hypothetical protein CICLE_v10031248mg             212   2e-61   
ref|XP_010272087.1|  PREDICTED: uncharacterized protein LOC104607...    205   6e-61   
ref|XP_009419909.1|  PREDICTED: uncharacterized protein LOC103999...    206   3e-59   
ref|XP_002878755.1|  predicted protein                                  184   6e-55   
gb|EYU33635.1|  hypothetical protein MIMGU_mgv1a018256mg                194   3e-54   Erythranthe guttata [common monkey flower]
gb|KJB62764.1|  hypothetical protein B456_009G435000                    193   3e-54   Gossypium raimondii
gb|KCW67102.1|  hypothetical protein EUGRSUZ_F00885                     194   3e-54   Eucalyptus grandis [rose gum]
gb|KCW67113.1|  hypothetical protein EUGRSUZ_F00893                     193   4e-54   Eucalyptus grandis [rose gum]
ref|XP_006575675.1|  PREDICTED: uncharacterized protein LOC100789...    190   4e-53   Glycine max [soybeans]
ref|XP_010644433.1|  PREDICTED: uncharacterized protein LOC100267...    190   5e-53   Vitis vinifera
gb|KDO82634.1|  hypothetical protein CISIN_1g0101752mg                  176   1e-51   Citrus sinensis [apfelsine]
gb|ACF81787.1|  unknown                                                 173   2e-50   Zea mays [maize]
ref|XP_002872148.1|  hypothetical protein ARALYDRAFT_351537             173   3e-50   
ref|XP_010930259.1|  PREDICTED: uncharacterized protein LOC105051...    180   4e-49   Elaeis guineensis
ref|XP_010644430.1|  PREDICTED: uncharacterized protein LOC100241...    178   2e-48   
ref|XP_010644429.1|  PREDICTED: uncharacterized protein LOC100241...    177   4e-48   
gb|KCW67105.1|  hypothetical protein EUGRSUZ_F00888                     170   3e-47   Eucalyptus grandis [rose gum]
gb|KCW66790.1|  hypothetical protein EUGRSUZ_F00555                     166   5e-46   Eucalyptus grandis [rose gum]
ref|XP_010445105.1|  PREDICTED: uncharacterized protein LOC104727725    159   1e-44   
ref|XP_002888842.1|  hypothetical protein ARALYDRAFT_895006             155   7e-44   
gb|KCW67110.1|  hypothetical protein EUGRSUZ_F00891                     155   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010064383.1|  PREDICTED: uncharacterized protein LOC104451423    147   2e-39   
ref|XP_001449176.1|  hypothetical protein                               144   3e-39   Paramecium tetraurelia strain d4-2
gb|EEC71626.1|  hypothetical protein OsI_04047                          144   4e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_001455162.1|  hypothetical protein                               144   3e-38   Paramecium tetraurelia strain d4-2
ref|XP_001436259.1|  hypothetical protein                               142   3e-38   Paramecium tetraurelia strain d4-2
gb|KCW67111.1|  hypothetical protein EUGRSUZ_F00891                     140   7e-38   Eucalyptus grandis [rose gum]
ref|XP_010064375.1|  PREDICTED: uncharacterized protein LOC104451414    138   6e-37   
gb|EJY77500.1|  hypothetical protein OXYTRI_00869                       122   2e-31   Oxytricha trifallax
ref|XP_004027177.1|  hypothetical protein IMG5_188030                   127   6e-30   Ichthyophthirius multifiliis
ref|XP_001031695.1|  hypothetical protein TTHERM_00760790               123   2e-29   Tetrahymena thermophila SB210
ref|XP_008245164.1|  PREDICTED: uncharacterized protein LOC103343273    124   2e-29   
emb|CDW81161.1|  UNKNOWN                                                122   4e-28   Stylonychia lemnae
emb|CDW76296.1|  UNKNOWN                                                114   5e-28   Stylonychia lemnae
ref|XP_004346245.1|  hypothetical protein CAOG_05572                    115   5e-28   Capsaspora owczarzaki ATCC 30864
gb|EAR84506.2|  hypothetical protein TTHERM_00655340                    121   1e-27   Tetrahymena thermophila SB210
ref|XP_001032169.1|  hypothetical protein TTHERM_00655340               121   1e-27   
ref|XP_001749148.1|  hypothetical protein                               120   2e-27   Monosiga brevicollis MX1
ref|XP_004997585.1|  hypothetical protein PTSG_01605                    119   4e-27   Salpingoeca rosetta
emb|CDW73981.1|  UNKNOWN                                                119   7e-27   Stylonychia lemnae
gb|AFA26195.1|  hypothetical protein                                    114   3e-26   Lolium perenne [perennial ryegrass]
gb|EJY88389.1|  hypothetical protein OXYTRI_16548                       107   4e-26   Oxytricha trifallax
gb|EJY86845.1|  hypothetical protein OXYTRI_09854                       116   5e-26   Oxytricha trifallax
gb|AGW24477.1|  chloroplast 20 kDa chaperonin                           102   1e-23   Avicennia marina subsp. marina
emb|CDW80089.1|  UNKNOWN                                                110   1e-23   Stylonychia lemnae
ref|XP_010100527.1|  hypothetical protein L484_027842                   104   2e-22   
gb|KDO49372.1|  hypothetical protein CISIN_1g038412mg                 96.3    3e-21   Citrus sinensis [apfelsine]
gb|KJB13651.1|  hypothetical protein B456_002G087800                    101   6e-21   Gossypium raimondii
emb|CDW85293.1|  UNKNOWN                                              92.4    1e-19   Stylonychia lemnae
gb|KCW66786.1|  hypothetical protein EUGRSUZ_F005522                  95.1    2e-19   Eucalyptus grandis [rose gum]
gb|EAY76121.1|  hypothetical protein OsI_04050                        94.4    9e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002677023.1|  predicted protein                                89.7    5e-18   Naegleria gruberi strain NEG-M
emb|CDY23519.1|  BnaC06g24880D                                        83.2    8e-17   Brassica napus [oilseed rape]
ref|XP_010064275.1|  PREDICTED: uncharacterized protein LOC104451268  88.6    1e-16   
emb|CBI33030.3|  unnamed protein product                              82.4    1e-16   Vitis vinifera
ref|XP_009801253.1|  PREDICTED: uncharacterized protein LOC104246...  82.8    1e-14   Nicotiana sylvestris
gb|EWM29091.1|  hypothetical protein Naga_100024g11                   69.7    5e-14   Nannochloropsis gaditana
gb|EJY76018.1|  hypothetical protein OXYTRI_02478                     77.4    1e-12   Oxytricha trifallax
ref|XP_009405675.1|  PREDICTED: uncharacterized protein LOC103988768  75.1    2e-12   
gb|KCW66787.1|  hypothetical protein EUGRSUZ_F005521                  68.6    1e-11   Eucalyptus grandis [rose gum]
ref|XP_002780228.1|  conserved hypothetical protein                   72.0    6e-11   Perkinsus marinus ATCC 50983
gb|KDO82636.1|  hypothetical protein CISIN_1g0101752mg                64.3    2e-10   Citrus sinensis [apfelsine]
gb|KDO82635.1|  hypothetical protein CISIN_1g0101752mg                63.5    6e-10   Citrus sinensis [apfelsine]
ref|XP_002773717.1|  conserved hypothetical protein                   66.2    5e-09   Perkinsus marinus ATCC 50983
ref|XP_004509910.1|  PREDICTED: uncharacterized protein LOC101495828  62.8    7e-08   
ref|XP_002780229.1|  conserved hypothetical protein                   60.8    3e-07   Perkinsus marinus ATCC 50983
gb|EPS57942.1|  hypothetical protein M569_16875                       57.4    3e-07   Genlisea aurea
ref|XP_002458625.1|  hypothetical protein SORBIDRAFT_03g036905        55.1    1e-06   
gb|EJY67182.1|  hypothetical protein OXYTRI_12523                     58.5    2e-06   Oxytricha trifallax
ref|XP_002780230.1|  conserved hypothetical protein                   58.2    3e-06   
gb|KCW67153.1|  hypothetical protein EUGRSUZ_F00947                   46.2    2e-04   



>emb|CDP00228.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLV+SVMSMWTR+QPTYAANMWNEALNKRL TE L+LYEILAE
Sbjct  334  FSWIDTVADNYPPPLDAHLVMSVMSMWTRVQPTYAANMWNEALNKRLETEELNLYEILAE  393

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+GVFG +A+SIQVTEFTIRD
Sbjct  394  TERRGLSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGVFGPIADSIQVTEFTIRD  453

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLP WCNSG+D LPFCQI+GEYRMEL
Sbjct  454  AYMLKIFENNQTRLPKWCNSGDDMLPFCQILGEYRMEL  491


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNENCPSLPP+YERP+ C
Sbjct  492  PQYNTLEPYANMNENCPSLPPTYERPVRC  520



>ref|XP_011086470.1| PREDICTED: uncharacterized protein LOC105168199 [Sesamum indicum]
Length=528

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP YAANMWNEALN RLGTEGLDL++ILAE
Sbjct  342  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPAYAANMWNEALNMRLGTEGLDLHDILAE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG+TFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG L+ SIQVTEFTIRD
Sbjct  402  TETRGVTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLSNSIQVTEFTIRD  461

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKIYENN TRLPSWCN+ +D+LPFCQI+GEY+MEL
Sbjct  462  AYMLKIYENNVTRLPSWCNNSDDQLPFCQILGEYKMEL  499


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P+YNTLEPY NMNENCPSLPP+YERP+ C
Sbjct  500  PYYNTLEPYTNMNENCPSLPPTYERPVRC  528



>gb|KJB61190.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=409

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  223  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYRILEE  282

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG L+ SIQVTEFTIRD
Sbjct  283  TERRGITFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPLSNSIQVTEFTIRD  342

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQT LPSWCN+G+ +LPFCQI+GEY MEL
Sbjct  343  AYMLKIFENNQTNLPSWCNNGDGRLPFCQILGEYWMEL  380


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P+YN+LEPYANMNENCPSLPP Y+RP  C
Sbjct  381  PFYNSLEPYANMNENCPSLPPIYDRPTRC  409



>ref|XP_006660599.1| PREDICTED: uncharacterized protein LOC102705746 [Oryza brachyantha]
Length=420

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ E
Sbjct  234  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVE  293

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   AESIQVTEFTIRD
Sbjct  294  TERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFAPFAESIQVTEFTIRD  353

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQ RLPSWCN+  DKLPFCQI+GEYRMEL
Sbjct  354  AYMLKIFEDNQARLPSWCNTEADKLPFCQILGEYRMEL  391


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  392  PEYNTIEPYAKMNENCPSLPPTYKRPARC  420



>ref|XP_008353107.1| PREDICTED: uncharacterized protein LOC103416654 [Malus domestica]
Length=416

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DN+PPP+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEILAE
Sbjct  230  FSWIDTMADNFPPPLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILAE  289

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E R + FD LLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  290  VESREMAFDHLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  349

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN  ++KLPFCQI+GEYRMEL
Sbjct  350  AYMLKIFEDNQTRLPSWCNGKDEKLPFCQILGEYRMEL  387


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  388  PLYNTLEPYANMNEHCPSLPPTYDRPTRC  416



>ref|XP_004238724.1| PREDICTED: uncharacterized protein LOC101243707 [Solanum lycopersicum]
Length=524

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAE
Sbjct  338  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEWVYSDG+STTCVAFILAMYKE+GVFG ++ SIQVTEFTIRD
Sbjct  398  TERRGITFDQLLTIPEQDEWVYSDGQSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIRD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN G++K+ FCQI+GEY+MEL
Sbjct  458  AYMLKIFEDNQTRLPSWCNGGDNKVSFCQILGEYQMEL  495


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL+PYANMNENCPSLPP YERP  C
Sbjct  496  PEYNTLDPYANMNENCPSLPPHYERPRRC  524



>gb|EYU28651.1| hypothetical protein MIMGU_mgv1a004456mg [Erythranthe guttata]
Length=526

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP YAANMWNEALN RLGTE LDLY ILAE
Sbjct  340  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPAYAANMWNEALNMRLGTEDLDLYGILAE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG +  SIQVTEFTI+D
Sbjct  400  TERRGITFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPVTNSIQVTEFTIKD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENN T+LP+WCN+G+DKLPFCQI+GEY+MEL
Sbjct  460  AYMLKIFENNMTQLPNWCNNGDDKLPFCQILGEYKMEL  497


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P+YNTLEPY NMNENCPSLPP+YERP  C
Sbjct  498  PYYNTLEPYTNMNENCPSLPPTYERPARC  526



>ref|XP_004504499.1| PREDICTED: uncharacterized protein LOC101510072 [Cicer arietinum]
Length=520

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP+YAANMWNEALNKRLGTE LDL++IL E
Sbjct  334  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPSYAANMWNEALNKRLGTEDLDLHDILLE  393

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FD+LL IPEQDEWVYSDGKSTTCVAFIL+MYKE+G+FG +  SIQVTEFTIRD
Sbjct  394  TEKRGIAFDELLAIPEQDEWVYSDGKSTTCVAFILSMYKEAGIFGPVTSSIQVTEFTIRD  453

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLP WCN+ NDKLPFCQI+GEYRMEL G
Sbjct  454  AYMLRIFEDNQTRLPRWCNNANDKLPFCQILGEYRMELPG  493


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL+PYANMNE+CPSLPP+Y+RP  C
Sbjct  492  PGYNTLDPYANMNEHCPSLPPTYDRPSKC  520



>gb|KHN01126.1| hypothetical protein glysoja_008028 [Glycine soja]
Length=518

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++IL E
Sbjct  332  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDILIE  391

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FDQLLTIPEQDEWVYSDGKSTTCVAFIL+MYK +G+FG ++ SIQVTEFTIRD
Sbjct  392  TEKRGIAFDQLLTIPEQDEWVYSDGKSTTCVAFILSMYKAAGIFGPISSSIQVTEFTIRD  451

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLP WCN+ ND+LPFCQI+GEYRMEL G
Sbjct  452  AYMLRIFEDNQTRLPRWCNNENDRLPFCQILGEYRMELPG  491


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL+PYANMNE+CPSLPP+Y+RP+ C
Sbjct  490  PGYNTLDPYANMNEHCPSLPPTYDRPLKC  518



>ref|XP_006357209.1| PREDICTED: uncharacterized protein LOC102581459 [Solanum tuberosum]
Length=524

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGT+ LDLY ILAE
Sbjct  338  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTKDLDLYGILAE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEW+YSDG+STTCVAFILAMYKE+GVFG ++ SIQVTEFTIRD
Sbjct  398  TERRGITFDQLLTIPEQDEWIYSDGQSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIRD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCNSG++K  FCQI+GEY+MEL
Sbjct  458  AYMLKIFEDNQTRLPSWCNSGDNKFSFCQILGEYQMEL  495


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL+PYANMNENCPSLPP YERP  C
Sbjct  496  PQYNTLDPYANMNENCPSLPPHYERPGRC  524



>ref|XP_003517865.1| PREDICTED: uncharacterized protein LOC100805887 [Glycine max]
Length=518

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++IL E
Sbjct  332  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDILIE  391

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FDQLLTIPEQDEWVYSDGKSTTCVAFIL+MYK +G+FG ++ SIQVTEFTIRD
Sbjct  392  TEKRGIAFDQLLTIPEQDEWVYSDGKSTTCVAFILSMYKAAGIFGPISSSIQVTEFTIRD  451

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLP WCN+ ND+LPFCQI+GEYRMEL G
Sbjct  452  AYMLRIFEDNQTRLPRWCNNENDRLPFCQILGEYRMELPG  491


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL+PYANMNE+CPSLPP+Y+RP+ C
Sbjct  490  PGYNTLDPYANMNEHCPSLPPTYDRPLKC  518



>gb|KJB61188.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=527

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  341  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYRILEE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG L+ SIQVTEFTIRD
Sbjct  401  TERRGITFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPLSNSIQVTEFTIRD  460

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQT LPSWCN+G+ +LPFCQI+GEY MEL
Sbjct  461  AYMLKIFENNQTNLPSWCNNGDGRLPFCQILGEYWMEL  498


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P+YN+LEPYANMNENCPSLPP Y+RP  C
Sbjct  499  PFYNSLEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_010533011.1| PREDICTED: uncharacterized protein LOC104808873 [Tarenaya hassleriana]
Length=530

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHL+ISVMSMWTR+QPTYAANMWNEALNKRLGTEGLDLYEILAE
Sbjct  344  FSWIDTLADNYPPPLDAHLLISVMSMWTRVQPTYAANMWNEALNKRLGTEGLDLYEILAE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFD+LLTIPE+DEWVYSDGKSTTCVAFIL MYK +GVFG LA+ IQVTEFTIRD
Sbjct  404  TERRGMTFDELLTIPERDEWVYSDGKSTTCVAFILQMYKAAGVFGPLADHIQVTEFTIRD  463

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+IYE+NQTRLPSWCN    KLPFCQI+G YRMEL G
Sbjct  464  AYALRIYEDNQTRLPSWCNDEEGKLPFCQILGGYRMELPG  503



>gb|KHG00924.1| Protein FAM69A [Gossypium arboreum]
Length=527

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  341  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG L+ SIQVTEFTIRD
Sbjct  401  TERRGITFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPLSNSIQVTEFTIRD  460

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQT LPSWCN+G+ +LPFCQI+GEY MEL
Sbjct  461  AYMLKIFENNQTNLPSWCNNGDGRLPFCQILGEYWMEL  498


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P+YN+LEPYANMNENCPSLPP Y+RP  C
Sbjct  499  PFYNSLEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_009605574.1| PREDICTED: uncharacterized protein LOC104100114 [Nicotiana tomentosiformis]
Length=523

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAE
Sbjct  337  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+TFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTI+D
Sbjct  397  TEKRGITFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AY LKI+E+NQTRLPSWCNSG++K+ FCQI+GEY+MEL
Sbjct  457  AYTLKIFEDNQTRLPSWCNSGDNKVSFCQILGEYQMEL  494


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNENCPSLPP+YERP+ C
Sbjct  495  PQYNTLEPYANMNENCPSLPPNYERPMRC  523



>ref|XP_003552001.1| PREDICTED: uncharacterized protein LOC100815535 [Glycine max]
 gb|KHN28269.1| hypothetical protein glysoja_040924 [Glycine soja]
Length=531

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++IL E
Sbjct  345  FSWIDTVADNYPPPLDAHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDILVE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FD+LLTIPEQDEWVYSDGKSTTCVAFIL+MYKE+ VFG +A SIQVTEFTIRD
Sbjct  405  TEKRGIPFDELLTIPEQDEWVYSDGKSTTCVAFILSMYKEAEVFGPIANSIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLPSWCN+ ND++PFCQI+GEY+MEL G
Sbjct  465  AYMLRIFEDNQTRLPSWCNNENDRIPFCQILGEYKMELPG  504


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNE CPSLPP+Y+RP  C
Sbjct  503  PGYNTLEPYANMNEYCPSLPPTYDRPSRC  531



>gb|EAZ08986.1| hypothetical protein OsI_31250 [Oryza sativa Indica Group]
Length=546

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ E
Sbjct  360  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVE  419

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   AESIQVTEFTIRD
Sbjct  420  TERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFAESIQVTEFTIRD  479

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQ RLPSWCN+ +DKLPFCQI+GEYRMEL
Sbjct  480  AYMLKIFEDNQARLPSWCNTESDKLPFCQILGEYRMEL  517


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  518  PEYNTIEPYAKMNENCPSLPPTYKRPARC  546



>ref|NP_001063085.1| Os09g0392000 [Oryza sativa Japonica Group]
 dbj|BAD26533.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24999.1| Os09g0392000 [Oryza sativa Japonica Group]
 gb|EAZ44615.1| hypothetical protein OsJ_29237 [Oryza sativa Japonica Group]
 dbj|BAG99992.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ E
Sbjct  360  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVE  419

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   AESIQVTEFTIRD
Sbjct  420  TERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFAESIQVTEFTIRD  479

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQ RLPSWCN+ +DKLPFCQI+GEYRMEL
Sbjct  480  AYMLKIFEDNQARLPSWCNTESDKLPFCQILGEYRMEL  517


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  518  PEYNTIEPYAKMNENCPSLPPTYKRPARC  546



>ref|XP_006378189.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55986.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=514

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  316  FSWIDTIADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGE  375

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+ FD+LLT+PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRD
Sbjct  376  TERRGIAFDELLTVPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRD  435

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLPSWCN+GN +LPFCQI+GEY+MEL
Sbjct  436  AYMLKIFENNQTRLPSWCNNGNVQLPFCQILGEYQMEL  473



>ref|XP_004297675.1| PREDICTED: uncharacterized protein LOC101296656 [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+D HLV+SVMSMWTR+QP YAANMWNEALNKRL TEGLDLYEILAE
Sbjct  330  FSWIDTMAENYPPPLDTHLVVSVMSMWTRVQPAYAANMWNEALNKRLSTEGLDLYEILAE  389

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E RG++ D LLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  390  VENRGISVDHLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  449

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLPSWCN G++KLPFCQI+GEYRMEL
Sbjct  450  AYMLKIFENNQTRLPSWCNLGDEKLPFCQILGEYRMEL  487



>ref|XP_003519794.1| PREDICTED: uncharacterized protein LOC100779863 [Glycine max]
 gb|KHN28683.1| hypothetical protein glysoja_025417 [Glycine soja]
Length=520

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++IL E
Sbjct  334  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDILIE  393

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FDQLLTIPEQDEWVYSDGKSTTCVAFIL+MYK +G+FG ++ SIQVTEFTIRD
Sbjct  394  TEKRGIAFDQLLTIPEQDEWVYSDGKSTTCVAFILSMYKAAGIFGPISSSIQVTEFTIRD  453

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLP WCN+ ND+ PFCQI+GEYRMEL G
Sbjct  454  AYMLRIFEDNQTRLPRWCNNENDRHPFCQILGEYRMELPG  493


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL+PYANMNE+CPSLPP+Y+RP+ C
Sbjct  492  PGYNTLDPYANMNEHCPSLPPTYDRPLKC  520



>ref|XP_008244965.1| PREDICTED: uncharacterized protein LOC103343066 [Prunus mume]
Length=526

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEIL E
Sbjct  340  FSWIDTMADNYPPPLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILTE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E R + FD LLTIPE+DEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  400  VENREIAFDHLLTIPEKDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN  N+KLPFCQI+GEYRMEL
Sbjct  460  AYMLKIFEDNQTRLPSWCNGKNEKLPFCQILGEYRMEL  497


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPY NMNE+CPSLPP+Y+RP+ C
Sbjct  498  PEYNTIEPYTNMNEHCPSLPPTYDRPLRC  526



>ref|XP_007222590.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
 gb|EMJ23789.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
Length=526

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEIL E
Sbjct  340  FSWIDTMADNYPPPLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILTE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E R + FD LLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  400  VENREIAFDHLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN  ++KLPFCQI+GEYRMEL
Sbjct  460  AYMLKIFEDNQTRLPSWCNGKDEKLPFCQILGEYRMEL  497


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPY NMNE+CPSLPP+Y+RP+ C
Sbjct  498  PEYNTIEPYTNMNEHCPSLPPTYDRPLRC  526



>ref|XP_006378188.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55985.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=552

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  354  FSWIDTIADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGE  413

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+ FD+LLT+PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRD
Sbjct  414  TERRGIAFDELLTVPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRD  473

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLPSWCN+GN +LPFCQI+GEY+MEL
Sbjct  474  AYMLKIFENNQTRLPSWCNNGNVQLPFCQILGEYQMEL  511



>ref|XP_007153681.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
 gb|ESW25675.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
Length=522

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++I+ E
Sbjct  336  FSWIDTVADNYPPPLDAHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDIIVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FD+LLTIPEQDEWVYSDGKSTTCVAFIL+MYKE+GVFG ++ SIQVTEFTIRD
Sbjct  396  TEKRGIPFDELLTIPEQDEWVYSDGKSTTCVAFILSMYKEAGVFGPVSSSIQVTEFTIRD  455

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLP WCN+ ND+L FCQI+GEYRMEL G
Sbjct  456  AYMLRIFEDNQTRLPRWCNNENDQLSFCQILGEYRMELPG  495



>ref|XP_008389573.1| PREDICTED: uncharacterized protein LOC103451910 [Malus domestica]
Length=526

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DN+PPP+D HLV+SVMSMWTR+QP YAANMWNEALNKRLGTEGLDLYEILAE
Sbjct  340  FSWIDTMADNFPPPLDTHLVVSVMSMWTRIQPAYAANMWNEALNKRLGTEGLDLYEILAE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E R + FD LLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  400  VESREMAFDHLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN  ++KLPFCQI+GEYRMEL
Sbjct  460  AYMLKIFEDNQTRLPSWCNGKDEKLPFCQILGEYRMEL  497


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  498  PLYNTLEPYANMNEHCPSLPPTYDRPTRC  526



>ref|XP_003613417.1| hypothetical protein MTR_5g036420 [Medicago truncatula]
 gb|AES96375.1| plant/F10M23-360 protein [Medicago truncatula]
Length=522

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++I+ E
Sbjct  336  FSWIDTVADNYPPPLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDIILE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FD+LL IPEQD+WVYSDGKSTTCVAFIL+MYKE+G+FG ++ SIQVTEFTIRD
Sbjct  396  TEKRGIAFDELLAIPEQDDWVYSDGKSTTCVAFILSMYKEAGIFGPISSSIQVTEFTIRD  455

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYML+I+E+NQTRLP WCN+ NDKLPFCQI+GEYRME  G
Sbjct  456  AYMLRIFEDNQTRLPRWCNNENDKLPFCQILGEYRMEFPG  495


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTL PYANMNE+CPSLPP+Y+RP  C
Sbjct  494  PGYNTLVPYANMNEHCPSLPPTYDRPSQC  522



>ref|XP_011015682.1| PREDICTED: uncharacterized protein LOC105119255 [Populus euphratica]
Length=540

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  354  FSWIDTIADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGE  413

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+ FD+LLT+PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRD
Sbjct  414  TERRGIAFDELLTVPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRD  473

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLP WCN+GN +LPFCQI+GEY+MEL
Sbjct  474  AYMLKIFENNQTRLPRWCNNGNVQLPFCQILGEYQMEL  511


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YN++EPYANMNENCPSLPP YERPI C
Sbjct  512  PEYNSVEPYANMNENCPSLPPVYERPIQC  540



>ref|XP_008339979.1| PREDICTED: uncharacterized protein LOC103402967 [Malus domestica]
Length=526

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DN+PPP+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEILAE
Sbjct  340  FSWIDTMADNFPPPLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILAE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E R + FD LLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  400  VESREMAFDHLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N TRLPSWCN  ++KLPFCQI+GEYRMEL
Sbjct  460  AYMLKIFEDNXTRLPSWCNGKDEKLPFCQILGEYRMEL  497


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  498  PLYNTLEPYANMNEHCPSLPPTYDRPTRC  526



>ref|XP_011012739.1| PREDICTED: uncharacterized protein LOC105116927 [Populus euphratica]
Length=540

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  354  FSWIDTIADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGE  413

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+ FD+LLT+PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRD
Sbjct  414  TERRGIAFDELLTVPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRD  473

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLP WCN+GN +LPFCQI+GEY+MEL
Sbjct  474  AYMLKIFENNQTRLPRWCNNGNVQLPFCQILGEYQMEL  511


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YN++EPYANMNENCPSLPP YERPI C
Sbjct  512  PEYNSVEPYANMNENCPSLPPVYERPIQC  540



>ref|XP_008446261.1| PREDICTED: uncharacterized protein LOC103489044 [Cucumis melo]
Length=524

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DN+PPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDL++IL E
Sbjct  338  FSWIDTVTDNFPPPLDAHLVISVMSMWTRLQPAYAANMWNEALNKRLGTEDLDLHDILVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  398  TEKRGIPFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPVSSSIQVTEFTIRD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N TRLP+WCN+ +DKLPFCQI+GEY+MEL
Sbjct  458  AYMLKIFEDNHTRLPTWCNNESDKLPFCQILGEYKMEL  495


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNENCPSLPP+Y+RP  C
Sbjct  496  PQYNTLEPYANMNENCPSLPPTYDRPTQC  524



>ref|XP_010913432.1| PREDICTED: uncharacterized protein LOC105039122 isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI++NYPPP+DA+LV+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ E
Sbjct  348  FSWIDTITNNYPPPLDANLVMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIE  407

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEW YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRD
Sbjct  408  TERRGMTFDQLLTIPEQDEWEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRD  467

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENN TRLPSWCN+  +KLPFCQI+GEYRMEL
Sbjct  468  AYMLKIFENNGTRLPSWCNAEEEKLPFCQILGEYRMEL  505


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+YERP+ C
Sbjct  506  PEYNTIEPYARMNENCPSLPPTYERPVSC  534



>ref|XP_009757019.1| PREDICTED: uncharacterized protein LOC104250177 [Nicotiana sylvestris]
Length=523

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAE
Sbjct  337  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+TFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTI+D
Sbjct  397  TEKRGITFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AY LKI+E+NQTRLPSWCNS  +K+ FCQI+GEY MEL
Sbjct  457  AYTLKIFEDNQTRLPSWCNSRENKVSFCQILGEYEMEL  494


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNENCPSLPP+YERP+ C
Sbjct  495  PQYNTLEPYANMNENCPSLPPNYERPVRC  523



>dbj|BAD94699.1| hypothetical protein [Arabidopsis thaliana]
Length=258

 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  72   FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  131

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +G+F  LA+ IQVTEFTIRD
Sbjct  132  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGIFDPLADHIQVTEFTIRD  191

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK++E+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  192  AYTLKLFESNQTRLPSWCNTEEGKLDFCQILGEYRMELPG  231



>gb|KDP21286.1| hypothetical protein JCGZ_21757 [Jatropha curcas]
Length=529

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAE
Sbjct  343  FSWIDTIADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAE  402

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG+ FD+LLT PEQDEW+YSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTIRD
Sbjct  403  IEKRGIAFDELLTAPEQDEWIYSDGKSTTCVAFILAMYKEAGVFGPISSSIQVTEFTIRD  462

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLP WCN+ N +LPFCQI+GEY MEL
Sbjct  463  AYMLKIFENNQTRLPGWCNNDNGRLPFCQILGEYWMEL  500


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPPSY+RP  C
Sbjct  501  PEYNTVEPYANMNENCPSLPPSYDRPGRC  529



>ref|XP_006438501.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 ref|XP_006483762.1| PREDICTED: uncharacterized protein LOC102615522 [Citrus sinensis]
 gb|ESR51741.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=518

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLV+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E
Sbjct  332  FSWIDTMADNYPPPLDAHLVVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDE  391

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG++FDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFTIRD
Sbjct  392  IEKRGISFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTIRD  451

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLPSWCN+   KLPFCQI+GEYRMEL
Sbjct  452  AYMLKIFENNQTRLPSWCNNEEAKLPFCQILGEYRMEL  489


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPPSYERP  C
Sbjct  490  PQYNTIEPYANMNENCPSLPPSYERPQRC  518



>ref|XP_004135222.1| PREDICTED: uncharacterized protein LOC101209749 [Cucumis sativus]
 ref|XP_004155340.1| PREDICTED: uncharacterized LOC101209749 [Cucumis sativus]
 gb|KGN51842.1| hypothetical protein Csa_5G603390 [Cucumis sativus]
Length=524

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DN+PPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDL++IL E
Sbjct  338  FSWIDTVTDNFPPPLDAHLVISVMSMWTRLQPAYAANMWNEALNKRLGTEDLDLHDILVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG+ FD+LLTIPEQD+WVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  398  TEKRGIPFDELLTIPEQDDWVYSDGKSTTCVAFILAMYKEAGIFGPVSSSIQVTEFTIRD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N TRLP+WCN+ +DKLPFCQI+GEY+MEL
Sbjct  458  AYMLKIFEDNHTRLPTWCNNESDKLPFCQILGEYKMEL  495


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P +NTLEPYANMNENCPSLPP+Y+RP  C
Sbjct  496  PQFNTLEPYANMNENCPSLPPTYDRPTQC  524



>ref|XP_002460179.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
 gb|EER96700.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
Length=537

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ E
Sbjct  351  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEGLDLQGIIIE  410

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRD
Sbjct  411  TERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFAPFSESIQVTEFTIRD  470

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N  RLPSWCN+  DKLPFCQI+GEYRMEL
Sbjct  471  AYMLKIFEDNPARLPSWCNTDTDKLPFCQILGEYRMEL  508


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  509  PEYNTIEPYAKMNENCPSLPPTYKRPARC  537



>ref|XP_007044484.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
 gb|EOY00316.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
Length=527

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  341  FSWIDTVADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILDE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+ FDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG +A SIQVTEFTIRD
Sbjct  401  TERRGIAFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPIANSIQVTEFTIRD  460

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLPSWCN  +   PFCQI+GEY MEL
Sbjct  461  AYMLKIFENNQTRLPSWCNYKDGGFPFCQILGEYWMEL  498


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPP Y+RP  C
Sbjct  499  PHYNTIEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_008798032.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713048 
[Phoenix dactylifera]
Length=539

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI++NYPPP+DA+LV+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ E
Sbjct  353  FSWIDTIANNYPPPLDANLVMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIE  412

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEW YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRD
Sbjct  413  TERRGMTFDQLLTIPEQDEWEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRD  472

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENN+TRLPSWCN+  +KLPFCQI+G+Y+MEL
Sbjct  473  AYMLKIFENNRTRLPSWCNADEEKLPFCQILGDYQMEL  510


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA+MNENCPSLPP+YERP+ C
Sbjct  511  PDYNTIEPYAHMNENCPSLPPTYERPVIC  539



>ref|XP_004956736.1| PREDICTED: uncharacterized protein LOC101782072 [Setaria italica]
Length=538

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ E
Sbjct  352  FSWIDTIGDNYPPPLDANLVMTVMSMWTRVQPLYAANMWNEALNKRLGTEGLDLKGIIME  411

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++FDQLLTIPEQDEW+YSDGKSTTCVAFILAMYKE+G+FG  AESIQVTEFTIRD
Sbjct  412  TERRGMSFDQLLTIPEQDEWIYSDGKSTTCVAFILAMYKEAGIFGPFAESIQVTEFTIRD  471

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E++  RLPSWCN+ +DKLPFCQI+GEYRMEL
Sbjct  472  AYMLKIFEDSLARLPSWCNTESDKLPFCQILGEYRMEL  509


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  510  PEYNTVEPYAKMNENCPSLPPTYKRPARC  538



>ref|XP_006300446.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
 gb|EOA33344.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
Length=531

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  345  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA++IQVTEFTIRD
Sbjct  405  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADNIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK+YE+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  465  AYALKLYESNQTRLPSWCNTEEGKLDFCQILGEYRMELPG  504



>ref|XP_002887283.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63542.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  339  FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  399  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  458

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK++E+NQTRLPSWCN+  +KL FCQI+GEYRMEL G
Sbjct  459  AYTLKLFESNQTRLPSWCNTEEEKLDFCQILGEYRMELPG  498



>ref|XP_010471012.1| PREDICTED: uncharacterized protein LOC104750861 [Camelina sativa]
Length=532

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  346  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  405

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVF  LA+ IQVTEFTIRD
Sbjct  406  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFDPLADHIQVTEFTIRD  465

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK+YENNQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  466  AYTLKLYENNQTRLPSWCNTEEGKLEFCQILGEYRMELPG  505



>ref|XP_010652908.1| PREDICTED: uncharacterized protein LOC100251867 isoform X2 [Vitis 
vinifera]
Length=430

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTRMQP YA NMWNEALNKRL TE LDL  ILAE
Sbjct  244  FSWIDTIADNYPPPLDAHLVISVMSMWTRMQPAYAENMWNEALNKRLETEDLDLLGILAE  303

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+G+FG  + SIQVTEFTIRD
Sbjct  304  TEKRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGIFGPASSSIQVTEFTIRD  363

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQ+RLPSWC   + +L FCQI+GEYRMEL
Sbjct  364  AYMLKIFENNQSRLPSWCGDEDGRLQFCQILGEYRMEL  401


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA+MNENCPSLPP+YERP+ C
Sbjct  402  PQYNTIEPYAHMNENCPSLPPTYERPVGC  430



>ref|XP_010415693.1| PREDICTED: uncharacterized protein LOC104701657 [Camelina sativa]
Length=531

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  345  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVF  LA+ IQVTEFTIRD
Sbjct  405  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFDPLADHIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK+YENNQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  465  AYTLKLYENNQTRLPSWCNTEEGKLEFCQILGEYRMELPG  504



>ref|XP_010512094.1| PREDICTED: uncharacterized protein LOC104788107 [Camelina sativa]
Length=531

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  345  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVF  LA+ IQVTEFTIRD
Sbjct  405  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFDPLADHIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK+YENNQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  465  AYTLKLYENNQTRLPSWCNTEEGKLEFCQILGEYRMELPG  504



>dbj|BAJ33873.1| unnamed protein product [Thellungiella halophila]
Length=521

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP+YAANMWNEALNKRLGTE LDLY IL E
Sbjct  343  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPSYAANMWNEALNKRLGTEDLDLYGILEE  402

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  403  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  462

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  463  AYTLRLFEENQTRLPSWCNTEEGKLEFCQILGEYRMELPG  502



>ref|XP_009360447.1| PREDICTED: uncharacterized protein LOC103950916 [Pyrus x bretschneideri]
Length=527

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DN+PPP+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEILAE
Sbjct  340  FSWIDTMADNFPPPLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILAE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E R + FD LLTIPE DEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRD
Sbjct  400  VESREMAFDHLLTIPEHDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPS-WCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQ RLPS WCN  ++KLPFCQI+GEYRMEL
Sbjct  460  AYMLKIFEDNQPRLPSCWCNGKDEKLPFCQILGEYRMEL  498


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNE+CPSLPP+Y+RP  C
Sbjct  499  PLYNTLEPYANMNEHCPSLPPTYDRPTRC  527



>emb|CDY03761.1| BnaA02g14760D [Brassica napus]
Length=526

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  340  FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  400  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  460  AYTLRLFEDNQTRLPSWCNTEKGKLEFCQILGEYRMELPG  499



>ref|XP_009127775.1| PREDICTED: uncharacterized protein LOC103852633 [Brassica rapa]
Length=526

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  340  FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  400  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  460  AYTLRLFEDNQTRLPSWCNTEKGKLEFCQILGEYRMELPG  499



>ref|XP_006390921.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
 gb|ESQ28207.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
Length=529

 Score =   283 bits (723),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP+YAANMWNEALNKRLGTE LDLY IL E
Sbjct  343  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPSYAANMWNEALNKRLGTEDLDLYGILEE  402

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  403  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  462

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  463  AYTLRLFEENQTRLPSWCNTEEGKLEFCQILGEYRMELPG  502


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT++PYANMNENCPSLPP YERP  C
Sbjct  501  PGYNTIQPYANMNENCPSLPPDYERPSKC  529



>emb|CDY42991.1| BnaC02g19650D [Brassica napus]
Length=529

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  343  FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  402

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  403  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  462

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  463  AYTLRLFEDNQTRLPSWCNTEKGKLEFCQILGEYRMELPG  502



>emb|CDY38797.1| BnaA07g28690D [Brassica napus]
Length=523

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  337  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEELDLYGILEE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  397  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  456

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E+NQTRLPSWCN+   KL FCQI+GE+RMEL G
Sbjct  457  AYTLRLFEDNQTRLPSWCNTEKGKLEFCQILGEFRMELPG  496



>ref|XP_009105692.1| PREDICTED: uncharacterized protein LOC103831561 [Brassica rapa]
Length=526

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  340  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEELDLYGILEE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  400  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  459

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E+NQTRLPSWCN+   KL FCQI+GE+RMEL G
Sbjct  460  AYTLRLFEDNQTRLPSWCNTEKGKLEFCQILGEFRMELPG  499


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPY NMNENCPSLPP YERP  C
Sbjct  498  PGYNTIEPYPNMNENCPSLPPDYERPSKC  526



>ref|NP_001142383.1| uncharacterized protein LOC100274556 precursor [Zea mays]
 gb|ACF88369.1| unknown [Zea mays]
Length=536

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTE  DL  I+ E
Sbjct  350  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEDFDLQGIIME  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             ERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRD
Sbjct  410  IERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRD  469

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N  RLP WCN+G DKLPFCQI+GEYRMEL
Sbjct  470  AYMLKIFEDNPARLPGWCNAGTDKLPFCQILGEYRMEL  507


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  508  PEYNTIEPYAKMNENCPSLPPTYKRPARC  536



>ref|XP_002270582.1| PREDICTED: uncharacterized protein LOC100251867 isoform X1 [Vitis 
vinifera]
 emb|CBI32078.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTRMQP YA NMWNEALNKRL TE LDL  ILAE
Sbjct  334  FSWIDTIADNYPPPLDAHLVISVMSMWTRMQPAYAENMWNEALNKRLETEDLDLLGILAE  393

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+G+FG  + SIQVTEFTIRD
Sbjct  394  TEKRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGIFGPASSSIQVTEFTIRD  453

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQ+RLPSWC   + +L FCQI+GEYRMEL
Sbjct  454  AYMLKIFENNQSRLPSWCGDEDGRLQFCQILGEYRMEL  491


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA+MNENCPSLPP+YERP+ C
Sbjct  492  PQYNTIEPYAHMNENCPSLPPTYERPVGC  520



>tpg|DAA61320.1| TPA: hypothetical protein ZEAMMB73_635026 [Zea mays]
Length=536

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTE  DL  I+ E
Sbjct  350  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEDFDLQGIIME  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             ERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRD
Sbjct  410  IERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRD  469

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N  RLP WCN+G DKLPFCQI+GEYRMEL
Sbjct  470  AYMLKIFEDNPARLPGWCNAGTDKLPFCQILGEYRMEL  507


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  508  PEYNTIEPYAKMNENCPSLPPTYKRPARC  536



>gb|EPS61168.1| hypothetical protein M569_13630, partial [Genlisea aurea]
Length=249

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+DAHLV+SVMSMW RMQP YAANMWNEALN RLGT+ LDLYEIL E
Sbjct  63   FSWIDTVANNYPPPLDAHLVVSVMSMWARMQPAYAANMWNEALNMRLGTKDLDLYEILFE  122

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG+TFDQLLTIPEQDEW+YSDGKSTTCVAFIL+MYK +GVF   ++S+QVTEFTI+D
Sbjct  123  TERRGITFDQLLTIPEQDEWIYSDGKSTTCVAFILSMYKAAGVFSPFSDSVQVTEFTIKD  182

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N TRLP WC +  D L FCQI+GE+RMEL
Sbjct  183  AYMLKIFEDNATRLPGWCQNEKDGLSFCQILGEFRMEL  220


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P+YNTL+PYANMNENCPSLPP+YERP  C
Sbjct  221  PYYNTLDPYANMNENCPSLPPTYERPPRC  249



>ref|XP_010683317.1| PREDICTED: uncharacterized protein LOC104898021 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI +N+PPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTEGLDL+EIL E
Sbjct  345  FSWIDTIGENFPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEGLDLHEILIE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E RG+ F+QLLTIPEQD+W+YSDGKSTTCVAFILAMYKE+G+F  L+ESIQVTEFTIRD
Sbjct  405  IEDRGIAFEQLLTIPEQDDWIYSDGKSTTCVAFILAMYKEAGIFNPLSESIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N TRLPSWC + N  +PFCQI+GEYRMEL
Sbjct  465  AYMLKIFEDNTTRLPSWCTTENGHVPFCQILGEYRMEL  502


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA+MNENCPSLPP Y+RPI C
Sbjct  503  PEYNTVEPYAHMNENCPSLPPHYQRPIKC  531



>gb|KFK41436.1| hypothetical protein AALP_AA2G130200 [Arabis alpina]
Length=527

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  341  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG +A+ IQVTEFTIRD
Sbjct  401  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPIADQIQVTEFTIRD  460

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+I++ NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  461  AYTLRIFDENQTRLPSWCNTEEGKLNFCQILGEYRMELPG  500



>gb|EMS45474.1| hypothetical protein TRIUR3_21271 [Triticum urartu]
Length=435

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ E
Sbjct  249  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLQGIILE  308

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++FDQLLTIPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRD
Sbjct  309  TEKRGMSFDQLLTIPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRD  368

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+++TRLPSWC +  DK PFCQI+GEYRMEL
Sbjct  369  AYMLKIFEDDRTRLPSWCRTEADKPPFCQILGEYRMEL  406


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  407  PEYNTIEPYAKMNENCPSLPPTYKRPSRC  435



>ref|XP_002520208.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42263.1| conserved hypothetical protein [Ricinus communis]
Length=527

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHL++SVMSMWTR+QP YAANMWNEALNKRL TE LDLY ILAE
Sbjct  341  FSWIDTIADNYPPPLDAHLIVSVMSMWTRVQPAYAANMWNEALNKRLDTEDLDLYGILAE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG+TFD+LLT PEQD+W+YSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTIRD
Sbjct  401  IEKRGVTFDELLTAPEQDDWIYSDGKSTTCVAFILAMYKEAGVFGPISSSIQVTEFTIRD  460

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENNQTRLPSWCN+ N +L FCQI+GEY MEL
Sbjct  461  AYMLKIFENNQTRLPSWCNNDNGRLLFCQILGEYWMEL  498


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  283  YNTLEPYANMNENCPSLPPSYERPIHC  203
            YN+LEPYANMNENCPSLPP+Y+RP  C
Sbjct  501  YNSLEPYANMNENCPSLPPNYDRPGRC  527



>ref|XP_009419908.1| PREDICTED: uncharacterized protein LOC103999784 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=537

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+DA+LV+SVMSMWTR+QP+YAANMWNEALNKRLGTE LDL+EI+ E
Sbjct  351  FSWIDTVAENYPPPLDANLVMSVMSMWTRLQPSYAANMWNEALNKRLGTEDLDLHEIIVE  410

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T+R+G+TFDQLLT+PEQDEW+YSDGKSTTCVAF+L +YKE+G+ G LA SIQVTEFTIRD
Sbjct  411  TQRQGMTFDQLLTMPEQDEWIYSDGKSTTCVAFVLELYKEAGILGPLANSIQVTEFTIRD  470

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYML I+ENNQTRLPSWCN+  +KLPFCQI+G YRMEL
Sbjct  471  AYMLNIFENNQTRLPSWCNALEEKLPFCQILGYYRMEL  508


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA+MNENCPSLPP+Y RP  C
Sbjct  509  PQYNTIEPYAHMNENCPSLPPAYTRPERC  537



>gb|ACG40083.1| hypothetical protein [Zea mays]
Length=537

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTE LDL  I+ E
Sbjct  351  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEDLDLQGIIME  410

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             ERRG++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRD
Sbjct  411  IERRGMSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRD  470

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N  RLP WCN+  DKLPFCQI+GEYRMEL
Sbjct  471  AYMLKIFEDNPARLPGWCNADTDKLPFCQILGEYRMEL  508


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  509  PEYNTIEPYAKMNENCPSLPPTYKRPARC  537



>gb|AAB61100.1| ESTs gb|R30459,gb|N38441 come from this gene [Arabidopsis thaliana]
Length=551

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  365  FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  424

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +G+F  LA+ IQVTEFTIRD
Sbjct  425  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGIFDPLADHIQVTEFTIRD  484

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK++E+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  485  AYTLKLFESNQTRLPSWCNTEEGKLDFCQILGEYRMELPG  524



>ref|NP_564985.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK25910.1|AF360200_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93691.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35026.1| uncharacterized protein AT1G70160 [Arabidopsis thaliana]
Length=523

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  337  FSWIDTLGDNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +G+F  LA+ IQVTEFTIRD
Sbjct  397  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGIFDPLADHIQVTEFTIRD  456

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY LK++E+NQTRLPSWCN+   KL FCQI+GEYRMEL G
Sbjct  457  AYTLKLFESNQTRLPSWCNTEEGKLDFCQILGEYRMELPG  496



>emb|CDY11612.1| BnaC06g31270D [Brassica napus]
Length=525

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL E
Sbjct  339  FSWIDTLADNYPPPLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEELDLYGILEE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T RRG++FD+LLTIPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRD
Sbjct  399  TARRGMSFDELLTIPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRD  458

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AY L+++E+NQTRLPSWCN+   KL  CQI+GE+RMEL G
Sbjct  459  AYTLRMFEDNQTRLPSWCNTEKGKLELCQILGEFRMELPG  498


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT++PY NMNENCPSLPP+YERP  C
Sbjct  497  PGYNTIDPYPNMNENCPSLPPTYERPSKC  525



>ref|XP_003578075.1| PREDICTED: uncharacterized protein LOC100824338 [Brachypodium 
distachyon]
Length=536

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ E
Sbjct  350  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVE  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++FDQLLTIPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRD
Sbjct  410  TERRGMSFDQLLTIPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRD  469

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI++N+Q RLPSWC +  DK  FCQI+GEY+MEL
Sbjct  470  AYMLKIFQNDQARLPSWCQTEADKPTFCQILGEYKMEL  507


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  508  PEYNTIEPYAKMNENCPSLPPTYKRPSRC  536



>gb|EEC83605.1| hypothetical protein OsI_29292 [Oryza sativa Indica Group]
Length=547

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDNYPPP+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  361  FSWIDTMSDNYPPPLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITE  420

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T +RG++F+QLLTIPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQVTEFTIRD
Sbjct  421  TGKRGMSFNQLLTIPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQVTEFTIRD  480

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCNSG D+LPFCQI+GEY+MEL
Sbjct  481  AYMLKIFEDNQTRLPSWCNSGADRLPFCQILGEYKMEL  518


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  519  PEYNTIEPYANMNENCPSSPPTYTRPLGC  547



>ref|NP_001061835.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAC98558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99810.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23749.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAG97186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=547

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDNYPPP+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  361  FSWIDTMSDNYPPPLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITE  420

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T +RG++F+QLLTIPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQVTEFTIRD
Sbjct  421  TGKRGMSFNQLLTIPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQVTEFTIRD  480

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCNSG D+LPFCQI+GEY+MEL
Sbjct  481  AYMLKIFEDNQTRLPSWCNSGADRLPFCQILGEYKMEL  518


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  519  PEYNTIEPYANMNENCPSSPPTYTRPLGC  547



>dbj|BAJ97125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ E
Sbjct  348  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLQGIIFE  407

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++FDQLLTIPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRD
Sbjct  408  TEKRGMSFDQLLTIPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRD  467

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+++ RLPSWC +  DK PFCQI+GEYRMEL
Sbjct  468  AYMLKIFEDDRARLPSWCLTEADKPPFCQILGEYRMEL  505


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  506  PEYNTIEPYAKMNENCPSLPPTYKRPSRC  534



>ref|XP_010272086.1| PREDICTED: uncharacterized protein LOC104607980 isoform X1 [Nelumbo 
nucifera]
Length=531

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ +NYPPP+DAHLV+SVM MWTR+QP YAANMWNEALNKRLGT+GLDL  ILAE
Sbjct  345  FSWIDTMDENYPPPLDAHLVLSVMFMWTRLQPAYAANMWNEALNKRLGTDGLDLPGILAE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +ERRG++FDQLL IPEQDEWVYSDGKSTTCVAFIL MYKE+G+F  ++ SIQVTEFTIRD
Sbjct  405  SERRGISFDQLLIIPEQDEWVYSDGKSTTCVAFILEMYKEAGIFYPISSSIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENN+TRLPSWC++ + +LPFCQI+GEY+MEL
Sbjct  465  AYMLKIFENNRTRLPSWCSNADGELPFCQILGEYQMEL  502


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPP+YERP+ C
Sbjct  503  PQYNTIEPYANMNENCPSLPPTYERPVRC  531



>ref|XP_006856897.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
 gb|ERN18364.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
Length=526

 Score =   275 bits (702),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLVISVMSMWTR+QP YAANMWNEALNKRL TEGLDL+ IL E
Sbjct  339  FSWIDTIADNYPPPLDAHLVISVMSMWTRLQPAYAANMWNEALNKRLETEGLDLHGILLE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++FDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+G+FG ++ SIQVTEFTIRD
Sbjct  399  TEKRGISFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGIFGPVSNSIQVTEFTIRD  458

Query  402  AYMLKIYENNQTRLPSWC-NSGNDKLPFCQIVGEYRMEL  289
            AYML+I+ENN +RLPSWC N    + PFCQI+GEY ME 
Sbjct  459  AYMLRIFENNSSRLPSWCSNRDTKQPPFCQILGEYHMEF  497



>gb|ACN36261.1| unknown [Zea mays]
Length=392

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT SDNYPPP+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  206  FSWIDTASDNYPPPLDANLVMAIMSMWTRLQPRYASNMWNEALNKRLGTEKLDLHGIIRE  265

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+F+QLLT+PE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRD
Sbjct  266  TERRGLSFNQLLTVPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPYTESIQVTEFTIRD  325

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN+  D LPFCQI+GEY+M L
Sbjct  326  AYMLKIFEDNQTRLPSWCNAAADGLPFCQILGEYKMGL  363


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  295  GTPWYNTLEPYANMNENCPSLPPSYERPIHC  203
            G P YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  362  GLPEYNTIEPYANMNENCPSAPPTYSRPSRC  392



>dbj|BAJ99018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ E
Sbjct  348  FSWIDTIGDNYPPPLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLQGIIFE  407

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++FDQLLTIPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRD
Sbjct  408  TEKRGMSFDQLLTIPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRD  467

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E++  RLPSWC +  DK PFCQI+GEYRMEL
Sbjct  468  AYMLKIFEDDGARLPSWCLTEADKPPFCQILGEYRMEL  505


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  506  PEYNTIEPYAKMNENCPSLPPTYKRPSRC  534



>ref|XP_010043827.1| PREDICTED: uncharacterized protein LOC104432932 [Eucalyptus grandis]
 gb|KCW85832.1| hypothetical protein EUGRSUZ_B02569 [Eucalyptus grandis]
Length=534

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ DNYPPP+DAHLV+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ I+ E
Sbjct  348  FSWIDTVGDNYPPPLDAHLVVSVMSMWTRLQPAYAANMWNEALNKRLGTEELDLHGIIQE  407

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++FD+LLT PEQD+W+YSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTIRD
Sbjct  408  TEQRGMSFDELLTTPEQDDWMYSDGKSTTCVAFILAMYKEAGVFGPISSSIQVTEFTIRD  467

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+EN+QTRLPSWC++   +LP+CQI+GEY MEL
Sbjct  468  AYMLKIFENSQTRLPSWCSNKGGQLPYCQILGEYWMEL  505


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPPSYERP  C
Sbjct  506  PEYNTIEPYANMNENCPSLPPSYERPKRC  534



>ref|XP_002444358.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
 gb|EES13853.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
Length=542

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDNYPPP+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ +++E
Sbjct  356  FSWIDTMSDNYPPPLDANLVMAIMSMWTRLQPHYASNMWNEALNKRLGTEKLDLHGVISE  415

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RGL+F+QLLTIPE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRD
Sbjct  416  TEKRGLSFNQLLTIPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPFTESIQVTEFTIRD  475

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN+  D+LPFCQI+GEY+M+L
Sbjct  476  AYMLKIFEDNQTRLPSWCNAAADRLPFCQILGEYKMDL  513



>ref|XP_004973463.1| PREDICTED: uncharacterized protein LOC101781133 [Setaria italica]
Length=546

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDNYPPP+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  360  FSWIDTMSDNYPPPLDANLVMAIMSMWTRLQPHYASNMWNEALNKRLGTEKLDLHGIITE  419

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+F+QLLTIPE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRD
Sbjct  420  TERRGLSFNQLLTIPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPFTESIQVTEFTIRD  479

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLK++E+NQTRLP WCN+  D+LPFCQI+GEY+M+L
Sbjct  480  AYMLKVFEDNQTRLPGWCNAAADRLPFCQILGEYKMDL  517


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  518  PEYNTIEPYANMNENCPSAPPTYSRPARC  546



>dbj|BAJ91369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   272 bits (695),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S+NYPPP+DA+LV++ MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++E
Sbjct  345  FSWIDTMSENYPPPLDANLVMAAMSMWTRLQPHYASNMWNEALNKRLGTEQLDLHGIISE  404

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG++F+QLLTIPEQDEW YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRD
Sbjct  405  TERRGMSFNQLLTIPEQDEWEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRD  464

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYML+I+E+N+TRLP WCN   D+LPFCQ++GEY+MEL
Sbjct  465  AYMLRIFEDNRTRLPGWCNGDADRLPFCQVLGEYKMEL  502


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT++PYANMNENCPS PP+Y+RP+ C
Sbjct  503  PEYNTIQPYANMNENCPSSPPTYDRPLRC  531



>ref|XP_006659410.1| PREDICTED: uncharacterized protein LOC102708916 [Oryza brachyantha]
Length=409

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDN+PPP+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  223  FSWIDTMSDNFPPPLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITE  282

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T +RG++F+QLLTIPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQVTEFTIRD
Sbjct  283  TGKRGMSFNQLLTIPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQVTEFTIRD  342

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+N TRLPSWCN   D+LPFCQI+GEY+M+L
Sbjct  343  AYMLKIFEDNHTRLPSWCNHEADRLPFCQILGEYKMDL  380


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  381  PEYNTIEPYANMNENCPSSPPTYTRPLGC  409



>ref|NP_001143255.1| uncharacterized protein LOC100275783 precursor [Zea mays]
 gb|ACG30173.1| hypothetical protein [Zea mays]
Length=522

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT SDNYPPP+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  336  FSWIDTASDNYPPPLDANLVMAIMSMWTRLQPRYASNMWNEALNKRLGTEKLDLHGIIRE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+F+QLLT+PE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRD
Sbjct  396  TERRGLSFNQLLTVPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPYTESIQVTEFTIRD  455

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN+  D LPFCQI+GEY+M L
Sbjct  456  AYMLKIFEDNQTRLPSWCNAAADGLPFCQILGEYKMGL  493


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  295  GTPWYNTLEPYANMNENCPSLPPSYERPIHC  203
            G P YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  492  GLPEYNTIEPYANMNENCPSAPPTYSRPSRC  522



>ref|XP_008676929.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 ref|XP_008676930.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 gb|AFW62202.1| hypothetical protein ZEAMMB73_209421 [Zea mays]
Length=522

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT SDNYPPP+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  336  FSWIDTASDNYPPPLDANLVMAIMSMWTRLQPRYASNMWNEALNKRLGTEKLDLHGIIRE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+F+QLLT+PE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRD
Sbjct  396  TERRGLSFNQLLTVPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPYTESIQVTEFTIRD  455

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCN+  D LPFCQI+GEY+M L
Sbjct  456  AYMLKIFEDNQTRLPSWCNAAADGLPFCQILGEYKMGL  493


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  295  GTPWYNTLEPYANMNENCPSLPPSYERPIHC  203
            G P YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  492  GLPEYNTIEPYANMNENCPSAPPTYSRPSRC  522



>ref|XP_006858155.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
 gb|ERN19622.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
Length=526

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAHLV SVM+MW ++QP YAANMWNEALNKRLGTEGLDL EIL E
Sbjct  339  FSWIDTIEDNYPPPLDAHLVASVMTMWNKIQPAYAANMWNEALNKRLGTEGLDLPEILVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TER+GL+FD+LLTIPEQD+W+Y+DGKST+CVAF+L MYK++G+F  +A+SIQVTEFTI+D
Sbjct  399  TERQGLSFDKLLTIPEQDDWLYTDGKSTSCVAFVLEMYKQAGLFDQIADSIQVTEFTIKD  458

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+LK +EN+ +RLP WCN G+D KLPFCQI+G+YRMEL G
Sbjct  459  AYILKFFENDTSRLPQWCNKGDDVKLPFCQILGKYRMELPG  499



>ref|XP_003574496.1| PREDICTED: uncharacterized protein LOC100845920 [Brachypodium 
distachyon]
Length=536

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S+NYPPP+DA+L+++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++E
Sbjct  350  FSWIDTMSENYPPPLDANLIMAVMSMWTRLQPQYASNMWNEALNKRLGTEKLDLHGIISE  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++F+QLLT+PEQDEW YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRD
Sbjct  410  TEKRGMSFNQLLTVPEQDEWEYSDGKSTTCVAFILSMYKAAGVFAPFTESIQVTEFTIRD  469

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYML+I+E+N TRLP WCN   D LPFCQI+GEY+MEL
Sbjct  470  AYMLRIFEDNATRLPGWCNGEADGLPFCQILGEYKMEL  507


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPS PP+Y+RP+ C
Sbjct  508  PEYNTIEPYANMNENCPSSPPTYKRPVRC  536



>ref|XP_010445104.1| PREDICTED: uncharacterized protein LOC104727724, partial [Camelina 
sativa]
Length=247

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  60   FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  119

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  120  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  179

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL G
Sbjct  180  AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPG  220



>gb|ABK24649.1| unknown [Picea sitchensis]
Length=521

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+DNYPPP+DAHLV+S+M+MWTR+QP YAANMWNEALNKRLGT  LD+  +L E
Sbjct  334  FSWIDTITDNYPPPLDAHLVLSIMAMWTRVQPNYAANMWNEALNKRLGTMDLDIRGVLIE  393

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+ F+QLLT+PEQD+W+YSDGKSTTCVAFIL MYKE+G+F S++ SIQVTEFTIRD
Sbjct  394  SEKRGIPFEQLLTVPEQDDWIYSDGKSTTCVAFILEMYKEAGLFDSISSSIQVTEFTIRD  453

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYM+K +E+N+T LPSWCN  +D KLPFCQI+GEYRMEL G
Sbjct  454  AYMMKYFESNRTHLPSWCNENDDVKLPFCQILGEYRMELPG  494



>ref|XP_010267678.1| PREDICTED: uncharacterized protein LOC104604833 [Nelumbo nucifera]
Length=528

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT   NYPPP+DAHLV SVM++W +M+P YAANMWNEALNKRLGTEGLDL EIL E
Sbjct  341  FSWIDTTYGNYPPPIDAHLVASVMTIWNQMKPEYAANMWNEALNKRLGTEGLDLPEILVE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+FD+LLTIPEQD+W+YSDGKST+CVAFIL MYK +G+F  +A SIQVTEFTI+D
Sbjct  401  TERRGLSFDKLLTIPEQDDWIYSDGKSTSCVAFILEMYKHAGLFDPIASSIQVTEFTIKD  460

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN G N KLPFCQI GEYRMEL G
Sbjct  461  AYTLKFFENNSSRLPKWCNEGDNVKLPFCQIKGEYRMELPG  501



>ref|XP_010276049.1| PREDICTED: uncharacterized protein LOC104610902 [Nelumbo nucifera]
Length=528

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV S M++W +MQP YAAN+WNEALNKRLGTEGLDL EIL E
Sbjct  341  FSWIDTIDGNYPPPLDAHLVASGMTVWHQMQPAYAANLWNEALNKRLGTEGLDLPEILVE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRGL+FD+LLTIPEQD+W+YS+GKST+CVAFIL MYK++G+FG ++ SIQVTEFTI+D
Sbjct  401  TERRGLSFDKLLTIPEQDDWLYSNGKSTSCVAFILEMYKQAGLFGPISSSIQVTEFTIKD  460

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN G+D KLPFCQI G+YRMEL G
Sbjct  461  AYTLKFFENNSSRLPKWCNEGDDVKLPFCQIRGKYRMELPG  501



>gb|EAZ42788.1| hypothetical protein OsJ_27372 [Oryza sativa Japonica Group]
Length=484

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 142/158 (90%), Gaps = 5/158 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDNYPPP+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ E
Sbjct  303  FSWIDTMSDNYPPPLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITE  362

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T +RG++F+QLLTIPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQ     IRD
Sbjct  363  TGKRGMSFNQLLTIPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQ-----IRD  417

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+E+NQTRLPSWCNSG D+LPFCQI+GEY+MEL
Sbjct  418  AYMLKIFEDNQTRLPSWCNSGADRLPFCQILGEYKMEL  455


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  456  PEYNTIEPYANMNENCPSSPPTYTRPLGC  484



>gb|KCW70170.1| hypothetical protein EUGRSUZ_F03459 [Eucalyptus grandis]
Length=439

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W +++P+YAAN+WNEALN RLGTEGLDL +IL E
Sbjct  252  FSWIDTIDGNYPPPLDAHLVASVMTVWNQLRPSYAANLWNEALNLRLGTEGLDLPDILVE  311

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG +FD+LLTIPE+D+W+YSDGKST+C+AF+L MYKE+G+FGS+A+SIQVTEFTI+D
Sbjct  312  TEKRGSSFDELLTIPEKDDWLYSDGKSTSCIAFVLEMYKEAGLFGSIADSIQVTEFTIKD  371

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML+ +ENN +RLP WCN  +D KLPFCQI G+YRMEL G
Sbjct  372  AYMLRFFENNSSRLPKWCNDADDVKLPFCQIRGKYRMELPG  412



>gb|KDO82633.1| hypothetical protein CISIN_1g0101752mg, partial [Citrus sinensis]
Length=168

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  526
            V+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDE
Sbjct  1    VVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDE  60

Query  525  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  346
            WVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN
Sbjct  61   WVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFENNQTRLPSWCN  120

Query  345  SGNDKLPFCQIVGEYRMEL  289
            +   KLPFCQI+GEYRMEL
Sbjct  121  NEEAKLPFCQILGEYRMEL  139


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPPSYERP  C
Sbjct  140  PQYNTIEPYANMNENCPSLPPSYERPQRC  168



>ref|XP_006401517.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
 gb|ESQ42970.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
Length=529

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+SDNYPPP+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  342  FSWIDTVSDNYPPPLDAHLVASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL IPEQD W+YSDGKST+C+AFIL MYKE+G+FGSLA S+QVTEFTI+D
Sbjct  402  VEKRGSSFDKLLAIPEQDNWIYSDGKSTSCIAFILEMYKEAGLFGSLANSVQVTEFTIKD  461

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +E N +RLP WCN  +  KLP+CQI+G+YRMEL G
Sbjct  462  AYMLNFFETNASRLPEWCNDNDSVKLPYCQILGKYRMELPG  502



>ref|XP_010482896.1| PREDICTED: uncharacterized protein LOC104761505 [Camelina sativa]
Length=534

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 145/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAHL  S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  347  FSWIDTISENYPPPLDAHLAASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVE  406

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  407  VEKRGSSFDRLLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKD  466

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG---TTHWSHM  262
            AYML  +ENN +RLP+WCN   N KLP+CQI+G+YRMEL G      +SHM
Sbjct  467  AYMLNFFENNASRLPTWCNDNDNVKLPYCQILGKYRMELPGYNTMAPYSHM  517



>ref|XP_006280251.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
 gb|EOA13149.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
Length=563

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAHLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E
Sbjct  376  FSWIDTISENYPPPLDAHLVASFMTVWSKMQPEYAANMWNEALNKRLGTKGLDLSDVLVE  435

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD+W+YSDG ST+C+AFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  436  VEKRGSSFDKLLTIPEQDDWIYSDGPSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKD  495

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHGTT---HWSHM  262
            AYML  +ENN +RLP+WCN   N KLP+CQI+G+YRMEL G      +SHM
Sbjct  496  AYMLNFFENNASRLPTWCNDNDNVKLPYCQILGKYRMELPGYNTMEPYSHM  546



>gb|KCW67126.1| hypothetical protein EUGRSUZ_F00907 [Eucalyptus grandis]
Length=216

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  29   FSWIDTIDANYPPPLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVE  88

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ S+QVTEFTI+D
Sbjct  89   TEMRGSSFAELLTIPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSVQVTEFTIKD  148

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY LK +ENN +RLP WCN G+D +LPFCQI G YRMEL
Sbjct  149  AYSLKFFENNSSRLPKWCNDGDDVELPFCQIRGRYRMEL  187



>ref|XP_010448765.1| PREDICTED: uncharacterized protein LOC104731172 [Camelina sativa]
Length=536

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  349  FSWIDTISENYPPPLDAHLVASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVE  408

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  409  VEKRGSSFDRLLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKD  468

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AYML  +E N +RLP+WCN   N KLP+CQI+G+YRMEL G
Sbjct  469  AYMLNFFETNASRLPTWCNDNDNVKLPYCQILGKYRMELPG  509



>ref|XP_009143005.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103866775 
[Brassica rapa]
Length=523

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  336  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQDEW+YSDGKST+C+AFIL MYKE G+F  ++ SIQVTEFTI+D
Sbjct  396  VEKRGSSFDELLAVPEQDEWIYSDGKSTSCIAFILEMYKEGGLFDPISSSIQVTEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP+WCN  +D KLP+CQI+G+YRMEL
Sbjct  456  AYMLKFFENNASRLPTWCNDNDDVKLPYCQILGKYRMEL  494



>gb|AGV54795.1| hypothetical protein [Phaseolus vulgaris]
Length=522

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  714  AHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPE  535
            AHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++I+ ETE+RG+ FD+LLTIPE
Sbjct  352  AHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDIIVETEKRGIPFDELLTIPE  411

Query  534  QDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPS  355
            QDEWVYSDGKSTTCVAFIL+MYKE+GVFG ++ SIQVTEFTIRDAYML+I+E+NQTRLP 
Sbjct  412  QDEWVYSDGKSTTCVAFILSMYKEAGVFGPVSSSIQVTEFTIRDAYMLRIFEDNQTRLPR  471

Query  354  WCNSGNDKLPFCQIVGEYRMELHG  283
            WCN+ ND+L FCQI+GEYRMEL G
Sbjct  472  WCNNENDQLSFCQILGEYRMELPG  495


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNTLEPYANMNE CPSLPP Y+RP  C
Sbjct  494  PGYNTLEPYANMNEYCPSLPPIYDRPSQC  522



>ref|XP_002864361.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40620.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S+NYPPP+DAH+V S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  342  FSWIDTVSENYPPPLDAHIVASFMTVWSQMQPEYAANMWNEALNKRLGTEGLDLSDVLVE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL +YKE+G+FG LA SIQVTEFTI+D
Sbjct  402  VEKRGSSFDKLLAVPEQDDWIYSDGKSTSCIAFILELYKEAGLFGPLANSIQVTEFTIKD  461

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AYML  +ENN +RLP+WCN+  N KLP+CQI+G+YRMEL G
Sbjct  462  AYMLNFFENNASRLPTWCNANDNVKLPYCQILGKYRMELPG  502



>emb|CDX89285.1| BnaA01g16080D [Brassica napus]
Length=475

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL  +L E
Sbjct  288  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPGVLVE  347

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQDEW+YSDGKST+C+AFIL MYKE G+F  ++ SIQVTEFTI+D
Sbjct  348  VEKRGSSFDELLAVPEQDEWIYSDGKSTSCIAFILEMYKEGGLFDPVSSSIQVTEFTIKD  407

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN  +D KLP+CQI+G+YRMEL
Sbjct  408  AYMLKFFENNASRLPKWCNDNDDVKLPYCQILGKYRMEL  446



>ref|XP_009120015.1| PREDICTED: uncharacterized protein LOC103844940 [Brassica rapa]
Length=529

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+WIDT++ NYPPP+DAHLV S M++W ++QP YAANMWNEALNKRLGTEGL L ++L E
Sbjct  342  FAWIDTVTANYPPPIDAHLVASFMTVWNKLQPEYAANMWNEALNKRLGTEGLGLPDVLVE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD+WVYSDGKST+C+AFIL MYKE+G+FGSLA SIQVTEFT++D
Sbjct  402  VEKRGSSFDKLLTVPEQDDWVYSDGKSTSCIAFILEMYKEAGLFGSLASSIQVTEFTLKD  461

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +ENN +RLP WCN  +  KLPFCQI+G+YRMEL G
Sbjct  462  AYMLNFFENNASRLPKWCNDNDSVKLPFCQILGKYRMELPG  502



>ref|XP_010438669.1| PREDICTED: uncharacterized protein LOC104722227 [Camelina sativa]
Length=524

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  337  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  397  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL G
Sbjct  457  AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPG  497



>ref|XP_002867528.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43787.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  335  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  395  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL G
Sbjct  455  AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPG  495



>emb|CDY29265.1| BnaC01g19170D [Brassica napus]
Length=507

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAAN+WNEALNKRLGTEGLDL ++L E
Sbjct  320  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANIWNEALNKRLGTEGLDLPDVLVE  379

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD W+YSDGKST+C+AFIL MYKE G+F  ++ SIQVTEFTI+D
Sbjct  380  VEKRGSSFDELLAVPEQDHWIYSDGKSTSCIAFILEMYKEGGLFDPISSSIQVTEFTIKD  439

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +RLP+WCN  +D KLP+CQI+G+YRMEL G
Sbjct  440  AYMLKFFENNASRLPTWCNDNDDVKLPYCQILGKYRMELPG  480



>gb|KFK29208.1| hypothetical protein AALP_AA7G103200 [Arabis alpina]
Length=521

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  334  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  393

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  394  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  453

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL G
Sbjct  454  AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPG  494



>emb|CDY19873.1| BnaC09g31390D [Brassica napus]
Length=541

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+WIDT++ NYPPP+DAHLV S M++W ++QP YAANMWNEALNKRLGTEGL L ++L E
Sbjct  354  FAWIDTVTANYPPPIDAHLVASFMTVWNKLQPEYAANMWNEALNKRLGTEGLGLPDVLVE  413

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD+W+YSDGKST+C+AFIL MYKE+G+FGSLA SIQVTEFT++D
Sbjct  414  VEKRGSSFDKLLTVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFGSLASSIQVTEFTLKD  473

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +ENN +RLP WCN  +  KLPFCQI+G+YRMEL G
Sbjct  474  AYMLNFFENNASRLPKWCNDNDSVKLPFCQILGKYRMELPG  514



>ref|NP_200298.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08766.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96551.1| uncharacterized protein AT5G54870 [Arabidopsis thaliana]
Length=531

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S+NYPPP+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  344  FSWIDTVSENYPPPLDAHLVASFMTVWSQMQPEYAANMWNEALNKRLGTEGLDLSDVLVE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PE D+W+YSDGKST+C+AFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  404  VEKRGSSFDKLLAVPELDDWIYSDGKSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKD  463

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +ENN +RLP+WCN  +  KLP+CQI+G+YRMEL G
Sbjct  464  AYMLNFFENNASRLPTWCNDNDSVKLPYCQILGKYRMELPG  504



>ref|XP_008371266.1| PREDICTED: uncharacterized protein LOC103434697 [Malus domestica]
Length=522

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAHLV SVM++W R+QP YAANMWNEALNKRLGT+ L   +IL E
Sbjct  335  FSWIDTIEDNYPPPLDAHLVASVMTVWNRIQPAYAANMWNEALNKRLGTQNLSFXDILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G +FDQLLTIPEQD+WVYSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+D
Sbjct  395  VEKSGSSFDQLLTIPEQDDWVYSDGKSTSCVAFILEMYKEAGLFDPIAGSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYML I+ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  455  AYMLNIFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  493



>ref|XP_010446119.1| PREDICTED: uncharacterized protein LOC104728896 [Camelina sativa]
Length=697

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  510  FSWIDTISENYPPPLDAHLVASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVE  569

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL +YKE+G+FG LA SIQVTEFTI+D
Sbjct  570  VEKRGSSFDRLLAVPEQDDWIYSDGKSTSCIAFILEIYKEAGLFGPLASSIQVTEFTIKD  629

Query  402  AYMLKIYENNQTRLPSWCN-SGNDKLPFCQIVGEYRMELHG  283
            AYML  +ENN +RLP+WCN + N KLP+CQI+G+YRMEL G
Sbjct  630  AYMLNFFENNASRLPTWCNDNDNVKLPYCQILGKYRMELPG  670



>ref|XP_006413116.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
 gb|ESQ54569.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
Length=546

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  359  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  418

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  419  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  478

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+LK +ENN +RLP WCN  +D KLP+CQI+G+YRMEL G
Sbjct  479  AYILKFFENNASRLPKWCNDNDDVKLPYCQILGKYRMELPG  519



>ref|XP_008349941.1| PREDICTED: uncharacterized protein LOC103413239 [Malus domestica]
Length=522

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAH+V SVM++W ++QP YAANMWNEALNKRLGT+ L   +IL E
Sbjct  335  FSWIDTIEDNYPPPLDAHVVASVMTVWNQIQPAYAANMWNEALNKRLGTQNLTFPDILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FDQLLTIPEQD+W YSDGKST+CVAFIL MYKE+G+FG +A SIQVTEFTI+D
Sbjct  395  VEKRGSSFDQLLTIPEQDDWEYSDGKSTSCVAFILEMYKEAGLFGPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  455  AYMLKFFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  493



>ref|XP_010913435.1| PREDICTED: uncharacterized protein LOC105039122 isoform X2 [Elaeis 
guineensis]
Length=453

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  526
            V+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLTIPEQDE
Sbjct  286  VMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLTIPEQDE  345

Query  525  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  346
            W YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN TRLPSWCN
Sbjct  346  WEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNGTRLPSWCN  405

Query  345  SGNDKLPFCQIVGEYRMEL  289
            +  +KLPFCQI+GEYRMEL
Sbjct  406  AEEEKLPFCQILGEYRMEL  424


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+YERP+ C
Sbjct  425  PEYNTIEPYARMNENCPSLPPTYERPVSC  453



>ref|XP_010433417.1| PREDICTED: uncharacterized protein LOC104717532 [Camelina sativa]
Length=523

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  336  FSWIDTIRGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  396  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL G
Sbjct  456  AYMLKFFENNASRFPKWCNDNDDMKLPYCQILGKYRMELPG  496



>emb|CDY17285.1| BnaA10g09190D [Brassica napus]
Length=541

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+WIDT++ NYPPP+DAHLV S M++W ++QP YAANMWNEALNKRLGT+GL L ++L E
Sbjct  354  FAWIDTVTANYPPPIDAHLVASFMTVWNKLQPEYAANMWNEALNKRLGTKGLGLPDVLVE  413

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD+WVYSDGKST+C+AFIL MYKE+G+FGSLA SIQVTEFT++D
Sbjct  414  VEKRGSSFDKLLTVPEQDDWVYSDGKSTSCIAFILEMYKEAGLFGSLASSIQVTEFTLKD  473

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +ENN +RLP WCN  +  KLPFCQI+G+YRMEL G
Sbjct  474  AYMLNFFENNTSRLPKWCNDNDSVKLPFCQILGKYRMELPG  514



>ref|XP_009127046.1| PREDICTED: uncharacterized protein LOC103851917 [Brassica rapa]
Length=529

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+D+HLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E
Sbjct  342  FSWIDTVTENYPPPLDSHLVASFMTVWSKMQPDYAANMWNEALNKRLGTKGLDLSDVLVE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL IPEQD+WVYSDGKST+C+AFIL MYKE G+FGSLA+S+QVTEFTI+D
Sbjct  402  VEKRGSSFDKLLAIPEQDDWVYSDGKSTSCIAFILEMYKEGGLFGSLADSVQVTEFTIKD  461

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +E N +RLP WCN  +  KLP+CQI+G+YRM+L G
Sbjct  462  AYMLNFFETNASRLPKWCNDNDSVKLPYCQILGKYRMQLPG  502



>ref|XP_010448183.1| PREDICTED: uncharacterized protein LOC104730687 [Camelina sativa]
Length=561

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  374  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  433

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  434  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  493

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL
Sbjct  494  AYMLKFFENNASRFPKWCNDNDDAKLPYCQILGKYRMEL  532



>ref|XP_008385988.1| PREDICTED: uncharacterized protein LOC103448506 [Malus domestica]
Length=552

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAH+V SVM++W ++QP YAANMWNEALNKRLGT+ L   +IL E
Sbjct  365  FSWIDTIEDNYPPPLDAHVVASVMTVWNQIQPAYAANMWNEALNKRLGTQNLTFPDILVE  424

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FDQLLTIPEQD+W YSDGKST+CVAFIL MYKE+G+FG +A SIQVTEFTI+D
Sbjct  425  VEKRGSSFDQLLTIPEQDDWEYSDGKSTSCVAFILEMYKEAGLFGPIASSIQVTEFTIKD  484

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  485  AYMLKFFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  523



>ref|XP_007211818.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
 gb|EMJ13017.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
Length=522

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAH+V SVM++W  +QPTYAANMWNEALNKRLGT+ L   +IL E
Sbjct  335  FSWIDTIQDNYPPPLDAHVVASVMTVWNHIQPTYAANMWNEALNKRLGTQNLSFPDILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD+W+YSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+D
Sbjct  395  VEKRGSSFDELLTVPEQDDWLYSDGKSTSCVAFILEMYKEAGLFDPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  455  AYMLKFFENNSSRLPKWCNDGDSVKLPFCQIKGKYRMEL  493



>ref|XP_006283454.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
 gb|EOA16352.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
Length=557

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  370  FSWIDTISGNYPPPLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  429

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FDQLL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  430  VEKRGSSFDQLLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  489

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +R P WCN  +D  LP+CQI+G+YRMEL
Sbjct  490  AYMLKFFENNASRFPKWCNDNDDVNLPYCQILGKYRMEL  528



>emb|CDY06624.1| BnaC02g13480D [Brassica napus]
Length=610

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S+NYPPP+D+HLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E
Sbjct  342  FSWIDTVSENYPPPLDSHLVASFMTVWSKMQPDYAANMWNEALNKRLGTKGLDLSDVLVE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL IPEQD+W+YSDGKST+C+AFIL MYKE G+FGSLA+SIQVTEFT++D
Sbjct  402  VEKRGSSFDKLLAIPEQDDWIYSDGKSTSCIAFILEMYKEGGLFGSLADSIQVTEFTLKD  461

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +E N +RLP WCN  +  KLP+CQI+G+YRM+L G
Sbjct  462  AYMLNFFETNASRLPKWCNDNDSVKLPYCQILGKYRMQLPG  502



>emb|CDY20800.1| BnaA02g09400D [Brassica napus]
Length=610

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+D+HLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E
Sbjct  342  FSWIDTVTENYPPPLDSHLVASFMTVWSKMQPDYAANMWNEALNKRLGTKGLDLSDVLVE  401

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL IPEQD+WVYSDGKST+C+AFIL MYKE G+FGSLA+S+QVTEFTI+D
Sbjct  402  VEKRGSSFDKLLAIPEQDDWVYSDGKSTSCIAFILEMYKEGGLFGSLADSVQVTEFTIKD  461

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML  +E N +RLP WCN  +  KLP+CQI+G+YRM+L G
Sbjct  462  AYMLNFFETNASRLPKWCNDNDSVKLPYCQILGKYRMQLPG  502



>gb|ABR17461.1| unknown [Picea sitchensis]
Length=520

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLV+SVM++W RMQP YAANMWNEALNKRLGT+ LDL  IL E
Sbjct  333  FSWIDTLTDNYPPPLDAHLVVSVMTIWNRMQPDYAANMWNEALNKRLGTKDLDLPSILIE  392

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG++F+ LL IPE+D+W YSDGKSTTC+AFIL MYKE+G+F  ++ SIQVTEFTIRD
Sbjct  393  TEQRGISFEDLLKIPEKDDWFYSDGKSTTCIAFILEMYKEAGLFDPISNSIQVTEFTIRD  452

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYML+ +++N T LPSWCN  ++ +LPFCQI+GEYRMEL G
Sbjct  453  AYMLRFFDDNITNLPSWCNENDEVQLPFCQILGEYRMELPG  493



>gb|ACF87807.1| unknown [Zea mays]
Length=363

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  176  FSWIDTISDNYPPPLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVE  235

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LL++PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+D
Sbjct  236  SEKRGITFDKLLSVPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKD  295

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +E+N TRLP WCN  +D KLPFCQI G+YRMEL G
Sbjct  296  AYILNFFEDNSTRLPEWCNKDDDVKLPFCQIKGKYRMELPG  336



>ref|XP_009378549.1| PREDICTED: uncharacterized protein LOC103967027 [Pyrus x bretschneideri]
Length=522

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAH+V SVM++W ++QP YAANMWNEALN RLGT+ L   +IL E
Sbjct  335  FSWIDTIEDNYPPPLDAHVVASVMTVWNQIQPAYAANMWNEALNTRLGTKNLTFPDILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FDQLLTIPEQD+W YSDGKST+CVAFIL MYKE+G+FG +A SIQVTEFTI+D
Sbjct  395  VEKRGSSFDQLLTIPEQDDWEYSDGKSTSCVAFILEMYKEAGLFGPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  455  AYMLKFFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  493



>ref|XP_008226932.1| PREDICTED: uncharacterized protein LOC103326477 [Prunus mume]
Length=522

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAH+V SVM++W  +QPTYAANMWNEALNKRLGT+ L   +IL +
Sbjct  335  FSWIDTIQDNYPPPLDAHVVASVMTVWNHIQPTYAANMWNEALNKRLGTQNLSFPDILVD  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD+W+YSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+D
Sbjct  395  VEKRGSSFDELLTVPEQDDWLYSDGKSTSCVAFILEMYKEAGLFDPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  455  AYMLKFFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  493



>ref|XP_010064377.1| PREDICTED: uncharacterized protein LOC104451417 [Eucalyptus grandis]
Length=359

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  172  FSWIDTIDANYPPPLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVE  231

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ S+QVTEFTI+D
Sbjct  232  TEMRGSSFAELLTIPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSVQVTEFTIKD  291

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY LK +ENN +RLP WCN G+D +LPFCQI G YRMEL
Sbjct  292  AYSLKFFENNSSRLPKWCNDGDDVELPFCQIRGRYRMEL  330



>ref|XP_006452283.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
 gb|ESR65523.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
Length=463

 Score =   252 bits (643),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT S NYPPP+DAHLV S M+MW  +QP YAANMWNEALNKRLGTEGLDL +IL E
Sbjct  276  FSWIDTRSGNYPPPLDAHLVASGMTMWNHIQPAYAANMWNEALNKRLGTEGLDLPDILVE  335

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG  FD+LLTIPEQD+W+YSDGKST+CVAF+L MYKE+G+F  +  SIQVTEFTI+D
Sbjct  336  TERRGTPFDELLTIPEQDDWIYSDGKSTSCVAFVLEMYKEAGLFDPIGSSIQVTEFTIKD  395

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L+ +ENN +RLP WCN  +  KLP+CQI G+YRMEL G
Sbjct  396  AYSLRFFENNSSRLPKWCNDADTVKLPYCQIRGKYRMELPG  436



>ref|XP_004970230.1| PREDICTED: uncharacterized protein LOC101777322 isoform X2 [Setaria 
italica]
Length=543

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM++WT++QP YAAN+W EALNKRLGT+GLDL EI+ E
Sbjct  356  FSWIDTISDNYPPPLDAHVVASVMTVWTKLQPEYAANLWKEALNKRLGTKGLDLPEIIVE  415

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +ERRG+TFD+LLT+PE+D WVY DG+S +C+AF+L MYKE+G+FG +  S++VTEFTI+D
Sbjct  416  SERRGITFDKLLTVPEKDNWVYEDGQSASCIAFVLMMYKEAGLFGPITNSVEVTEFTIKD  475

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  +E+N TRLP WCN G+  KLPFCQI G YRMEL G
Sbjct  476  AYTLNFFEDNSTRLPEWCNKGDSVKLPFCQIKGRYRMELPG  516



>ref|XP_004491367.1| PREDICTED: uncharacterized protein LOC101492149 [Cicer arietinum]
Length=525

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  338  FSWIDTLSGNYPPPLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             ERRG +FD+LLTIPEQD+W+YSDGKST+CVAFILAMYK +G+F  +A SIQVTEFTI+D
Sbjct  398  VERRGSSFDELLTIPEQDDWLYSDGKSTSCVAFILAMYKAAGLFDPIASSIQVTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +ENN +RLP+WCN G+  KLP+CQI G+YRMEL G
Sbjct  458  AYILNFFENNASRLPTWCNDGDTVKLPYCQIKGKYRMELPG  498



>gb|KJB62763.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=524

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL+L +IL E
Sbjct  337  FSWIDTIGGNYPPPLDAHLVASVMTVWSKIQPEYAANMWNEALNKRLGTQGLNLSDILVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG +FD+LLTIPEQD W+YSDGKST+C+AF+L +YKE+G+F  +A+SIQVTEFTI+D
Sbjct  397  TEKRGSSFDELLTIPEQDNWIYSDGKSTSCIAFVLELYKEAGLFDPIADSIQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AY LK +EN+ +RLP WCN   N KLP+CQI G+YRMEL G
Sbjct  457  AYSLKFFENDSSRLPKWCNDADNVKLPYCQIKGKYRMELPG  497



>gb|KDP39105.1| hypothetical protein JCGZ_00862 [Jatropha curcas]
Length=524

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGL L +IL E
Sbjct  337  FSWIDTIEGNYPPPLDAHLVASVMTVWSQIQPAYAANMWNEALNKRLGTEGLALPDILVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG +F +LLTIPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  +A S+QVTEFTI+D
Sbjct  397  TEKRGSSFGELLTIPEQDDWMYTDGKSTSCIAFVLEMYKEAGLFDPIASSVQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY L+ +ENN +RLP WCN G+D KLPFCQI G+YRMEL
Sbjct  457  AYTLRFFENNSSRLPKWCNDGDDVKLPFCQIRGKYRMEL  495



>gb|KHN38290.1| hypothetical protein glysoja_003955 [Glycine soja]
Length=439

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  252  FSWIDTLNENYPPPLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVE  311

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD+W+YSDGKST+C+AFIL MYKE+G+F  +A S+QVTEFTI+D
Sbjct  312  VEKRGSSFDELLTIPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPVASSVQVTEFTIKD  371

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +ENN TRLP WCN G+  KLP+CQI G+YRM+L G
Sbjct  372  AYILNFFENNSTRLPKWCNDGDTVKLPYCQIKGKYRMDLPG  412



>ref|XP_009420606.1| PREDICTED: uncharacterized protein LOC104000320 [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+D+H+V SVM+MW ++QP YAANMWNEALNKRLGT+GLDL EI+ E
Sbjct  350  FSWIDTISDNYPPPLDSHVVASVMTMWNKIQPAYAANMWNEALNKRLGTQGLDLPEIIVE  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G +FD LLTIPEQD+WVY+DGKST+CVAFIL MYK +G+FGS A SIQVTEFTI+D
Sbjct  410  AEKNGTSFDNLLTIPEQDDWVYTDGKSTSCVAFILEMYKAAGLFGSNASSIQVTEFTIKD  469

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  +E+N +RLP WCN  ++ KLP+CQI G YRMEL G
Sbjct  470  AYTLNFFESNSSRLPKWCNKDDNVKLPYCQIKGRYRMELPG  510



>ref|XP_004970229.1| PREDICTED: uncharacterized protein LOC101777322 isoform X1 [Setaria 
italica]
Length=554

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM++WT++QP YAAN+W EALNKRLGT+GLDL EI+ E
Sbjct  367  FSWIDTISDNYPPPLDAHVVASVMTVWTKLQPEYAANLWKEALNKRLGTKGLDLPEIIVE  426

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +ERRG+TFD+LLT+PE+D WVY DG+S +C+AF+L MYKE+G+FG +  S++VTEFTI+D
Sbjct  427  SERRGITFDKLLTVPEKDNWVYEDGQSASCIAFVLMMYKEAGLFGPITNSVEVTEFTIKD  486

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  +E+N TRLP WCN G+  KLPFCQI G YRMEL G
Sbjct  487  AYTLNFFEDNSTRLPEWCNKGDSVKLPFCQIKGRYRMELPG  527



>gb|KCW67171.1| hypothetical protein EUGRSUZ_F00962 [Eucalyptus grandis]
Length=408

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  221  FSWIDTIDANYPPPLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVE  280

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ SIQVTEFTI+D
Sbjct  281  TEMRGSSFAELLTIPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSIQVTEFTIKD  340

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN G++ +LPFCQI G YRMEL G
Sbjct  341  AYSLKFFENNSSRLPKWCNDGDNVELPFCQIRGRYRMELPG  381



>ref|XP_004252023.1| PREDICTED: uncharacterized protein LOC101252754 [Solanum lycopersicum]
Length=523

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHLV SVM++W  +QP YAANMWNEALNKRLGT GLDL +IL E
Sbjct  336  FSWIDTIDGNYPSPLDAHLVASVMTVWNHLQPAYAANMWNEALNKRLGTRGLDLPDILVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+WVYSDGKST+C+AF+L MYKE+G+FG LA SIQVTEFTI+D
Sbjct  396  IEKRGSSFAKLLTIPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFGPLASSIQVTEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN  RLP WCN+ +  KLPFCQI+G+YRMEL G
Sbjct  456  AYSLKFFENNTNRLPMWCNADDTVKLPFCQILGKYRMELPG  496



>ref|XP_006475148.1| PREDICTED: uncharacterized protein LOC102609098 [Citrus sinensis]
 gb|KDO62608.1| hypothetical protein CISIN_1g009605mg [Citrus sinensis]
Length=531

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT S NYPPP+DAHLV S M+MW  +QP YAANMWNEALNKRLGTEGLDL +IL E
Sbjct  344  FSWIDTRSGNYPPPLDAHLVASGMTMWNHIQPAYAANMWNEALNKRLGTEGLDLPDILVE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TERRG  FD+LLTIPEQD+W+YSDGKST+CVAF+L MYKE+G+F  +  SIQVTEFTI+D
Sbjct  404  TERRGTPFDELLTIPEQDDWIYSDGKSTSCVAFVLEMYKEAGLFDPIGSSIQVTEFTIKD  463

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L+ +ENN +RLP WCN  +  KLP+CQI G+YRMEL G
Sbjct  464  AYSLRFFENNSSRLPKWCNDADTVKLPYCQIRGKYRMELPG  504



>ref|XP_006367536.1| PREDICTED: uncharacterized protein LOC102597542 [Solanum tuberosum]
Length=537

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHLV SVM++W  +QP YAANMWNEALNKRLGT+GLDL +IL E
Sbjct  350  FSWIDTIDGNYPSPLDAHLVASVMTVWNHLQPAYAANMWNEALNKRLGTQGLDLPDILVE  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+WVYSDGKST+C+AF+L MYKE+G+FG LA SIQVTEFTI+D
Sbjct  410  VEKRGSSFAKLLTIPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFGPLASSIQVTEFTIKD  469

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +EN+  RLP WCN+ +  KLPFCQI+G+YRMEL G
Sbjct  470  AYSLKFFENDTNRLPKWCNADDTVKLPFCQILGKYRMELPG  510



>gb|KHG29749.1| Transcription activator gutR [Gossypium arboreum]
Length=531

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL+L +IL E
Sbjct  344  FSWIDTIGGNYPPPLDAHLVASVMTVWSKIQPEYAANMWNEALNKRLGTQGLNLSDILVE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG +FD+LLTIPEQD W+YSDGKST+C+AF+L +YKE+G+F  +A+SIQVTEFTI+D
Sbjct  404  TEKRGSSFDELLTIPEQDNWIYSDGKSTSCIAFVLELYKEAGLFDPIADSIQVTEFTIKD  463

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +E++ +RLP WCN  +D KLP+CQI G+YRMEL G
Sbjct  464  AYSLKFFESDSSRLPKWCNDADDVKLPYCQIKGKYRMELPG  504



>ref|XP_009334822.1| PREDICTED: uncharacterized protein LOC103927611 [Pyrus x bretschneideri]
 ref|XP_009334847.1| PREDICTED: uncharacterized protein LOC103927629 [Pyrus x bretschneideri]
Length=522

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPP+DAHLV SVM++W ++QP YAANMWNEALNKRLGT+ L   +IL E
Sbjct  335  FSWIDTIEDNYPPPLDAHLVASVMTVWNQIQPAYAANMWNEALNKRLGTQNLSFPDILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G +FD+LLTIPEQD+WVYSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+D
Sbjct  395  VEKSGSSFDRLLTIPEQDDWVYSDGKSTSCVAFILEMYKEAGLFDPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYML  +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  455  AYMLNFFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  493



>dbj|BAB89049.1| unknown protein [Oryza sativa Japonica Group]
Length=545

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM+MW ++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  358  FSWIDTISDNYPPPLDAHVVASVMTMWNKLQPEYAANMWKEALNKRLGTKGLDLPEIIVE  417

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LLT+PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+D
Sbjct  418  SEKRGMTFDKLLTVPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKD  477

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  +ENN TRLP WCN  +  KLPFCQI G YRMEL G
Sbjct  478  AYSLNFFENNMTRLPVWCNKDDSVKLPFCQIKGRYRMELPG  518



>ref|NP_001044498.2| Os01g0793500 [Oryza sativa Japonica Group]
 dbj|BAD53001.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94904.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55516.1| hypothetical protein OsJ_03735 [Oryza sativa Japonica Group]
 dbj|BAF06412.2| Os01g0793500 [Oryza sativa Japonica Group]
Length=539

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM+MW ++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  352  FSWIDTISDNYPPPLDAHVVASVMTMWNKLQPEYAANMWKEALNKRLGTKGLDLPEIIVE  411

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LLT+PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+D
Sbjct  412  SEKRGMTFDKLLTVPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKD  471

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  +ENN TRLP WCN  +  KLPFCQI G YRMEL G
Sbjct  472  AYSLNFFENNMTRLPVWCNKDDSVKLPFCQIKGRYRMELPG  512



>ref|XP_003617489.1| hypothetical protein MTR_5g092140 [Medicago truncatula]
 gb|AET00448.1| plant/F10M23-360 protein [Medicago truncatula]
Length=525

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  338  FSWIDTLSGNYPPPLDANVVACVMTIWSQLQPAYAANMWNEALNKRLGTKGLDLPEVLVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+W YSDGKST+CVAFILAMYKE+G+F  +A SIQVTEFTI+D
Sbjct  398  VEKRGSSFAELLTIPEQDDWTYSDGKSTSCVAFILAMYKEAGLFDPIASSIQVTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +ENN +RLP+WCN G+  KLP+CQI G+YRMEL G
Sbjct  458  AYLLNFFENNSSRLPTWCNDGDTVKLPYCQIKGKYRMELPG  498



>ref|XP_010545218.1| PREDICTED: uncharacterized protein LOC104817662 [Tarenaya hassleriana]
Length=524

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAH+V SVM++W+++QP YAANMWNEALN RLGT+ LDL +I+ E
Sbjct  337  FSWIDTISENYPPPLDAHVVASVMTVWSKIQPDYAANMWNEALNMRLGTKDLDLPDIMVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD+WVYSDGKST+C+AF+L MYKE+G+F  +A S+QVTEFTI+D
Sbjct  397  VEKRGSSFDELLTIPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFDPIASSVQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +E N +RLP+WCN  +D KLP+CQI+G+YRMEL
Sbjct  457  AYMLKFFETNASRLPNWCNDKDDVKLPYCQILGKYRMEL  495



>ref|XP_002522970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39400.1| conserved hypothetical protein [Ricinus communis]
Length=524

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL L +IL E
Sbjct  337  FSWIDTIDKNYPPPLDAHLVASVMTVWSQIQPAYAANMWNEALNKRLGTQGLGLPDILVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL++PEQD+W+Y+DGKST+C+AF+LAMYKE+G+F  +A SIQVTEFTI+D
Sbjct  397  VEKRGSSFGELLSVPEQDDWLYTDGKSTSCIAFVLAMYKEAGLFDPIASSIQVTEFTIKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L+ +EN+ +RLP WCN G+D KLPFCQI G+YRMEL G
Sbjct  457  AYALRFFENDSSRLPKWCNDGDDVKLPFCQIKGKYRMELPG  497



>gb|EYU19247.1| hypothetical protein MIMGU_mgv1a004499mg [Erythranthe guttata]
Length=524

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+S NYPPP+DAHLV SVM++WT+M+P YA N+WNEALNKRLGT+   L EIL E
Sbjct  336  FSWIDTVSGNYPPPLDAHLVASVMTVWTQMKPAYAGNIWNEALNKRLGTQNFSLSEILVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+W+Y DGKST+CVAFI  MYKE+G+FG LA SIQVTEFTI+D
Sbjct  396  VEKRGSSFGELLAIPEQDDWIYVDGKSTSCVAFIFEMYKEAGLFGELATSIQVTEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSGND--KLPFCQIVGEYRMELHG  283
            AY LK++ENN TRLP WCN+  D  KLPFCQI G+YRMEL G
Sbjct  456  AYSLKLFENNSTRLPEWCNNDADTVKLPFCQIKGKYRMELPG  497



>gb|KJB13649.1| hypothetical protein B456_002G087800 [Gossypium raimondii]
Length=530

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV S M++W++MQP YAAN+WNEALNKRLGT+GLDL +IL E
Sbjct  343  FSWIDTIDGNYPPPLDAHLVASAMTVWSKMQPEYAANLWNEALNKRLGTKGLDLSDILVE  402

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G +FDQLLT+PEQD+W+YSDGKST+C+AF+L MYKE+G+F  +A+SIQVTEFTI+D
Sbjct  403  IEKLGSSFDQLLTVPEQDDWIYSDGKSTSCIAFVLEMYKEAGLFDPIADSIQVTEFTIKD  462

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AY L+ +ENN ++LP WCN   N KLP+CQI+G+YRMEL G
Sbjct  463  AYTLRFFENNSSQLPKWCNDADNVKLPYCQILGKYRMELPG  503



>gb|KHG01773.1| Tryptophan synthase alpha chain [Gossypium arboreum]
Length=531

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV S M++W++MQP YAAN+WNEALNKRLGT+GLDL +IL E
Sbjct  344  FSWIDTIDGNYPPPLDAHLVASAMTVWSKMQPEYAANLWNEALNKRLGTKGLDLSDILVE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G +FDQLLTIPEQD+W+YSDGKST+C+AF+L MYKE+G+F  +A+ IQVTEFTI+D
Sbjct  404  IEKHGSSFDQLLTIPEQDDWLYSDGKSTSCIAFVLEMYKEAGLFDPIADLIQVTEFTIKD  463

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AY L+ +ENN +RLP WCN   N KLP+CQI+G+YRMEL G
Sbjct  464  AYTLRFFENNSSRLPKWCNDADNVKLPYCQILGKYRMELPG  504



>ref|XP_007211816.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
 gb|EMJ13015.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
Length=522

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 139/171 (81%), Gaps = 4/171 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPPVDAH+V SVM++W  +QP YAANMWNEALNKRLGT+ L L EIL E
Sbjct  335  FSWIDTIKDNYPPPVDAHMVASVMTVWNNIQPAYAANMWNEALNKRLGTQNLSLPEILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD W+YSDGKST+ VAFIL MYK++G+F  +A SIQVTEFTI+D
Sbjct  395  VEKRGSSFDELLTLPEQDYWLYSDGKSTSSVAFILEMYKQAGLFDPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL---HGTTHWSHM  262
            AYMLK +ENN  RLP WCN G+  KLPFCQI G+YRMEL   +    +SHM
Sbjct  455  AYMLKFFENNSCRLPKWCNDGDTVKLPFCQIKGKYRMELPEYNSMEPYSHM  505



>ref|XP_003519567.1| PREDICTED: uncharacterized protein LOC100789468 isoform X1 [Glycine 
max]
Length=519

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  332  FSWIDTLNENYPPPLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVE  391

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD+W+YSDGKST+C+AFIL MYKE+G+F  +A S+QVTEFTI+D
Sbjct  392  VEKRGSSFDELLTIPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPVASSVQVTEFTIKD  451

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +ENN TRLP WCN G+  KLP+CQI G+YRM+L G
Sbjct  452  AYILNFFENNSTRLPKWCNDGDTVKLPYCQIKGKYRMDLPG  492



>ref|NP_194432.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB36548.1| putative protein [Arabidopsis thaliana]
 emb|CAB79557.1| putative protein [Arabidopsis thaliana]
 gb|AAL75889.1| AT4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AAN28849.1| At4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AEE85285.1| uncharacterized protein AT4G27020 [Arabidopsis thaliana]
Length=523

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DA LV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  336  FSWIDTISGNYPPPLDAQLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  396  VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSGND--KLPFCQIVGEYRMELHG  283
            AYMLK +E+N +R P WCN  ND  KLP+CQI+G+YRMEL G
Sbjct  456  AYMLKFFESNASRFPKWCND-NDVVKLPYCQILGKYRMELPG  496



>ref|XP_008654687.1| PREDICTED: uncharacterized protein LOC100275589 isoform X1 [Zea 
mays]
 gb|ACR35704.1| unknown [Zea mays]
 gb|AFW84864.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=542

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  355  FSWIDTISDNYPPPLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVE  414

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LL++PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+D
Sbjct  415  SEKRGITFDKLLSVPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKD  474

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +E+N TRLP WCN  +D KLPFCQI G+YRMEL G
Sbjct  475  AYILNFFEDNSTRLPEWCNKDDDVKLPFCQIKGKYRMELPG  515



>ref|XP_010060409.1| PREDICTED: uncharacterized protein LOC104448324 [Eucalyptus grandis]
Length=523

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  336  FSWIDTIDANYPPPLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ SIQVTEFTI+D
Sbjct  396  TEMRGSSFAELLTIPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSIQVTEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN G++ +LPFCQI G YRMEL G
Sbjct  456  AYSLKFFENNSSRLPKWCNDGDNVELPFCQIRGRYRMELPG  496



>ref|XP_008226933.1| PREDICTED: uncharacterized protein LOC103326478 [Prunus mume]
Length=522

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 139/171 (81%), Gaps = 4/171 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI DNYPPPVDAH+V SVM++W  +QP YAANMWNEALNKRLGT+ L L +IL E
Sbjct  335  FSWIDTIKDNYPPPVDAHMVASVMTVWNNIQPAYAANMWNEALNKRLGTQNLSLPDILVE  394

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLT+PEQD W+YSDGKST+ VAFIL MYK++G+F  +A SIQVTEFTI+D
Sbjct  395  VEKRGSSFDELLTLPEQDYWLYSDGKSTSSVAFILEMYKQAGLFDPIASSIQVTEFTIKD  454

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL---HGTTHWSHM  262
            AYMLK +ENN  RLP WCN G+  KLPFCQI G+YRMEL   +    +SHM
Sbjct  455  AYMLKFFENNSCRLPKWCNDGDTVKLPFCQIKGKYRMELPEYNSVEPYSHM  505



>ref|XP_007142263.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
 gb|ESW14257.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
Length=544

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++ NYPPP+DA++V  VM++W ++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  357  FSWIDTLNGNYPPPLDANVVACVMTIWNQIQPEYAANMWNEALNKRLGTKGLDLPEVLVE  416

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD+WVY+DGKST+C+AFIL MYKE+G+FG +A S+QVTEFTI+D
Sbjct  417  VEKRGSSFDELLTIPEQDDWVYTDGKSTSCIAFILEMYKEAGLFGPIASSVQVTEFTIKD  476

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHGTTH---WSHM  262
            AY+L  +ENN +RLP WCN G+  KLP+CQI G+YR+EL G      +SHM
Sbjct  477  AYILNFFENNSSRLPKWCNDGDTVKLPYCQIKGKYRVELPGYNSMEPYSHM  527



>ref|XP_002280959.1| PREDICTED: uncharacterized protein LOC100267545 isoform X1 [Vitis 
vinifera]
 emb|CBI26614.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ +NYPPP+DAH+V SVM++W +M+P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  344  FSWIDTLDENYPPPLDAHVVASVMTVWNQMKPAYAANLWNEALNKRLGTQDLALPEILVE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE+RG +FD+LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG  A SIQVTEFTI+D
Sbjct  404  TEKRGSSFDELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPSASSIQVTEFTIKD  463

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMEL  289
            AY L  +ENN +RLP WCN G N +LP+CQI G+YRMEL
Sbjct  464  AYTLNFFENNSSRLPKWCNDGDNVQLPYCQIKGKYRMEL  502



>gb|KCW67034.1| hypothetical protein EUGRSUZ_F00801 [Eucalyptus grandis]
Length=390

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DA++V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L E
Sbjct  203  FSWIDTIDANYPPPLDAYVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVE  262

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ SIQVT+FTI+D
Sbjct  263  TEMRGSSFAELLTIPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSIQVTKFTIKD  322

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN G+D +LPFCQI G Y+MEL G
Sbjct  323  AYSLKFFENNSSRLPKWCNDGDDVELPFCQIQGRYQMELPG  363



>gb|ACN29289.1| unknown [Zea mays]
 gb|AFW84862.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=559

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  372  FSWIDTISDNYPPPLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVE  431

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LL++PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+D
Sbjct  432  SEKRGITFDKLLSVPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKD  491

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +E+N TRLP WCN  +D KLPFCQI G+YRMEL G
Sbjct  492  AYILNFFEDNSTRLPEWCNKDDDVKLPFCQIKGKYRMELPG  532



>ref|NP_001143111.1| uncharacterized protein LOC100275589 [Zea mays]
 gb|ACG29052.1| hypothetical protein [Zea mays]
Length=559

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  372  FSWIDTISDNYPPPLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVE  431

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LL++PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+D
Sbjct  432  SEKRGITFDKLLSVPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKD  491

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +E+N TRLP WCN  +D KLPFCQI G+YRMEL G
Sbjct  492  AYILNFFEDNSTRLPEWCNKDDDVKLPFCQIKGKYRMELPG  532



>ref|XP_007020905.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
 gb|EOY12430.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
Length=567

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W ++QP YAANMWNEALNKRLGTEGLDL +IL E
Sbjct  380  FSWIDTIDGNYPPPLDAHLVASVMTVWNKIQPEYAANMWNEALNKRLGTEGLDLSDILVE  439

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD LLTIPEQD W+YSDGKS +C+AF+L MYK +G+F  +A+SI+VTEFTI+D
Sbjct  440  VEKRGSSFDALLTIPEQDGWIYSDGKSASCIAFVLEMYKAAGLFDPIADSIEVTEFTIKD  499

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L+ +ENN ++LP WCN  +D KLP+CQI+G+YRMEL G
Sbjct  500  AYTLRFFENNSSQLPKWCNDADDVKLPYCQILGKYRMELPG  540



>ref|XP_002316997.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
 gb|EEE97609.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
Length=526

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYPPP+D+H+V SVM++W  MQP YAANMWNEALNKRLGT+GLDL ++L E
Sbjct  339  FSWIDTLDGNYPPPLDSHVVASVMTVWNHMQPEYAANMWNEALNKRLGTQGLDLPDVLVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  ++ S+QVTEFTI+D
Sbjct  399  VEKRGSSFGELLTIPEQDDWLYADGKSTSCIAFVLEMYKEAGLFDPISGSVQVTEFTIKD  458

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY L+ +ENN +RLP WCN G+D KLPFCQI G+YRMEL
Sbjct  459  AYTLRFFENNSSRLPKWCNDGDDVKLPFCQIKGKYRMEL  497



>ref|XP_011097895.1| PREDICTED: uncharacterized protein LOC105176701 [Sesamum indicum]
Length=533

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 6/189 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYP P+DAHLV SVM++WT+MQP YA NMWNEALNKRLG++ L L E+L E
Sbjct  346  FSWIDTISGNYPAPLDAHLVASVMTVWTQMQPAYAGNMWNEALNKRLGSQNLSLSEVLVE  405

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+WVY+DGKST+CVAF+  +YKE+G+FG LA SIQVTEFTI+D
Sbjct  406  VEKRGSSFGELLAIPEQDDWVYADGKSTSCVAFVFELYKEAGLFGKLASSIQVTEFTIKD  465

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHGTT---HWSHMPT*MRIALL  235
            AY LK +ENN +RLP+WCN  +  KLPFCQI G+YRMEL G      +SHM    R   L
Sbjct  466  AYSLKFFENNSSRLPTWCNDVDTVKLPFCQIRGKYRMELPGYNTMDPYSHMNE--RCPSL  523

Query  234  YPQAMRGLS  208
             P+  R L 
Sbjct  524  PPKYYRPLG  532



>ref|XP_011040240.1| PREDICTED: uncharacterized protein LOC105136541 [Populus euphratica]
Length=526

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYPPP+DAH+V S M++W  +QP YAANMWNEALNKRLGT+GLDL +IL E
Sbjct  339  FSWIDTLDGNYPPPLDAHVVASFMTVWNHIQPEYAANMWNEALNKRLGTQGLDLPDILVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  +  S+QVTEFTI+D
Sbjct  399  VEKRGSSFGKLLTIPEQDDWLYTDGKSTSCIAFVLEMYKEAGLFDPITSSVQVTEFTIKD  458

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY L+ +ENN +RLP WCN G+D KLPFCQI G+YRMEL
Sbjct  459  AYTLRFFENNSSRLPKWCNDGDDVKLPFCQIKGQYRMEL  497



>ref|XP_006346228.1| PREDICTED: uncharacterized protein LOC102585922 [Solanum tuberosum]
Length=527

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DA+LV SVM++W ++QP YAANMWNEALNKRLGT+ L L ++L E
Sbjct  340  FSWIDTIDGNYPSPLDANLVASVMTVWNQLQPAYAANMWNEALNKRLGTKNLSLPDVLVE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+WVYSDGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  400  VEKRGFSFAKLLAIPEQDDWVYSDGKSTSCVAFILEMYKEAGLFGELASSIQVTEFTIKD  459

Query  402  AYMLKIYENNQTRLPSWCNS-GNDKLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN+  N KLPFCQI G+YRMEL G
Sbjct  460  AYSLKFFENNSSRLPKWCNADDNVKLPFCQIRGKYRMELPG  500



>ref|XP_008454551.1| PREDICTED: uncharacterized protein LOC103494941 [Cucumis melo]
Length=537

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT   NYPPP+DAHLV SVM++WTR++PT AAN+WNEALN RLGT+GLDL EIL E
Sbjct  350  FSWIDTTHGNYPPPLDAHLVASVMTIWTRVRPTLAANLWNEALNIRLGTKGLDLPEILVE  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E++G +F +LL IPEQD+W+Y+DGKS +CVAFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  410  VEKQGSSFGELLAIPEQDDWIYADGKSASCVAFILQMYKEAGLFGPLASSIQVTEFTIKD  469

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  YENN TRLP WC+  +D KLP+CQI+G+YRM+L G
Sbjct  470  AYTLNFYENNSTRLPKWCHGRDDVKLPYCQILGKYRMDLQG  510



>ref|XP_006370687.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
 gb|ERP67256.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
Length=585

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYPPP+DAHLV S M++W  +QP YAANMWNEALNKRLGT+GLDL +IL E
Sbjct  398  FSWIDTLDGNYPPPLDAHLVASFMTVWNHIQPEYAANMWNEALNKRLGTQGLDLPDILVE  457

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  +  S+QVTEFTI+D
Sbjct  458  VEKRGSSFGKLLTIPEQDDWLYTDGKSTSCIAFVLEMYKEAGLFDPITSSVQVTEFTIKD  517

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY L+ +ENN +RLP WCN G+D KLPFCQI G+YRMEL
Sbjct  518  AYTLRFFENNSSRLPKWCNDGDDVKLPFCQIKGQYRMEL  556



>ref|XP_009769049.1| PREDICTED: uncharacterized protein LOC104219979 [Nicotiana sylvestris]
Length=526

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYP P+DAHLV SVM++W ++QP YAANMWNEALNKRLGT+GL L +IL E
Sbjct  339  FSWIDTLDGNYPSPLDAHLVASVMTVWNQLQPAYAANMWNEALNKRLGTQGLGLPDILVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  399  VEKRGSSFAKLLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPLAGSIQVTEFTIKD  458

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +EN+  RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  459  AYSLKFFENDPNRLPKWCNADDTVKLPFCQIRGKYRMELPG  499



>gb|KHN11935.1| hypothetical protein glysoja_019908 [Glycine soja]
Length=486

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++ NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  299  FSWIDTLNGNYPPPLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLPEVLVE  358

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD W YSDGKST+C+AFIL MYKE+G+F  ++ S+QVTEFTI+D
Sbjct  359  VEKRGSSFDELLTIPEQDYWTYSDGKSTSCIAFILEMYKEAGLFDPISSSVQVTEFTIKD  418

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +ENN +RLP WCN G+  KLP+CQI G+YRMEL G
Sbjct  419  AYILNFFENNSSRLPKWCNDGDTVKLPYCQIKGKYRMELPG  459



>ref|XP_001775460.1| predicted protein [Physcomitrella patens]
 gb|EDQ59789.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT +DNYPPP+D++LV S ++MWTR+QP +AANMWNEALNKRLGTEGLDL  ++ E
Sbjct  339  FSWIDTPTDNYPPPLDSNLVASAITMWTRLQPDFAANMWNEALNKRLGTEGLDLPGVMVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG++F++LL IPEQD W YSDG STTCVAFIL MYKE+G+FGS  +SIQVTEFTIRD
Sbjct  399  SEKRGISFEELLAIPEQDTWEYSDGFSTTCVAFILQMYKEAGLFGSFGDSIQVTEFTIRD  458

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLK++E++ +RLPSWCN+   K  FCQI+GEY ME+
Sbjct  459  AYMLKLFEDDVSRLPSWCNATEGKGSFCQILGEYEMEI  496



>ref|XP_004295816.2| PREDICTED: uncharacterized protein LOC101297130 [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYPPP+DAH+V SVM++W +++PTYAAN+WNEALNKRL T+ L   EIL E
Sbjct  349  FSWIDTVDGNYPPPLDAHVVASVMTVWDQIKPTYAANLWNEALNKRLETQNLSFPEILVE  408

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FDQLLT+PEQD+W+YSDGKST+CVAFIL MYKE+G+F  +  SIQVTEFTI+D
Sbjct  409  VEKRGSSFDQLLTVPEQDDWLYSDGKSTSCVAFILEMYKEAGLFDPIPSSIQVTEFTIKD  468

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYMLK +ENN +RLP WCN G+  KLPFCQI G+YRMEL
Sbjct  469  AYMLKFFENNSSRLPKWCNDGDTVKLPFCQIKGKYRMEL  507



>ref|XP_003564372.1| PREDICTED: uncharacterized protein LOC100827139 isoform X1 [Brachypodium 
distachyon]
Length=542

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAH+V SVM++W ++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  355  FSWIDTISHNYPPPLDAHVVASVMTVWNKLQPDYAANMWKEALNKRLGTKGLDLPEIIVE  414

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG TFD+LLTIPEQD+WVY+DG+S +CVA++L MYKE+G+F  ++ S++VTEFTI+D
Sbjct  415  SEKRGTTFDKLLTIPEQDKWVYTDGQSASCVAYVLMMYKEAGLFEPISSSVEVTEFTIKD  474

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  YE+N TRLP WCN  +  KLPFCQI G YRMEL G
Sbjct  475  AYVLNFYEDNTTRLPEWCNKDDSVKLPFCQIKGRYRMELPG  515



>ref|XP_003564373.1| PREDICTED: uncharacterized protein LOC100827139 isoform X2 [Brachypodium 
distachyon]
Length=535

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+DAH+V SVM++W ++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  348  FSWIDTISHNYPPPLDAHVVASVMTVWNKLQPDYAANMWKEALNKRLGTKGLDLPEIIVE  407

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG TFD+LLTIPEQD+WVY+DG+S +CVA++L MYKE+G+F  ++ S++VTEFTI+D
Sbjct  408  SEKRGTTFDKLLTIPEQDKWVYTDGQSASCVAYVLMMYKEAGLFEPISSSVEVTEFTIKD  467

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  YE+N TRLP WCN  +  KLPFCQI G YRMEL G
Sbjct  468  AYVLNFYEDNTTRLPEWCNKDDSVKLPFCQIKGRYRMELPG  508



>ref|XP_004151958.1| PREDICTED: uncharacterized protein LOC101214437 [Cucumis sativus]
 ref|XP_004158470.1| PREDICTED: uncharacterized LOC101214437 [Cucumis sativus]
 gb|KGN57971.1| hypothetical protein Csa_3G416640 [Cucumis sativus]
Length=536

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT   NYPPP+DAHLV SVM++WTR++PT AAN+WNEALN RLGT+GLDL EIL E
Sbjct  349  FSWIDTTHGNYPPPLDAHLVASVMTIWTRVRPTLAANLWNEALNIRLGTKGLDLPEILVE  408

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E++G +F +LL IPEQD+WVY+DGKS +CVAFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  409  VEKQGSSFGELLAIPEQDDWVYADGKSASCVAFILEMYKEAGLFGPLASSIQVTEFTIKD  468

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  YENN +RLP WC+  +D KLP+CQI+G+YRM+L G
Sbjct  469  AYSLNFYENNSSRLPKWCHGRDDVKLPYCQILGKYRMDLQG  509



>ref|XP_003544978.1| PREDICTED: uncharacterized protein LOC100796964 [Glycine max]
Length=525

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++ NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  338  FSWIDTLNGNYPPPLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLPEVLVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD W YSDGKST+C+AFIL MYKE+G+F  ++ S+QVTEFTI+D
Sbjct  398  VEKRGSSFDELLTIPEQDYWTYSDGKSTSCIAFILEMYKEAGLFDPISSSVQVTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY+L  +ENN +RLP WCN G+  KLP+CQI G+YRMEL G
Sbjct  458  AYILNFFENNSSRLPKWCNDGDTVKLPYCQIKGKYRMELPG  498



>ref|XP_009774573.1| PREDICTED: uncharacterized protein LOC104224588 [Nicotiana sylvestris]
Length=525

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHLV SVM++W ++QP YA+NMWNEALNKRLGT+ L L ++L E
Sbjct  338  FSWIDTIDGNYPSPLDAHLVASVMTVWNQLQPAYASNMWNEALNKRLGTQNLSLPDVLVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+WVYSDGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  398  VEKRGSSFAELLTIPEQDDWVYSDGKSTSCVAFILEMYKEAGLFGELASSIQVTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +E N +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  458  AYSLKFFETNSSRLPKWCNADDSVKLPFCQIRGKYRMELPG  498



>ref|XP_006644833.1| PREDICTED: uncharacterized protein LOC102706146 [Oryza brachyantha]
Length=540

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTISDNYPPP+DAH+V SVM+MW ++QP YAANMW EALNKRLGT+GLDL EI+ E
Sbjct  353  FSWIDTISDNYPPPLDAHVVASVMTMWNKLQPEYAANMWEEALNKRLGTKGLDLPEIIVE  412

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG TFD+LLTIPEQD+WVY+DG+S +CVA++L MYK++G+F  ++ SI+VTEFTI+D
Sbjct  413  SEKRGTTFDKLLTIPEQDKWVYTDGQSASCVAYVLMMYKDAGLFDPISNSIEVTEFTIKD  472

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L  +E+N TRLP WCN  +  +LPFCQI G YRMEL G
Sbjct  473  AYSLNFFEDNMTRLPVWCNKDDSVELPFCQIKGRYRMELPG  513



>ref|XP_011030808.1| PREDICTED: uncharacterized protein LOC105130143 [Populus euphratica]
Length=526

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYPPP+D+H+V SVM++W  MQP YAANMWNEALNKRLGT+GLDL ++L E
Sbjct  339  FSWIDTLDGNYPPPLDSHVVASVMTVWNHMQPEYAANMWNEALNKRLGTQGLDLPDVLVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+W+Y+DGKS +C+AF+L MYKE+G+F  ++ S+QVTEFTI+D
Sbjct  399  VEKRGSSFGELLAIPEQDDWLYADGKSASCIAFVLEMYKEAGLFDPISGSVQVTEFTIKD  458

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY L+ +ENN +RLP WCN G+D KLPFCQI G+YRMEL
Sbjct  459  AYTLRFFENNSSRLPKWCNDGDDVKLPFCQIKGKYRMEL  497



>ref|XP_011095372.1| PREDICTED: uncharacterized protein LOC105174849 [Sesamum indicum]
Length=533

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI+ NYP P+DAHLV SVM++WT++ P YA NMWNEALNKRLGT+ L L EI+ E
Sbjct  346  FSWIDTINGNYPAPLDAHLVASVMTVWTQLAPAYAGNMWNEALNKRLGTQNLSLSEIIVE  405

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD WVY+DGKST+CVAF+  MY+E+G+FG LA SIQVTEFTI+D
Sbjct  406  VEKRGSSFGELLAIPEQDNWVYADGKSTSCVAFVFEMYEEAGLFGELASSIQVTEFTIKD  465

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN G+  KLPFCQI G+YRMEL G
Sbjct  466  AYSLKFFENNSSRLPKWCNDGDTVKLPFCQIRGKYRMELPG  506



>dbj|BAJ95380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+GLDL EI+ E
Sbjct  354  FSWIDTISNNYPPPLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKGLDLPEIIVE  413

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LLTIPE+D+WVY+DG+S +CVA++L MYKE+G+F  ++ SI+VTEFTI+D
Sbjct  414  SEKRGMTFDKLLTIPEKDKWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIEVTEFTIKD  473

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHGTT---HWSHMPT*MRIALL  235
            AY+L  +E N TRLP+WCN  +  KLPFCQI G YRMEL G      ++HM    R A L
Sbjct  474  AYILNFFEANMTRLPAWCNKDDTVKLPFCQIKGRYRMELPGYNAMEQYAHMNE--RCASL  531

Query  234  YPQAMR  217
             P  +R
Sbjct  532  PPDYVR  537



>emb|CDM84540.1| unnamed protein product [Triticum aestivum]
Length=539

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 148/186 (80%), Gaps = 6/186 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+GLDL EI+ E
Sbjct  352  FSWIDTISNNYPPPLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKGLDLPEIIVE  411

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LLTIPE+D WVY+DG+S +CVA++L MYKE+G+F  ++ SI+VTEFTI+D
Sbjct  412  SEKRGMTFDKLLTIPEKDNWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIEVTEFTIKD  471

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHGTTH---WSHMPT*MRIALL  235
            AY+L  +E N TRLPSWCN  +  KLPFCQI G YRMEL G      ++HM    R A L
Sbjct  472  AYILNFFEANMTRLPSWCNKDDTVKLPFCQIKGRYRMELPGYNAMEPYAHMNE--RCASL  529

Query  234  YPQAMR  217
             P  +R
Sbjct  530  PPDYLR  535



>ref|XP_009599364.1| PREDICTED: uncharacterized protein LOC104095030 [Nicotiana tomentosiformis]
Length=526

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+  NYP P+DAHLV SVM++W ++QP YAANMWNEALNKRLGT+GLDL +IL E
Sbjct  339  FSWIDTLDGNYPSPLDAHLVASVMTVWNQLQPAYAANMWNEALNKRLGTQGLDLPDILVE  398

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG  A SIQVTEFTI+D
Sbjct  399  VEKRGSSFAKLLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPFAGSIQVTEFTIKD  458

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +E++  +LP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  459  AYSLKFFEDDPNQLPKWCNADDTVKLPFCQIRGKYRMELPG  499



>ref|XP_009607397.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
 ref|XP_009607398.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
Length=525

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHLV SVM++W ++QP YA+NMWNEALNKRLGT+ L L ++L E
Sbjct  338  FSWIDTIDGNYPSPLDAHLVASVMTVWNQLQPAYASNMWNEALNKRLGTQNLSLPDVLVE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPE+D+WVYSDGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+D
Sbjct  398  VEKRGSSFAELLTIPEKDDWVYSDGKSTSCVAFILEMYKEAGLFGELASSIQVTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +E N +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  458  AYSLKFFETNSSRLPKWCNADDSVKLPFCQIRGKYRMELPG  498



>ref|XP_010675677.1| PREDICTED: uncharacterized protein LOC104891653 [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSW+DTI+ NYPPP+DAHLV SVM++W  MQP YAAN+W EALNKRLGTE L+L EIL E
Sbjct  336  FSWVDTINMNYPPPLDAHLVASVMTIWYHMQPEYAANLWKEALNKRLGTEDLELPEILVE  395

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LLTIPEQD+W+Y DGKS +CVA++L +YK +G+FGSL  SIQ  EFTI+D
Sbjct  396  VEKRGSSFDELLTIPEQDDWIYEDGKSVSCVAYVLQIYKAAGLFGSLFSSIQANEFTIKD  455

Query  402  AYMLKIYENNQTRLPSWCNSG-NDKLPFCQIVGEYRMELHG  283
            AY LK +EN+ +RLPSWCN G N KLPFCQI G YRMEL G
Sbjct  456  AYSLKFFENDPSRLPSWCNDGDNVKLPFCQIRGRYRMELPG  496



>ref|XP_002965264.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
 gb|EFJ34102.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
Length=509

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT  DNYPP +D++LV SV+++WTR+QP YAANMWNEALNKRL T+GLDL  ++ E
Sbjct  322  FSWIDTPVDNYPPQLDSNLVASVLTVWTRLQPEYAANMWNEALNKRLDTQGLDLPGVMRE  381

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E RG+ F++LL IPE+D+W+YSDGKST+CVAF+L MYKE+G+FG LA SIQVTEFTIRD
Sbjct  382  AEHRGIPFEELLAIPEKDDWIYSDGKSTSCVAFVLQMYKEAGLFGELASSIQVTEFTIRD  441

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYML  +E N +RLP WCN+ +D  LPFCQI+G YRMEL
Sbjct  442  AYMLSFFEKNSSRLPKWCNAHDDPPLPFCQILGTYRMEL  480



>ref|XP_004244131.1| PREDICTED: uncharacterized protein LOC101251602 [Solanum lycopersicum]
Length=527

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DA+LV SVM++W  +QP YAANMWNEALNKRLGT+ L L +IL E
Sbjct  340  FSWIDTIDGNYPSPLDANLVASVMTVWNHLQPAYAANMWNEALNKRLGTKNLSLPDILVE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPE+D+WVYSDGKST+CVAFIL MYKE+G+FG  A SIQVTEFTI+D
Sbjct  400  VEKRGFSFAKLLAIPEKDDWVYSDGKSTSCVAFILEMYKEAGLFGEFASSIQVTEFTIKD  459

Query  402  AYMLKIYENNQTRLPSWCNS-GNDKLPFCQIVGEYRMEL  289
            AY LK +ENN +RLP WCN+  N  LPFCQI GEYRMEL
Sbjct  460  AYSLKFFENNSSRLPKWCNADDNVSLPFCQIRGEYRMEL  498



>ref|XP_002986592.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
 gb|EFJ12449.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
Length=509

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT  DNYPP +D++LV SV+++WTR+QP YAANMWNEALNKRL T+GLDL  ++ E
Sbjct  322  FSWIDTPVDNYPPQLDSNLVASVLTVWTRLQPEYAANMWNEALNKRLDTQGLDLPGVMRE  381

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E RG+ F++LL IPE+D+W+YSDGKST+CVAF+L MYKE+G+FG LA SIQVTEFTIRD
Sbjct  382  AEHRGIPFEELLAIPEKDDWIYSDGKSTSCVAFVLQMYKEAGLFGELASSIQVTEFTIRD  441

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AYML  +E N +RLP WCN+ +D  LPFCQI+G YRMEL
Sbjct  442  AYMLSFFEKNSSRLPKWCNAHDDPPLPFCQILGTYRMEL  480



>gb|EMT03744.1| hypothetical protein F775_19554 [Aegilops tauschii]
Length=637

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 147/186 (79%), Gaps = 6/186 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS+NYPPP+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+GLDL EI+ E
Sbjct  450  FSWIDTISNNYPPPLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKGLDLPEIIVE  509

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +E+RG+TFD+LLTIPE+D WVY+DG+S +CVA++L MYKE+G+F  ++ SI VTEFTI+D
Sbjct  510  SEKRGMTFDKLLTIPEKDNWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIDVTEFTIKD  569

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHGTTH---WSHMPT*MRIALL  235
            AY+L  +E N TRLPSWCN  +  KLPFCQI G YRMEL G      ++HM    R A L
Sbjct  570  AYILNFFEANMTRLPSWCNKDDTVKLPFCQIKGRYRMELPGYNAMEPYAHMNE--RCASL  627

Query  234  YPQAMR  217
             P  +R
Sbjct  628  PPDYVR  633



>ref|XP_004244132.1| PREDICTED: uncharacterized protein LOC101251905 [Solanum lycopersicum]
Length=528

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPPVDAHLV SVM++W ++ P Y +N+WNEALNKRLGT+ L L +IL E
Sbjct  341  FSWIDTIDGNYPPPVDAHLVASVMTVWNQIAPEYGSNLWNEALNKRLGTQNLSLPDILVE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+WVYSDGKS +CVAFIL MYKE G+FG LA SIQVTEFTI+D
Sbjct  401  VEKRGSSFAKLLAIPEQDDWVYSDGKSASCVAFILEMYKEGGLFGELANSIQVTEFTIKD  460

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L ++ENN +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  461  AYTLNLFENNSSRLPKWCNADDTMKLPFCQIRGKYRMELPG  501



>ref|XP_006346229.1| PREDICTED: uncharacterized protein LOC102586255 [Solanum tuberosum]
Length=528

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPPVDAHLV SVM++W ++ P Y +N+WNEALNKRLGT+ L L  IL E
Sbjct  341  FSWIDTIDGNYPPPVDAHLVASVMTVWNQIAPEYGSNLWNEALNKRLGTQNLSLPNILVE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+WVYSDGKS +CVAFIL MYKE G+FG  A SIQVTEFTIRD
Sbjct  401  VEKRGSSFAKLLAIPEQDDWVYSDGKSASCVAFILEMYKEGGLFGEFANSIQVTEFTIRD  460

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L ++ENN +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  461  AYTLNLFENNSSRLPKWCNADDTVKLPFCQIRGKYRMELPG  501



>ref|XP_010930250.1| PREDICTED: uncharacterized protein LOC105051475 isoform X1 [Elaeis 
guineensis]
Length=542

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+D+HLV S M++W+ +QP YAAN+WNEALN RLGTEGLDL  I+ E
Sbjct  355  FSWIDTISGNYPPPLDSHLVASAMTVWSNIQPAYAANLWNEALNLRLGTEGLDLPAIMVE  414

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G++FD+LLT+PEQD+WVYSDGKS +C+AF+L MYKE+G+F  +A +IQVTEFTI+D
Sbjct  415  AEKLGISFDKLLTVPEQDDWVYSDGKSASCIAFVLVMYKEAGLFDPIAANIQVTEFTIKD  474

Query  402  AYMLKIYENNQTRLPSWCNS-GNDKLPFCQIVGEYRMEL  289
            AY LK +ENN + LP WCN   N KLP+CQI+G YRMEL
Sbjct  475  AYTLKFFENNSSHLPEWCNKDDNVKLPYCQILGRYRMEL  513



>ref|XP_008812430.1| PREDICTED: uncharacterized protein LOC103723322 [Phoenix dactylifera]
Length=537

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYP P+D+HLV S M+MW ++QP YAAN+WNEALNKRLGTEGLDL  I+ E
Sbjct  350  FSWIDTISGNYPSPLDSHLVASAMTMWNKLQPAYAANLWNEALNKRLGTEGLDLPAIMVE  409

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G++FD+LLT+PE D WVYSDGKS +C+ FILAMYK++G+F  +A +IQVTEFTI+D
Sbjct  410  AEKLGISFDKLLTVPEHDNWVYSDGKSASCIVFILAMYKDAGLFDPIASNIQVTEFTIKD  469

Query  402  AYMLKIYENNQTRLPSWCNS-GNDKLPFCQIVGEYRMEL  289
            AY L  +E+N +RLP WCN   N KLPFCQI+G YRMEL
Sbjct  470  AYTLNFFESNSSRLPEWCNKDDNVKLPFCQIMGRYRMEL  508



>emb|CDP05764.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QPTYAAN+WNEALNKRLGT+GL L EIL E
Sbjct  340  FSWIDTIEGNYPPPLDAHLVASVMTVWSQLQPTYAANLWNEALNKRLGTQGLGLPEILVE  399

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPE+D W Y DGKS +CVAF+L MYKE+G+FG L  SI+VTEFTI+D
Sbjct  400  VEKRGSSFAELLAIPERDNWTYVDGKSASCVAFVLEMYKEAGIFGELGNSIEVTEFTIKD  459

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY L I+EN+ + LP WC  G+  +LPFCQI G+YRMEL G
Sbjct  460  AYSLNIFENDSSHLPQWCKDGDTVELPFCQIRGKYRMELPG  500



>gb|EMS65818.1| hypothetical protein TRIUR3_10678 [Triticum urartu]
Length=353

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  526
            V++ MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++ETERRG++F+QLLTIPEQDE
Sbjct  186  VMAAMSMWTRLQPHYASNMWNEALNKRLGTEQLDLHGIISETERRGMSFNQLLTIPEQDE  245

Query  525  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  346
            W YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAY L+I+E+N+TRLP WCN
Sbjct  246  WEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYTLRIFEDNRTRLPGWCN  305

Query  345  SGNDKLPFCQIVGEYRMEL  289
               D LPFCQI+GEY+MEL
Sbjct  306  GDADGLPFCQILGEYKMEL  324


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT++PYANMNENCPS PP+Y RP+ C
Sbjct  325  PEYNTIQPYANMNENCPSSPPTYSRPLRC  353



>ref|XP_010092131.1| hypothetical protein L484_017819 [Morus notabilis]
 gb|EXB50282.1| hypothetical protein L484_017819 [Morus notabilis]
Length=624

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+WIDT++ NYPPP+DAH V SVM++W ++QP+YAAN+WNEALNKRLGTEGLDL  IL E
Sbjct  365  FAWIDTVNGNYPPPLDAHAVASVMTVWNQIQPSYAANLWNEALNKRLGTEGLDLPSILVE  424

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE++GL+FD+LLTIPEQD+W+Y+DGKST+C+AF+L MYK +G+F  +A SIQVTEFTI+D
Sbjct  425  TEKQGLSFDKLLTIPEQDDWLYADGKSTSCIAFVLEMYKAAGLFDPIASSIQVTEFTIKD  484

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY LK ++++ +R P WCN  +D KLP+CQI+G  R EL
Sbjct  485  AYTLKFFDDDLSRQPKWCNDADDVKLPYCQILGNKRAEL  523



>ref|XP_009614697.1| PREDICTED: uncharacterized protein LOC104107565 isoform X2 [Nicotiana 
tomentosiformis]
Length=528

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHLV SVM+++ +++P YA+N+WNEALNKRLGT+ L L  IL E
Sbjct  341  FSWIDTIDGNYPSPLDAHLVASVMTVFNQLKPAYASNLWNEALNKRLGTQNLSLPNILVE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LLTIPEQD+W YSDGKS +CVA+IL MYKE G+FG LA SIQVTEFTI+D
Sbjct  401  VEKRGSSFAELLTIPEQDDWDYSDGKSASCVAYILEMYKEGGLFGELASSIQVTEFTIKD  460

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  461  AYTLKFFENNSSRLPKWCNADDSVKLPFCQIRGKYRMELPG  501



>ref|XP_002278686.1| PREDICTED: uncharacterized protein LOC100241838 isoform X3 [Vitis 
vinifera]
Length=524

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  338  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+D
Sbjct  398  TETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AY L  +EN+ +RLP WCN G+   P+CQI G+YRMEL
Sbjct  458  AYTLSFFENDSSRLPKWCNDGDIVQPYCQIKGKYRMEL  495



>ref|XP_009801187.1| PREDICTED: uncharacterized protein LOC104246940 isoform X1 [Nicotiana 
sylvestris]
Length=528

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHL+ SVM+++ +++P YA+N+WNEALNKRLGT+ L L  IL E
Sbjct  341  FSWIDTIDGNYPSPLDAHLIASVMTVFNQLKPAYASNLWNEALNKRLGTQNLSLPNILVE  400

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F +LL IPEQD+WVYSDGKS +CVA+I+ MYKE G+FG LA SIQVTEFTI+D
Sbjct  401  VEKRGSSFAELLIIPEQDDWVYSDGKSASCVAYIMEMYKEGGLFGELASSIQVTEFTIKD  460

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AY LK +ENN +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  461  AYTLKFFENNSSRLPKWCNADDTVKLPFCQIRGKYRMELPG  501



>ref|XP_010644425.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644426.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644427.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
Length=545

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  338  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+D
Sbjct  398  TETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AY L  +EN+ +RLP WCN G+   P+CQI G+YRMEL
Sbjct  458  AYTLSFFENDSSRLPKWCNDGDIVQPYCQIKGKYRMEL  495



>emb|CBI26611.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  383  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIE  442

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+D
Sbjct  443  TETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKD  502

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AY L  +EN+ +RLP WCN G+   P+CQI G+YRMEL
Sbjct  503  AYTLSFFENDSSRLPKWCNDGDIVQPYCQIKGKYRMEL  540



>ref|XP_001781611.1| predicted protein [Physcomitrella patens]
 gb|EDQ53567.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT + NYP P+D +LV S +++WTR+QP YA+NMWNEALNKRLGT+GLDL  ++ E
Sbjct  320  FSWIDTPNANYPAPLDCNLVASAITVWTRLQPDYASNMWNEALNKRLGTKGLDLPGVMVE  379

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TER+G+ F++LL IPE+D W YSDG ST+CVAF+L +YK++G+FGS+A+S+QVTEFT+RD
Sbjct  380  TERQGIPFEELLAIPEKDNWKYSDGYSTSCVAFVLEIYKQAGLFGSVADSVQVTEFTVRD  439

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
            AYMLK YE++++RLP+WC + N    +CQI+GEY MEL G
Sbjct  440  AYMLKFYEDDKSRLPAWCGTSNTSRTYCQILGEYDMELPG  479


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNE CPSLPPSY+RP  C
Sbjct  478  PGYNTIEPYANMNERCPSLPPSYDRPAQC  506



>gb|EMT12587.1| hypothetical protein F775_11937 [Aegilops tauschii]
Length=453

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 6/145 (4%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTE------GLDLYEILAETERRGLTFDQLLT  544
            V++ MSMWTR+QP YA+NMWNEALNKRLGTE       LDL+ I++ETERRG++F+QLLT
Sbjct  280  VMAAMSMWTRLQPHYASNMWNEALNKRLGTERTEKLTQLDLHGIISETERRGMSFNQLLT  339

Query  543  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  364
            IPEQDEW YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAYML+I+E+N+TR
Sbjct  340  IPEQDEWEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNRTR  399

Query  363  LPSWCNSGNDKLPFCQIVGEYRMEL  289
            LP WCN   D LPFCQI+GEY+MEL
Sbjct  400  LPGWCNGDADGLPFCQILGEYKMEL  424


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT++PYANMNENCPS PP+Y+RP+ C
Sbjct  425  PEYNTIQPYANMNENCPSSPPTYDRPLRC  453



>ref|XP_009614695.1| PREDICTED: uncharacterized protein LOC104107565 isoform X1 [Nicotiana 
tomentosiformis]
Length=533

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 132/166 (80%), Gaps = 6/166 (4%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE-----GLDLY  598
            FSWIDTI  NYP P+DAHLV SVM+++ +++P YA+N+WNEALNKRLGT+      L L 
Sbjct  341  FSWIDTIDGNYPSPLDAHLVASVMTVFNQLKPAYASNLWNEALNKRLGTQQMLMQNLSLP  400

Query  597  EILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTE  418
             IL E E+RG +F +LLTIPEQD+W YSDGKS +CVA+IL MYKE G+FG LA SIQVTE
Sbjct  401  NILVEVEKRGSSFAELLTIPEQDDWDYSDGKSASCVAYILEMYKEGGLFGELASSIQVTE  460

Query  417  FTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            FTI+DAY LK +ENN +RLP WCN+ +  KLPFCQI G+YRMEL G
Sbjct  461  FTIKDAYTLKFFENNSSRLPKWCNADDSVKLPFCQIRGKYRMELPG  506



>gb|EMS49816.1| hypothetical protein TRIUR3_06457 [Triticum urartu]
Length=589

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 138/195 (71%), Gaps = 35/195 (18%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE----------  613
            FSWIDTIS+NYPPP+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+          
Sbjct  286  FSWIDTISNNYPPPLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKVVPGPSFGSS  345

Query  612  ------------------------GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGK  505
                                    GLDL EI+ E+E+RG+TFD+LLTIPE+D WVY+DG+
Sbjct  346  IHLADSLVCDNKLLCDHNPAGMDNGLDLPEIIVESEKRGMTFDKLLTIPEKDNWVYTDGQ  405

Query  504  STTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KL  328
            S +CVA++L MYKE+G+F  ++ SI+VTEFTI+DAY+L  +E N TRLPSWCN  +  KL
Sbjct  406  SASCVAYVLMMYKEAGLFEPISSSIEVTEFTIKDAYILNFFEANMTRLPSWCNKDDTVKL  465

Query  327  PFCQIVGEYRMELHG  283
            PFCQI G YRMEL G
Sbjct  466  PFCQIKGRYRMELPG  480



>ref|XP_008454552.1| PREDICTED: uncharacterized protein LOC103494942 [Cucumis melo]
Length=538

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 8/175 (5%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT   N+P P+DAH+V S M++W +MQP++A  +WNEALNKRLGT+GL+L E+L E
Sbjct  348  FSWIDTTHGNFPSPLDAHMVASAMTIWNQMQPSFAGKLWNEALNKRLGTKGLELAEVLVE  407

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E++G +F +LL IPEQDEW YSDGKS TCVA ++ +YK +G+FG L  SIQ TEFT++D
Sbjct  408  VEKKGSSFGELLAIPEQDEWTYSDGKSATCVALVVEIYKVAGLFGPLTSSIQATEFTVKD  467

Query  402  AYMLKIYENNQTRLPSWCNSGND-----KLPFCQIVGEYRMEL--HGTTH-WSHM  262
            AY LK YE+N +RLP WCN G D     +LP+CQI+G YRMEL  + T H + HM
Sbjct  468  AYTLKFYEDNLSRLPKWCNDGGDNYENKQLPYCQILGNYRMELPDYNTIHPYQHM  522



>ref|XP_004158483.1| PREDICTED: uncharacterized LOC101212346 [Cucumis sativus]
Length=438

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT   N+P P+DAH+V S M++W +MQP++A  +WNEALNKRLGT+GL+L EIL E
Sbjct  248  FSWIDTTQGNFPSPLDAHMVASAMTIWNQMQPSFAGKLWNEALNKRLGTKGLELAEILVE  307

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E++G +F +LL IPEQD W YSDGKS TCVA ++ +YK +G+FG L  SIQ TEFT++D
Sbjct  308  VEKQGSSFGELLAIPEQDVWTYSDGKSATCVALVVEIYKVAGLFGPLTSSIQATEFTVKD  367

Query  402  AYMLKIYENNQTRLPSWCNSGND-----KLPFCQIVGEYRMEL--HGTTH-WSHM  262
            AY LK YE+N +RLP WCN G D     +LP+CQI+G YRMEL  + T H + HM
Sbjct  368  AYTLKFYEDNLSRLPKWCNDGGDNYENKQLPYCQILGNYRMELPDYNTIHPYQHM  422



>ref|XP_004152029.1| PREDICTED: uncharacterized protein LOC101212346 [Cucumis sativus]
 gb|KGN57972.1| hypothetical protein Csa_3G416650 [Cucumis sativus]
Length=527

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT   N+P P+DAH+V S M++W +MQP++A  +WNEALNKRLGT+GL+L EIL E
Sbjct  337  FSWIDTTQGNFPSPLDAHMVASAMTIWNQMQPSFAGKLWNEALNKRLGTKGLELAEILVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E++G +F +LL IPEQD W YSDGKS TCVA ++ +YK +G+FG L  SIQ TEFT++D
Sbjct  397  VEKQGSSFGELLAIPEQDVWTYSDGKSATCVALVVEIYKVAGLFGPLTSSIQATEFTVKD  456

Query  402  AYMLKIYENNQTRLPSWCNSGND-----KLPFCQIVGEYRMEL--HGTTH-WSHM  262
            AY LK YE+N +RLP WCN G D     +LP+CQI+G YRMEL  + T H + HM
Sbjct  457  AYTLKFYEDNLSRLPKWCNDGGDNYENKQLPYCQILGNYRMELPDYNTIHPYQHM  511



>ref|XP_010644428.1| PREDICTED: uncharacterized protein LOC100241838 isoform X2 [Vitis 
vinifera]
Length=538

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  338  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            TE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+D
Sbjct  398  TETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKD  457

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELH  286
            AY L  +EN+ +RLP WCN G+   P+CQI       L+
Sbjct  458  AYTLSFFENDSSRLPKWCNDGDIVQPYCQIKASISASLY  496



>emb|CAN60720.1| hypothetical protein VITISV_022056 [Vitis vinifera]
Length=555

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 130/189 (69%), Gaps = 31/189 (16%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE----------  613
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+          
Sbjct  338  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQTALGIWDLAF  397

Query  612  ---------------------GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTT  496
                                  L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+
Sbjct  398  KDPPKYPRSDVDIIMADLKNQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTS  457

Query  495  CVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQ  316
            CVAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +RLP WCN G+   P+CQ
Sbjct  458  CVAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSRLPKWCNDGDIVQPYCQ  517

Query  315  IVGEYRMEL  289
            I G+YRMEL
Sbjct  518  IKGKYRMEL  526



>gb|KCW67120.1| hypothetical protein EUGRSUZ_F00901 [Eucalyptus grandis]
Length=368

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 129/171 (75%), Gaps = 11/171 (6%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE----------  613
            FSWI TI+ NYPP +DAH+V SVM++  +MQP YAANMWNEALNKRLGTE          
Sbjct  164  FSWIGTINANYPPLLDAHVVASVMTVCNQMQPAYAANMWNEALNKRLGTEVPSYSICNCL  223

Query  612  GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAES  433
              DL +++ +TE RG +F +LLTIPEQD+WVYSDG+S +CVAF+L +YK + +F  ++ S
Sbjct  224  AWDLPDLIVKTEMRGSSFAELLTIPEQDDWVYSDGRSASCVAFVLEIYKAARLFDPISRS  283

Query  432  IQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            IQVTEFTI+DAY L+ +ENN +RLP WCN G+D +  FCQI G YRMEL G
Sbjct  284  IQVTEFTIKDAYSLRFFENNSSRLPKWCNDGDDVEFLFCQIRGRYRMELPG  334



>ref|XP_006438500.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 gb|ESR51740.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=473

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPPP+DAHLV+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E
Sbjct  332  FSWIDTMADNYPPPLDAHLVVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDE  391

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  409
             E+RG++FDQLLTIPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFT+
Sbjct  392  IEKRGISFDQLLTIPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTV  449



>ref|XP_010272087.1| PREDICTED: uncharacterized protein LOC104607980 isoform X2 [Nelumbo 
nucifera]
Length=500

 Score =   205 bits (522),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 117/158 (74%), Gaps = 31/158 (20%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ +NYPPP+DAHL                               GLDL  ILAE
Sbjct  345  FSWIDTMDENYPPPLDAHL-------------------------------GLDLPGILAE  373

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            +ERRG++FDQLL IPEQDEWVYSDGKSTTCVAFIL MYKE+G+F  ++ SIQVTEFTIRD
Sbjct  374  SERRGISFDQLLIIPEQDEWVYSDGKSTTCVAFILEMYKEAGIFYPISSSIQVTEFTIRD  433

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYMLKI+ENN+TRLPSWC++ + +LPFCQI+GEY+MEL
Sbjct  434  AYMLKIFENNRTRLPSWCSNADGELPFCQILGEYQMEL  471


 Score = 57.0 bits (136),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYANMNENCPSLPP+YERP+ C
Sbjct  472  PQYNTIEPYANMNENCPSLPPTYERPVRC  500



>ref|XP_009419909.1| PREDICTED: uncharacterized protein LOC103999784 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   206 bits (524),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 117/158 (74%), Gaps = 31/158 (20%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+DA+L                                LDL+EI+ E
Sbjct  351  FSWIDTVAENYPPPLDANL-------------------------------DLDLHEIIVE  379

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
            T+R+G+TFDQLLT+PEQDEW+YSDGKSTTCVAF+L +YKE+G+ G LA SIQVTEFTIRD
Sbjct  380  TQRQGMTFDQLLTMPEQDEWIYSDGKSTTCVAFVLELYKEAGILGPLANSIQVTEFTIRD  439

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            AYML I+ENNQTRLPSWCN+  +KLPFCQI+G YRMEL
Sbjct  440  AYMLNIFENNQTRLPSWCNALEEKLPFCQILGYYRMEL  477


 Score = 50.4 bits (119),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA+MNENCPSLPP+Y RP  C
Sbjct  478  PQYNTIEPYAHMNENCPSLPPAYTRPERC  506



>ref|XP_002878755.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55014.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score =   184 bits (468),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -2

Query  633  NKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGV  454
            NKRLGTE L+L  IL ET RRG++FD+LLTIPEQDEWVYSDGKST+CVAFILAMYK +GV
Sbjct  1    NKRLGTEDLNLCGILEETARRGISFDELLTIPEQDEWVYSDGKSTSCVAFILAMYKAAGV  60

Query  453  FGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRME  292
            FG LA  IQV EFTIRDAY  K++E+NQTRLPSWCN+  +KL FC I+GEYRME
Sbjct  61   FGPLANHIQVIEFTIRDAYTPKLFESNQTRLPSWCNTEEEKLDFCHILGEYRME  114



>gb|EYU33635.1| hypothetical protein MIMGU_mgv1a018256mg, partial [Erythranthe 
guttata]
Length=505

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYP P+DAHLV SVM++WT+MQP YA NMWNEALNKRLGT+   L ++L E
Sbjct  376  FSWIDTIDGNYPEPLDAHLVASVMTVWTQMQPAYAGNMWNEALNKRLGTQNFSLSQVLVE  435

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +F  LL  PEQD WVY+DGKS +CV F+  MYKE+G+FG L  SIQ +EFTI+D
Sbjct  436  VEKRGSSFGALLAAPEQDNWVYADGKSASCVVFVFEMYKEAGLFGKLGSSIQASEFTIKD  495

Query  402  AYMLKIYENN  373
            AY LK +ENN
Sbjct  496  AYSLKFFENN  505



>gb|KJB62764.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=460

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL+L +IL E
Sbjct  337  FSWIDTIGGNYPPPLDAHLVASVMTVWSKIQPEYAANMWNEALNKRLGTQGLNLSDILVE  396

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  412
            TE+RG +FD+LLTIPEQD W+YSDGKST+C+AF+L +YKE+G+F  +A+SIQVTEFT
Sbjct  397  TEKRGSSFDELLTIPEQDNWIYSDGKSTSCIAFVLELYKEAGLFDPIADSIQVTEFT  453



>gb|KCW67102.1| hypothetical protein EUGRSUZ_F00885 [Eucalyptus grandis]
Length=484

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  526
            V SVM++W +MQP YAANMWNEALNKRLGTE         ETE RG +F +LLTIPEQD+
Sbjct  326  VASVMTVWNQMQPAYAANMWNEALNKRLGTEVPSHSIGNLETEMRGSSFAELLTIPEQDD  385

Query  525  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  346
            WVYSDGKS +CV F+L MYK +G F  ++ SIQVTEFTI+DAY LK +ENN +RLP WCN
Sbjct  386  WVYSDGKSASCVVFVLEMYKAAGRFDPISSSIQVTEFTIKDAYSLKFFENNSSRLPKWCN  445

Query  345  SGND-KLPFCQIVGEYRMELHG  283
             G++ +LPFCQI G Y+MEL G
Sbjct  446  DGDNVELPFCQIRGRYQMELPG  467



>gb|KCW67113.1| hypothetical protein EUGRSUZ_F00893 [Eucalyptus grandis]
Length=496

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 110/142 (77%), Gaps = 13/142 (9%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  526
            V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+
Sbjct  340  VASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDD  399

Query  525  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  346
            WVYSDGKS +CVAF+L +            SIQVTEFTI+DAY LK +ENN +RLP W N
Sbjct  400  WVYSDGKSASCVAFVLEI------------SIQVTEFTIKDAYSLKFFENNSSRLPKWSN  447

Query  345  SGND-KLPFCQIVGEYRMELHG  283
             G+D +LPFCQI G YRMEL G
Sbjct  448  DGDDVELPFCQIQGRYRMELPG  469



>ref|XP_006575675.1| PREDICTED: uncharacterized protein LOC100789468 isoform X2 [Glycine 
max]
Length=464

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+++NYPPP+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E
Sbjct  332  FSWIDTLNENYPPPLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVE  391

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  409
             E+RG +FD+LLTIPEQD+W+YSDGKST+C+AFIL MYKE+G+F  +A S+QVTEFTI
Sbjct  392  VEKRGSSFDELLTIPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPVASSVQVTEFTI  449



>ref|XP_010644433.1| PREDICTED: uncharacterized protein LOC100267545 isoform X2 [Vitis 
vinifera]
Length=468

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT+ +NYPPP+DAH+V SVM++W +M+P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  344  FSWIDTLDENYPPPLDAHVVASVMTVWNQMKPAYAANLWNEALNKRLGTQDLALPEILVE  403

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  412
            TE+RG +FD+LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG  A SIQVTEFT
Sbjct  404  TEKRGSSFDELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPSASSIQVTEFT  460



>gb|KDO82634.1| hypothetical protein CISIN_1g0101752mg, partial [Citrus sinensis]
Length=123

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = -2

Query  705  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  526
            V+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDE
Sbjct  1    VVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDE  60

Query  525  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  409
            WVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFT+
Sbjct  61   WVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTV  99



>gb|ACF81787.1| unknown [Zea mays]
Length=122

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  567  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  388
            ++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLK
Sbjct  1    MSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLK  60

Query  387  IYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            I+E+N  RLP WCN+G DKLPFCQI+GEYRMEL
Sbjct  61   IFEDNPARLPGWCNAGTDKLPFCQILGEYRMEL  93


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+EPYA MNENCPSLPP+Y+RP  C
Sbjct  94   PEYNTIEPYAKMNENCPSLPPTYKRPARC  122



>ref|XP_002872148.1| hypothetical protein ARALYDRAFT_351537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48407.1| hypothetical protein ARALYDRAFT_351537 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -2

Query  615  EGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAE  436
            + L+L  IL E  RRG++FD+LLTIPEQDEWVYSDGKST CVAFILAMYK +GVFG LA 
Sbjct  34   QDLNLCGILEEIARRGMSFDELLTIPEQDEWVYSDGKSTACVAFILAMYKAAGVFGPLAN  93

Query  435  SIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
             IQVTEFTIRDAY  K++E+NQTRLPSWCN+  +KL FCQI+GEYRMEL
Sbjct  94   HIQVTEFTIRDAYTPKLFESNQTRLPSWCNTEEEKLDFCQILGEYRMEL  142



>ref|XP_010930259.1| PREDICTED: uncharacterized protein LOC105051475 isoform X2 [Elaeis 
guineensis]
Length=511

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 108/159 (68%), Gaps = 32/159 (20%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTIS NYPPP+D+HL                               GLDL  I+ E
Sbjct  355  FSWIDTISGNYPPPLDSHL-------------------------------GLDLPAIMVE  383

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+ G++FD+LLT+PEQD+WVYSDGKS +C+AF+L MYKE+G+F  +A +IQVTEFTI+D
Sbjct  384  AEKLGISFDKLLTVPEQDDWVYSDGKSASCIAFVLVMYKEAGLFDPIAANIQVTEFTIKD  443

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  289
            AY LK +ENN + LP WCN  ++ KLP+CQI+G YRMEL
Sbjct  444  AYTLKFFENNSSHLPEWCNKDDNVKLPYCQILGRYRMEL  482



>ref|XP_010644430.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644431.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644432.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
Length=467

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  338  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  412
            TE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFT
Sbjct  398  TETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFT  454



>ref|XP_010644429.1| PREDICTED: uncharacterized protein LOC100241838 isoform X4 [Vitis 
vinifera]
Length=505

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWID + +NYPPP+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL E
Sbjct  338  FSWIDALDENYPPPLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIE  397

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  412
            TE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFT
Sbjct  398  TETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFT  454



>gb|KCW67105.1| hypothetical protein EUGRSUZ_F00888 [Eucalyptus grandis]
Length=296

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 21/138 (15%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE----------  613
            FSWIDTI  NYPPP+DAH+V SVM++W +MQP YAANMWNEALNKRLGTE          
Sbjct  146  FSWIDTIDANYPPPLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTELPSHSICNCL  205

Query  612  -----------GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYK  466
                       GLDL +++ ETE RG +F +LLTIP+QD+WVYSDGKST+CV F+L M K
Sbjct  206  CDIMHLVLHTEGLDLLDLMVETEMRGSSFAELLTIPKQDDWVYSDGKSTSCVVFVLQMDK  265

Query  465  ESGVFGSLAESIQVTEFT  412
             +G+F  ++ SIQVTEFT
Sbjct  266  AAGLFDPISSSIQVTEFT  283



>gb|KCW66790.1| hypothetical protein EUGRSUZ_F00555 [Eucalyptus grandis]
Length=255

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
              WIDTI  NYPPP+DA +V SVM++W +MQP  A NMWNEALNK+LGT+GLDL +++ E
Sbjct  134  LRWIDTIDANYPPPLDARVVASVMTVWNQMQPACAPNMWNEALNKQLGTKGLDLPDLIVE  193

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  409
             E RG +F +LLTIPEQD+WVY+DGKST+CVAF+L +YK +G+F  ++ SIQVT+FT+
Sbjct  194  REMRGPSFAELLTIPEQDDWVYNDGKSTSCVAFVLEIYKAAGLFDPISSSIQVTKFTV  251



>ref|XP_010445105.1| PREDICTED: uncharacterized protein LOC104727725 [Camelina sativa]
Length=131

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = -2

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  4    VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  63

Query  402  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMEL G
Sbjct  64   AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPG  104



>ref|XP_002888842.1| hypothetical protein ARALYDRAFT_895006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65101.1| hypothetical protein ARALYDRAFT_895006 [Arabidopsis lyrata subsp. 
lyrata]
Length=97

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  567  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  388
            ++FD+LLTIPEQDEWVYSD KST CVAFIL MYK +GVFG LA +IQVTEFTIRDAY  K
Sbjct  1    MSFDELLTIPEQDEWVYSDEKSTACVAFILEMYKAAGVFGPLANNIQVTEFTIRDAYTPK  60

Query  387  IYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            ++E+NQTRLPSWCN+  +KL FCQI+GEYRMEL
Sbjct  61   LFESNQTRLPSWCNTEEEKLDFCQILGEYRMEL  93



>gb|KCW67110.1| hypothetical protein EUGRSUZ_F00891 [Eucalyptus grandis]
Length=148

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 4/122 (3%)
 Frame = -2

Query  615  EGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAE  436
            +GLDL ++L ETE RG +F +LLTIP+QD+WVYSDG S +CVAF+L MYK +G+F  ++ 
Sbjct  10   QGLDLPDLLLETEMRGSSFAELLTIPQQDDWVYSDGNSASCVAFVLEMYKATGLFDPISG  69

Query  435  SIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG---TTHWS  268
            SIQVTEFTI+DAY LK ++NN  RLP  CN G+D +LPFCQI G YRMEL G      + 
Sbjct  70   SIQVTEFTIKDAYSLKFFKNNSRRLPKLCNDGDDAELPFCQIRGRYRMELPGYNTMDPYP  129

Query  267  HM  262
            HM
Sbjct  130  HM  131



>ref|XP_010064383.1| PREDICTED: uncharacterized protein LOC104451423 [Eucalyptus grandis]
Length=207

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDTI  NYPPP+DAH+V S+M++W +MQP YAANM NEALNKRLGTEGLDL +++ E
Sbjct  96   FSWIDTIDANYPPPLDAHVVASIMTVWNQMQPAYAANMGNEALNKRLGTEGLDLPDVIVE  155

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE  463
            T+ RG +F +LLTI EQD+WVYSDGKS +CVA  L   K+
Sbjct  156  TKMRGSSFAELLTILEQDDWVYSDGKSASCVALFLKYTKQ  195



>ref|XP_001449176.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK81779.1| unnamed protein product [Paramecium tetraurelia]
Length=552

 Score =   144 bits (364),  Expect(3) = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F WIDT  DNYP  + A L   + S   +  P+ +  M  EALNKRLGTEGL + EI  E
Sbjct  369  FGWIDTPKDNYPTLLSAELATYIFSFIEKFAPSISTKMVGEALNKRLGTEGLTIPEITIE  428

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              +RG+   +L  + E+DEW+YSDG S  C +F++ +YK +G+FG     I+ TEFT +D
Sbjct  429  AAKRGIEIAELYAMVEKDEWIYSDGPSQVCSSFVIGLYKAAGLFGEY--HIEATEFTPKD  486

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
             Y +  ++ +   +P  C   +  LP+CQI+G +RMEL G
Sbjct  487  VYQMNFFDKDYV-VPKKCKDNDPDLPYCQIMGTHRMELEG  525


 Score = 41.2 bits (95),  Expect(3) = 3e-39, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  283  YNTLEPYANMNENCPSLPPSYERPIHC  203
            YNT++PY +MNE CPS  P Y+RP  C
Sbjct  526  YNTIDPYEHMNERCPSQAPDYKRPADC  552


 Score = 25.0 bits (53),  Expect(3) = 3e-39, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -3

Query  797  MLGKPYGYHNMIL  759
            M G+PYGYHN I 
Sbjct  357  MEGQPYGYHNFIF  369



>gb|EEC71626.1| hypothetical protein OsI_04047 [Oryza sativa Indica Group]
Length=123

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = -2

Query  567  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  388
            +TFD+LLT+PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+DAY L 
Sbjct  1    MTFDKLLTVPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLN  60

Query  387  IYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG  283
             +ENN TRLP WCN  +  KLPFCQI G YRMEL G
Sbjct  61   FFENNMTRLPVWCNKDDSVKLPFCQIKGRYRMELPG  96



>ref|XP_001455162.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87765.1| unnamed protein product [Paramecium tetraurelia]
Length=553

 Score =   144 bits (362),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 98/160 (61%), Gaps = 3/160 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F WIDT +DNYP P+ A     + S + ++ P    ++  EALNKRLGTEGL + E+  E
Sbjct  370  FGWIDTPTDNYPKPLSAEFATYMFSFFEKIAPGPITSLVGEALNKRLGTEGLSVSEVAIE  429

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              ++G+   +L  + E+DEWVYSDG S  C AF+  MYK +G+F      I+  EFT +D
Sbjct  430  AAKQGIELAELYAMVERDEWVYSDGPSQACAAFVTGMYKAAGLFKPF--HIEALEFTPKD  487

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
             Y LK +++N   +P  C   +  LP+CQ++G +R+EL G
Sbjct  488  IYQLKFFDSN-YEVPKKCKKNDPDLPYCQLMGTHRIELEG  526


 Score = 41.6 bits (96),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  283  YNTLEPYANMNENCPSLPPSYERPIHC  203
            YNT+EPY NMNE CPS+ P + RP  C
Sbjct  527  YNTVEPYENMNERCPSVAPEFIRPDGC  553


 Score = 21.9 bits (45),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 7/13 (54%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = -3

Query  797  MLGKPYGYHNMIL  759
            M G+PYGYH  + 
Sbjct  358  MEGQPYGYHTFLF  370



>ref|XP_001436259.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK68862.1| unnamed protein product [Paramecium tetraurelia]
Length=552

 Score =   142 bits (359),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F WIDT  DNYP  + A L   + S   +  P+ +  M  E LNKRLGTEGL + EI  E
Sbjct  369  FGWIDTPKDNYPSLLSAELATYIFSFIEKFAPSISNKMVGEGLNKRLGTEGLTIPEITIE  428

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              +RG+   +L  + E+D W+YSDG S  C +F++ +YK +G+FG     I+ TEFT +D
Sbjct  429  AAKRGIEIAELYAMVEKDNWIYSDGPSQVCSSFVIGLYKAAGLFGEY--HIEATEFTPKD  486

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
             Y +  ++ N   +P  C   +  LP+CQI+G +RMEL G
Sbjct  487  VYQMNFFDKNYV-VPKKCKDNDPDLPYCQIMGTHRMELEG  525


 Score = 40.8 bits (94),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  283  YNTLEPYANMNENCPSLPPSYERPIHC  203
            YNT++PY +MNE CPS  P Y+RP  C
Sbjct  526  YNTIDPYEHMNERCPSQAPDYKRPADC  552


 Score = 23.5 bits (49),  Expect(3) = 3e-38, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = -3

Query  797  MLGKPYGYHNMIL  759
            M G PYGYHN I 
Sbjct  357  MEGCPYGYHNFIF  369



>gb|KCW67111.1| hypothetical protein EUGRSUZ_F00891 [Eucalyptus grandis]
Length=126

 Score =   140 bits (354),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  573  RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYM  394
            RG +F +LLTIP+QD+WVYSDG S +CVAF+L MYK +G+F  ++ SIQVTEFTI+DAY 
Sbjct  2    RGSSFAELLTIPQQDDWVYSDGNSASCVAFVLEMYKATGLFDPISGSIQVTEFTIKDAYS  61

Query  393  LKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHG---TTHWSHM  262
            LK ++NN  RLP  CN G+D +LPFCQI G YRMEL G      + HM
Sbjct  62   LKFFKNNSRRLPKLCNDGDDAELPFCQIRGRYRMELPGYNTMDPYPHM  109



>ref|XP_010064375.1| PREDICTED: uncharacterized protein LOC104451414 [Eucalyptus grandis]
Length=133

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  573  RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYM  394
            RG +F +LLTIPEQD+WVYSDG+S +CVAF+L +YK + +F  ++ SIQVTEFTI+DAY 
Sbjct  2    RGSSFAELLTIPEQDDWVYSDGRSASCVAFVLEIYKAARLFDPISRSIQVTEFTIKDAYS  61

Query  393  LKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELHGTT---HWSHM  262
            L+ +ENN +RLP WCN G+D +  FCQI G YRMEL G      + HM
Sbjct  62   LRFFENNSSRLPKWCNDGDDVEFLFCQIRGRYRMELPGYNTMDPYPHM  109



>gb|EJY77500.1| hypothetical protein OXYTRI_00869 [Oxytricha trifallax]
Length=566

 Score =   122 bits (307),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 98/165 (59%), Gaps = 7/165 (4%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+W+DT SDN PP +   ++ +V S++  + P  A    N+ALNKRLGT GL++ EI  E
Sbjct  377  FAWLDTPSDNNPPVLPPGILSNVFSIFETVMPEVADIFMNQALNKRLGTHGLNMAEIANE  436

Query  582  TERRGLTFDQLLTIPEQDEWVYS-----DGKSTTCVAFILAMYKESGVFGSLAESIQVTE  418
               R LT D ++ +PE + W Y      DG+S  C  ++ A+YK +G+FG++  S    E
Sbjct  437  AALRNLTVDDVIAMPEIEGWEYEGIKPRDGRSYVCSTYLTAVYKAAGLFGNM--SFNPGE  494

Query  417  FTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
             T +D Y+LKIY++   +    C   +   P+CQ++G+YRM+  G
Sbjct  495  QTPKDLYLLKIYDDKPDQRNKECLKYDPGQPYCQLLGKYRMKFPG  539


 Score = 41.2 bits (95),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P YNT+ PY NMNE CPS+ P YER   C
Sbjct  538  PGYNTIVPYPNMNERCPSIAPEYERTDGC  566



>ref|XP_004027177.1| hypothetical protein IMG5_188030 [Ichthyophthirius multifiliis]
 gb|EGR27832.1| hypothetical protein IMG5_188030 [Ichthyophthirius multifiliis]
Length=570

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 101/172 (59%), Gaps = 10/172 (6%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F WIDT  ++ P  +D + + SV S+  +  P        EALN+RL T+ L+L EI   
Sbjct  387  FGWIDTEKESLPAILDINFLYSVFSLLEKFLPKLVNTFLGEALNQRLKTKDLNLGEIYTV  446

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              +R +T  QL ++PEQD W+YSDG+S  C +F+ A++K  G+F +L   I  TEFT RD
Sbjct  447  MSQRNITLSQLFSMPEQDSWIYSDGQSMVCSSFVAAVWKAGGIFENL--EINATEFTPRD  504

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHGTTH-----WSHM  262
             Y    ++ N  + P+ C   ND LP+CQI+G+++M++    +     +SHM
Sbjct  505  IYQTNFFDLNYKK-PAKC--LNDGLPYCQIMGKFKMDITSDGYSTIDPYSHM  553



>ref|XP_001031695.1| hypothetical protein TTHERM_00760790 [Tetrahymena thermophila]
 gb|EAR84032.1| hypothetical protein TTHERM_00760790 [Tetrahymena thermophila 
SB210]
Length=570

 Score =   123 bits (308),  Expect(3) = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F WIDT + N P  +D + V SV+++  +  P    ++  EA+NKRLGTE L+L ++   
Sbjct  387  FGWIDTENKNLPAVLDINFVYSVLTLIEKFIPAVPKSLVGEAMNKRLGTENLNLVQLYEV  446

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              +R LT  ++  IPEQD W+YSDG S  C +F+ A++K  G+F  L   I  TEFT RD
Sbjct  447  MFQRNLTVAEVFAIPEQDSWIYSDGPSMVCSSFVAAIWKAGGLFDGL--EINATEFTPRD  504

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
             Y    ++    + P  C    D LP+CQI+G++ M++
Sbjct  505  VYQTNFFDKKYKK-PEKCLK--DGLPYCQIMGKFVMDV  539


 Score = 33.5 bits (75),  Expect(3) = 2e-29, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -1

Query  313  RWRVSDGTPWYNTLEPYANMNENCPSLPPSYERPIHC  203
            ++ +   T  Y+++ PY+NM E+CPS PP + R   C
Sbjct  534  KFVMDVATDGYSSINPYSNMFEHCPSQPPLFLRTKGC  570


 Score = 21.2 bits (43),  Expect(3) = 2e-29, Method: Compositional matrix adjust.
 Identities = 7/11 (64%), Positives = 8/11 (73%), Gaps = 0/11 (0%)
 Frame = -3

Query  791  GKPYGYHNMIL  759
            G PYGYHN + 
Sbjct  377  GVPYGYHNFLF  387



>ref|XP_008245164.1| PREDICTED: uncharacterized protein LOC103343273 [Prunus mume]
Length=365

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 3/81 (4%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            FSWIDT++DNYPP +D HLV+S   M T  QP Y+ANMWNEALNKRLG EGLDLYEIL E
Sbjct  270  FSWIDTMADNYPPRLDTHLVVS---MRTSTQPAYSANMWNEALNKRLGKEGLDLYEILIE  326

Query  582  TERRGLTFDQLLTIPEQDEWV  520
             E R + FD LLTIPEQDEWV
Sbjct  327  IENREIAFDNLLTIPEQDEWV  347



>emb|CDW81161.1| UNKNOWN [Stylonychia lemnae]
Length=581

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 98/174 (56%), Gaps = 11/174 (6%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F WIDT  DN PP +   LV  V S+  +  P+     +N+ALN RL T GL++  I AE
Sbjct  395  FGWIDTPEDNLPPIIPPGLVPVVFSVLEKFTPSTVDIFFNQALNHRLNTTGLNIEGIAAE  454

Query  582  TERRGLTFDQLLTIPEQDEWVYS----DGKSTTCVAFILAMYKESGVFGSLAESIQVTEF  415
              +R LT +QL+   E + W Y+    DG++  C A++ A+Y+ +G+F      I   EF
Sbjct  455  AAQRNLTVEQLMAQVEVEGWNYTGLQNDGRAYVCSAYVAALYQAAGLFPG---KINGPEF  511

Query  414  TIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG---TTHWSHM  262
            T RD Y L +Y+ N  R P  C   +  LP+CQ++G+YRM L G    + ++HM
Sbjct  512  TPRDVYTLNVYDLNYNR-PDACVKADPTLPYCQLLGKYRMTLPGYSTISPYAHM  564



>emb|CDW76296.1| UNKNOWN [Stylonychia lemnae]
Length=589

 Score =   114 bits (286),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 87/165 (53%), Gaps = 7/165 (4%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+W+DT +DN PP +   ++ +  S+   + P       N+ALNKRLGT+GL L +I  E
Sbjct  400  FAWLDTPNDNNPPVLPPGMLANTFSLVETISPEVVDIFMNQALNKRLGTKGLTLSQISVE  459

Query  582  TERRGLTFDQLLTIPEQDEWVY-----SDGKSTTCVAFILAMYKESGVFGSLAESIQVTE  418
              +R LT D ++ +PE D W Y      DG+S  C  ++ A+ K +GVFG +       E
Sbjct  460  AAKRNLTLDDVIAMPELDGWEYEGLEPKDGRSYVCSTYVTAVMKAAGVFGDMI--FNPGE  517

Query  417  FTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELHG  283
             T RD Y L I+E   T     C       P+CQI+G Y+M   G
Sbjct  518  QTPRDMYQLTIFETTSTWRSKKCQETEPNTPWCQILGAYKMSFPG  562


 Score = 37.7 bits (86),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYERPIHC  203
            P ++T++PY +MNE CPS+ P YER   C
Sbjct  561  PGFSTVKPYPHMNERCPSIAPKYERTEGC  589



>ref|XP_004346245.1| hypothetical protein CAOG_05572 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95080.1| hypothetical protein CAOG_005572 [Capsaspora owczarzaki ATCC 
30864]
Length=582

 Score =   115 bits (287),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 95/170 (56%), Gaps = 14/170 (8%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTR-MQPT----YAANMWNEALNKRLGTEGLDLY  598
            F+W+DT   N P PVD H ++ ++S+    ++P     +  ++WN A N+RLGT      
Sbjct  381  FTWLDTPDQNMPAPVDQHYLVVMLSLLDPILEPLLVELHTPSLWNVAFNRRLGTAYTRCV  440

Query  597  EILAETERRGLTFDQLLTIPEQDEWVYS-------DGKSTTCVAFILAMYKESGVFGSLA  439
            EI A      ++F QL+++PEQD W+Y+       DG +  C  F+   YK  G+FG+L 
Sbjct  441  EIFAHAAAHNVSFGQLISMPEQDWWIYAGHEPWYPDGIAMVCDVFVCYTYKAGGLFGNLT  500

Query  438  ESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
            +SI   EFT  D Y L  ++     +P+ C + +    +CQI+G+YR++L
Sbjct  501  DSINCAEFTPLDVYELAWFDT--APIPAKCQAADPGNKWCQILGKYRIQL  548


 Score = 37.0 bits (84),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -1

Query  289  PWYNTLEPYANMNENCPSLPPSYER  215
            P +NT++P+A+M ENCPS+PP  +R
Sbjct  549  PEFNTVQPFAHMRENCPSMPPYADR  573



>gb|EAR84506.2| hypothetical protein TTHERM_00655340 [Tetrahymena thermophila 
SB210]
Length=570

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 101/172 (59%), Gaps = 10/172 (6%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            + W+DT + + P  +D + V S +++  +  P+   ++ NE LN RLGT+ L+L ++   
Sbjct  387  YGWVDTENKSLPAILDVNFVYSALTLVEKFYPSIPKSIINEGLNHRLGTQDLNLVQLYEV  446

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              ++ LT  ++  IPEQD W+YS G S  C AF+  +++  G+FG L   I V+EFT RD
Sbjct  447  MYQKNLTIAEVFAIPEQDSWLYSYGHSLVCSAFVAGVWRAGGLFGDL--QINVSEFTPRD  504

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL-----HGTTHWSHM  262
             Y +K ++ N  + P  C+   D LP+CQI+G++ M++     +  T + HM
Sbjct  505  VYQMKFFDKNFKK-PEKCHK--DGLPYCQIMGKFVMDVITDGYNSITPYEHM  553



>ref|XP_001032169.1| hypothetical protein TTHERM_00655340 [Tetrahymena thermophila]
Length=583

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 101/172 (59%), Gaps = 10/172 (6%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            + W+DT + + P  +D + V S +++  +  P+   ++ NE LN RLGT+ L+L ++   
Sbjct  400  YGWVDTENKSLPAILDVNFVYSALTLVEKFYPSIPKSIINEGLNHRLGTQDLNLVQLYEV  459

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
              ++ LT  ++  IPEQD W+YS G S  C AF+  +++  G+FG L   I V+EFT RD
Sbjct  460  MYQKNLTIAEVFAIPEQDSWLYSYGHSLVCSAFVAGVWRAGGLFGDL--QINVSEFTPRD  517

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL-----HGTTHWSHM  262
             Y +K ++ N  + P  C+   D LP+CQI+G++ M++     +  T + HM
Sbjct  518  VYQMKFFDKNFKK-PEKCHK--DGLPYCQIMGKFVMDVITDGYNSITPYEHM  566



>ref|XP_001749148.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85954.1| predicted protein [Monosiga brevicollis MX1]
Length=543

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 88/158 (56%), Gaps = 4/158 (3%)
 Frame = -2

Query  762  FSWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAE  583
            F+WIDT   NYP  +D+HL   ++     +    +  +W+ ALNKRL T  +    +L  
Sbjct  360  FTWIDTPEANYPGTLDSHLHELLIGFANAISYELSGLLWDRALNKRLNTVNMTTVPLLNL  419

Query  582  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  403
               R ++F +L+ +PEQDEW Y DG +  C   +   +K  G+FG L    Q TEFT  D
Sbjct  420  AHSRNISFTELMEMPEQDEWQYDDGYNMVCDVLVCEAWKAGGLFGDL--DFQCTEFTNWD  477

Query  402  AYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
             Y L I+  N T  P++C   +  LPFCQI+G+YRM L
Sbjct  478  DYTLAIF--NTTAPPAYCQQIDPGLPFCQILGDYRMSL  513



>ref|XP_004997585.1| hypothetical protein PTSG_01605 [Salpingoeca rosetta]
 gb|EGD78627.1| hypothetical protein PTSG_01605 [Salpingoeca rosetta]
Length=489

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 76/124 (61%), Gaps = 1/124 (1%)
 Frame = -2

Query  660  AANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFI  481
            AA MW  ALNKRLGT  L + E+      R ++F  L  +PEQD W Y DG S  C   +
Sbjct  337  AAMMWTMALNKRLGTANLTVAEVYDTAASRNISFTTLFAMPEQDSWQYVDGYSMVCDVLV  396

Query  480  LAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEY  301
               +K +G+ G+L + IQ TEFT  DAY L I+++   R P+ C + +  LPFCQI+G+Y
Sbjct  397  CETWKAAGLMGALTDKIQCTEFTNWDAYTLNIFDSTTPR-PAACKAADPDLPFCQILGKY  455

Query  300  RMEL  289
            RM+L
Sbjct  456  RMDL  459



>emb|CDW73981.1| UNKNOWN [Stylonychia lemnae]
Length=596

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 89/162 (55%), Gaps = 8/162 (5%)
 Frame = -2

Query  759  SWIDTISDNYPPPVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAET  580
             W+DT  DN PP + A  V  +  +  +  P        + LN RLGT+ L   E+ +  
Sbjct  407  GWLDTPEDNLPPLIPARFVPILFEILNKFIPDTIDIFLVQGLNHRLGTQNLTYPEVASAA  466

Query  579  ERRGLTFDQLLTIPEQDEWVY-----SDGKSTTCVAFILAMYKESGVFGSLAESIQVTEF  415
              RGLT +QL+ IPEQD W+Y      DG+S  C +F+  MYK +G+FG   + I   E 
Sbjct  467  AERGLTMEQLMAIPEQDGWLYHGIEPKDGRSYVCSSFVTGMYKAAGLFGD--KVINPQEI  524

Query  414  TIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  289
              RD Y + ++   Q+ LP  C + +  LP+CQI+G+YRM++
Sbjct  525  HDRDLYNMNLFNKTQS-LPEACKAADPTLPYCQILGKYRMDI  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1593558888600