BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018B07

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          374   2e-124   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                374   2e-124   Ipomoea batatas [batate]
gb|AFY26882.1|  catalase                                                359   4e-123   Ipomoea batatas [batate]
emb|CAB56850.1|  catalase                                               305   4e-98    Prunus persica
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      306   6e-98    Nicotiana tomentosiformis
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 304   5e-97    Eucalyptus grandis [rose gum]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                303   6e-97    Citrus sinensis [apfelsine]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 303   1e-96    Prunus mume [ume]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             303   1e-96    Citrus clementina [clementine]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 303   1e-96    Elaeis guineensis
dbj|BAF91369.1|  catalase                                               302   2e-96    Capsicum annuum
gb|AGC65520.1|  catalase                                                302   2e-96    Eriobotrya japonica [loquat]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             302   4e-96    Prunus persica
gb|ABY19573.1|  catalase                                                294   4e-96    Manihot esculenta [manioc]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      301   5e-96    Eucalyptus grandis [rose gum]
gb|AAX84671.1|  catalase CAT2                                           294   6e-96    Manihot esculenta [manioc]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      301   7e-96    Nicotiana sylvestris
gb|AIX10947.1|  putative catalase                                       301   8e-96    Gardenia jasminoides
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    301   8e-96    Capsicum annuum
emb|CAD42909.1|  catalase                                               300   2e-95    Prunus persica
gb|ABR15776.1|  catalase                                                293   3e-95    Litchi
gb|AAA57551.1|  catalase                                                296   3e-95    Nicotiana sylvestris
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      300   3e-95    Prunus mume [ume]
gb|AAB88173.1|  catalase                                                293   4e-95    Glycine max [soybeans]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             299   5e-95    Prunus persica
emb|CAD42908.1|  catalase                                               299   5e-95    Prunus persica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         299   5e-95    Tarenaya hassleriana [spider flower]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          299   6e-95    Avicennia marina
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      298   7e-95    Elaeis guineensis
ref|NP_001289779.1|  catalase isozyme 1                                 298   8e-95    Nelumbo nucifera [Indian lotus]
ref|XP_002306976.2|  catalase family protein                            298   9e-95    
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          298   1e-94    Solanum melongena [aubergine]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    298   1e-94    Gossypium raimondii
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      298   2e-94    Nicotiana tomentosiformis
emb|CDP07287.1|  unnamed protein product                                297   2e-94    Coffea canephora [robusta coffee]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    297   2e-94    Nicotiana tabacum [American tobacco]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      297   2e-94    Populus euphratica
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      297   3e-94    Nicotiana sylvestris
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      297   3e-94    
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      297   3e-94    
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 297   3e-94    Nicotiana tomentosiformis
gb|KJB14249.1|  hypothetical protein B456_002G115900                    292   3e-94    Gossypium raimondii
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 296   5e-94    Vitis vinifera
ref|NP_001268098.1|  catalase                                           296   6e-94    Vitis vinifera
ref|XP_010061175.1|  PREDICTED: catalase-like                           296   7e-94    Eucalyptus grandis [rose gum]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 296   7e-94    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAI43948.1|  catalase                                               296   9e-94    Populus deltoides
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      295   1e-93    Phoenix dactylifera
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               295   1e-93    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      295   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 295   1e-93    Nicotiana sylvestris
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 295   1e-93    Populus euphratica
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           295   1e-93    
ref|XP_002301920.1|  catalase family protein                            295   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           295   2e-93    Sesamum indicum [beniseed]
gb|ACJ11733.1|  catalase                                                295   2e-93    Gossypium hirsutum [American cotton]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      295   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               295   2e-93    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAC79443.1|  catalase                                               295   2e-93    Acacia ampliceps
gb|ADC95629.1|  catalase                                                295   3e-93    Bruguiera gymnorhiza [Burma mangrove]
gb|AIS20825.1|  CAT                                                     294   3e-93    Pyrus x bretschneideri [bai li]
gb|AAM97542.1|  catalase 3                                              294   3e-93    Capsicum annuum
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 294   3e-93    Phoenix dactylifera
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      294   4e-93    
gb|AHF27428.1|  catalase                                                289   4e-93    Cucurbita moschata [ayote]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          294   5e-93    Soldanella alpina
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     296   5e-93    Eucalyptus grandis [rose gum]
ref|NP_001237571.1|  catalase-4                                         293   7e-93    Glycine max [soybeans]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             293   7e-93    Phaseolus vulgaris [French bean]
gb|AGV54297.1|  peroxisomal catalase                                    293   7e-93    Phaseolus vulgaris [French bean]
gb|KHG25152.1|  Catalase isozyme 1                                      293   8e-93    Gossypium arboreum [tree cotton]
gb|AEQ30070.1|  catalase                                                293   8e-93    Litchi chinensis [litchi]
gb|ACJ73906.1|  CAT2                                                    287   9e-93    Solanum nigrum
gb|AJE26131.1|  catalase                                                293   1e-92    Salix matsudana [tortured willow]
ref|XP_010498496.1|  PREDICTED: catalase-3                              293   1e-92    Camelina sativa [gold-of-pleasure]
ref|NP_001240021.1|  catalase                                           293   1e-92    Glycine max [soybeans]
emb|CAC04509.1|  catalase                                               285   1e-92    Digitalis lanata [Grecian foxglove]
gb|AAC48918.1|  salicylic acid binding catalase                         293   1e-92    Nicotiana tabacum [American tobacco]
ref|XP_009110221.1|  PREDICTED: catalase-3                              293   2e-92    Brassica rapa
gb|AGE15298.2|  catalase 1                                              293   2e-92    Eriobotrya japonica [loquat]
ref|NP_001031072.3|  catalase 3                                         289   2e-92    Arabidopsis thaliana [mouse-ear cress]
gb|ACJ76836.3|  catalase                                                292   2e-92    Dimocarpus longan [longan]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     293   2e-92    Sesamum indicum [beniseed]
gb|ABM47415.1|  catalase                                                292   2e-92    Prunus avium [gean]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    292   3e-92    Gossypium raimondii
ref|NP_001234827.1|  catalase isozyme 1                                 292   3e-92    Solanum lycopersicum
ref|NP_001291326.1|  catalase isozyme 1                                 292   3e-92    Sesamum indicum [beniseed]
gb|AAF19965.1|AF207906_1  catalase 1                                    292   3e-92    Zantedeschia aethiopica [arum-lily]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 291   4e-92    Manihot esculenta [manioc]
emb|CDY31488.1|  BnaC05g15970D                                          292   4e-92    Brassica napus [oilseed rape]
ref|XP_007018034.1|  Catalase 2                                         291   4e-92    
emb|CDY29519.1|  BnaA06g14510D                                          291   5e-92    Brassica napus [oilseed rape]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             291   5e-92    Phaseolus vulgaris [French bean]
gb|AET97564.1|  catalase                                                291   5e-92    Ziziphus jujuba [Chinese jujube]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      291   5e-92    Solanum lycopersicum
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         291   6e-92    Brassica rapa
ref|XP_010530333.1|  PREDICTED: catalase-2                              291   6e-92    Tarenaya hassleriana [spider flower]
ref|XP_009149539.1|  PREDICTED: catalase-3                              292   7e-92    Brassica rapa
dbj|BAJ33995.1|  unnamed protein product                                291   7e-92    Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             291   7e-92    Eutrema salsugineum [saltwater cress]
emb|CDY33636.1|  BnaC08g19360D                                          291   7e-92    Brassica napus [oilseed rape]
emb|CDP07288.1|  unnamed protein product                                291   7e-92    Coffea canephora [robusta coffee]
dbj|BAH20307.1|  AT1G20620                                              290   9e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      291   9e-92    Cucumis melo [Oriental melon]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             291   9e-92    Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      290   9e-92    Citrus sinensis [apfelsine]
ref|NP_001237556.1|  catalase-1/2                                       290   1e-91    Glycine max [soybeans]
gb|AAR84578.1|  catalase 1a                                             290   1e-91    Lotus japonicus
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      290   1e-91    Vitis vinifera
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          290   1e-91 
dbj|BAQ21275.1|  catalase                                               290   2e-91    Citrus tamurana
emb|CDY01364.1|  BnaA07g11370D                                          292   2e-91    
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      290   2e-91    
gb|AAM65021.1|  unknown                                                 290   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                            290   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          290   2e-91    Amborella trichopoda
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               290   2e-91    Gossypium hirsutum [American cotton]
gb|AIA61608.1|  catalase                                                289   3e-91    Gynostemma pentaphyllum [jiaogulan]
gb|ABC01913.1|  catalase isozyme 1-like protein                         289   3e-91    Solanum tuberosum [potatoes]
gb|AFU90822.1|  catalase                                                289   3e-91    Populus tomentosa [Chinese white poplar]
gb|AFU90823.1|  catalase                                                288   3e-91    Populus x beijingensis
emb|CDY31878.1|  BnaC07g15280D                                          289   3e-91    Brassica napus [oilseed rape]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               289   4e-91    Cucurbita pepo
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 289   4e-91    Solanum tuberosum [potatoes]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              289   4e-91    
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    289   4e-91    Arabis alpina [alpine rockcress]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              289   4e-91    Cicer arietinum [garbanzo]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             288   5e-91    
ref|NP_001235974.1|  catalase-3                                         289   5e-91    Glycine max [soybeans]
prf||2104177A  catalase                                                 288   5e-91 
gb|ACV92695.1|  catalase                                                288   6e-91    Brassica oleracea
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          288   6e-91    Helianthus annuus
emb|CDX76313.1|  BnaA08g10870D                                          288   6e-91    
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             288   6e-91    
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       288   6e-91    Cucumis sativus [cucumbers]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          288   6e-91    Vigna radiata var. radiata [golden gram]
ref|NP_001274863.1|  catalase isozyme 1                                 288   7e-91    Solanum tuberosum [potatoes]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             288   7e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      288   8e-91    
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      288   8e-91    Phoenix dactylifera
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               288   8e-91    Solanum tuberosum [potatoes]
emb|CAA64220.1|  catalase                                               288   9e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAB86582.2|  catalase                                                288   9e-91    Raphanus sativus
gb|AAF71742.1|AF248491_1  catalase                                      288   1e-90    Raphanus sativus
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             288   1e-90    Capsella rubella
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             288   1e-90    Capsella rubella
ref|XP_011022275.1|  PREDICTED: catalase-like                           287   1e-90    Populus euphratica
gb|AAK96854.1|  catalase                                                288   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAR97905.1|  catalase                                                288   1e-90    Solanum tuberosum [potatoes]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          288   1e-90    Amborella trichopoda
prf||1906388A  catalase                                                 288   1e-90 
emb|CAA45564.1|  catalase                                               288   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAD37788.1|AF149283_1  catalase 1                                    286   1e-90    Phaseolus vulgaris [French bean]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         288   1e-90    Tarenaya hassleriana [spider flower]
ref|NP_195235.1|  catalase 2                                            288   1e-90    Arabidopsis thaliana [mouse-ear cress]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               288   1e-90    Solanum tuberosum [potatoes]
emb|CCP37650.1|  catalase-1                                             288   1e-90    Nicotiana tabacum [American tobacco]
gb|ACL27272.1|  catalase                                                287   1e-90    Nicotiana benthamiana
gb|AAD17935.1|  catalase                                                287   1e-90    Brassica juncea [brown mustard]
emb|CAA85470.1|  catalase                                               287   2e-90    Solanum tuberosum [potatoes]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               287   2e-90    Ricinus communis
gb|AFU48609.1|  catalase 1                                              287   2e-90    Nicotiana benthamiana
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      287   2e-90    Elaeis guineensis
emb|CDY40645.1|  BnaA03g53180D                                          287   2e-90    Brassica napus [oilseed rape]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              287   2e-90    Populus euphratica
ref|XP_009138342.1|  PREDICTED: catalase-2                              287   2e-90    Brassica rapa
gb|ACA50528.1|  putative catalase 2                                     287   2e-90    Brassica napus [oilseed rape]
gb|KFK30147.1|  catalase                                                287   2e-90    Arabis alpina [alpine rockcress]
gb|AAB62892.1|  catalase-1                                              287   2e-90    Nicotiana glutinosa
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              287   3e-90    Populus euphratica
gb|AAD17936.1|  catalase                                                286   3e-90    Brassica juncea [brown mustard]
emb|CDY17510.1|  BnaC03g65530D                                          286   3e-90    Brassica napus [oilseed rape]
gb|AAB71764.1|  catalase 1                                              286   3e-90    Nicotiana tabacum [American tobacco]
emb|CDY52649.1|  BnaAnng11640D                                          285   4e-90    Brassica napus [oilseed rape]
gb|AAD30292.1|AF139539_1  catalase 3                                    286   4e-90    Raphanus sativus
gb|AAD30291.2|AF139538_1  catalase 2                                    286   4e-90    Raphanus sativus
gb|KHG12976.1|  Catalase isozyme 2                                      286   5e-90    Gossypium arboreum [tree cotton]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               286   5e-90    Gossypium hirsutum [American cotton]
ref|XP_010094556.1|  Catalase isozyme 1                                 286   5e-90    Morus notabilis
gb|AFW69584.1|  catalase1                                               281   6e-90    
gb|ABQ44283.1|  catalase                                                281   6e-90    Saccharum hybrid cultivar NCo 376
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 285   9e-90    Cucumis melo [Oriental melon]
ref|NP_001048861.1|  Os03g0131200                                       285   9e-90    
dbj|BAA34205.1|  catalase                                               285   9e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009106100.1|  PREDICTED: catalase-2                              285   9e-90    Brassica rapa
gb|ADZ45555.1|  catalase                                                285   9e-90    Vigna radiata [mung bean]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         285   1e-89    Camelina sativa [gold-of-pleasure]
gb|AAC49807.1|  catalase 3                                              285   1e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAG43363.1|AF151368_1  catalase                                      285   1e-89    Hevea brasiliensis [jebe]
ref|XP_010437527.1|  PREDICTED: catalase-2                              285   1e-89    Camelina sativa [gold-of-pleasure]
gb|AAO17721.1|  catalase                                                285   2e-89    Hypericum perforatum
emb|CDX72514.1|  BnaC07g45360D                                          285   2e-89    
dbj|BAJ87148.1|  predicted protein                                      278   2e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACJ22771.1|  catalase 1                                              285   2e-89    Jatropha curcas
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                285   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      285   2e-89    Nicotiana sylvestris
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    284   2e-89    Oryza sativa Indica Group [Indian rice]
gb|AAY59707.1|  catalase                                                284   2e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 284   3e-89    Oryza brachyantha
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         284   3e-89    Jatropha curcas
gb|ADZ45556.1|  catalase                                                284   3e-89    Vigna radiata [mung bean]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      284   3e-89    Nicotiana tomentosiformis
gb|AAC19397.1|  leaf catalase                                           284   4e-89    Mesembryanthemum crystallinum
gb|AAR14052.2|  catalase                                                283   4e-89    Solanum tuberosum [potatoes]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         284   4e-89    Tarenaya hassleriana [spider flower]
gb|ACB11496.1|  catalase                                                283   5e-89    Pinus sylvestris [Scotch pine]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 283   5e-89    Tarenaya hassleriana [spider flower]
gb|AIU99479.1|  catalase                                                283   5e-89    Saccharum arundinaceum
dbj|BAA34204.1|  catalase                                               283   6e-89    Oryza sativa Japonica Group [Japonica rice]
emb|CDP01803.1|  unnamed protein product                                283   6e-89    Coffea canephora [robusta coffee]
dbj|BAA05494.1|  catalase                                               283   6e-89    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       283   6e-89    
ref|XP_007046520.1|  Catalase 2                                         283   6e-89    Theobroma cacao [chocolate]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         283   7e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010692544.1|  PREDICTED: catalase-like                           283   8e-89    Beta vulgaris subsp. vulgaris [field beet]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               283   8e-89    Ricinus communis
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               283   9e-89    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         283   9e-89    Oryza brachyantha
gb|AHF21552.1|  catalase                                                282   1e-88    Hylocereus undatus [dragon fruit]
gb|ABK24453.1|  unknown                                                 282   1e-88    Picea sitchensis
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              283   1e-88    
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      282   2e-88    Solanum tuberosum [potatoes]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    282   2e-88    Gossypium raimondii
gb|AIM43584.1|  catalase                                                282   2e-88    Saccharum hybrid cultivar Yacheng05-179
ref|NP_001241808.1|  catalase isozyme B                                 282   2e-88    Zea mays [maize]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       279   2e-88    Cucumis sativus [cucumbers]
gb|AAD17933.1|  catalase                                                282   2e-88    Brassica juncea [brown mustard]
emb|CAA42720.1|  catalase-1                                             282   2e-88    Zea mays [maize]
gb|AIU99485.1|  catalase                                                282   2e-88    Saccharum spontaneum [fodder cane]
gb|AIU99488.1|  catalase                                                282   2e-88    Saccharum hybrid cultivar ROC22
gb|AIU99484.1|  catalase                                                281   3e-88    Saccharum arundinaceum
gb|AIU99481.1|  catalase                                                281   3e-88    Saccharum spontaneum [fodder cane]
emb|CAG23920.1|  catalase                                               281   4e-88    Festuca arundinacea [tall fescue]
gb|KEH36312.1|  catalase heme-binding enzyme                            281   4e-88    Medicago truncatula
gb|AFN81243.1|  catalase 1                                              281   4e-88    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      281   5e-88    Brachypodium distachyon [annual false brome]
gb|AAC17729.1|  catalase 1                                              278   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS69543.1|  catalase                                                281   5e-88    Genlisea aurea
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          281   5e-88    
gb|AFR53082.1|  CAT                                                     281   6e-88    Anthurium andraeanum [flamingo-lily]
gb|AHF27433.1|  catalase                                                281   6e-88    Cucurbita maxima [Boston marrow]
gb|AAM97541.1|  catalase 2                                              280   6e-88    Capsicum annuum
gb|AHF27430.1|  catalase                                                280   7e-88    Cucurbita moschata [ayote]
gb|AHA50082.1|  catalase                                                280   8e-88    Eleutherococcus senticosus
ref|XP_003558892.1|  PREDICTED: catalase-1                              280   8e-88    Brachypodium distachyon [annual false brome]
gb|ACN36234.1|  unknown                                                 275   9e-88    Zea mays [maize]
gb|EMT05040.1|  Catalase-1                                              281   9e-88    
gb|AIU99480.1|  catalase                                                280   1e-87    Saccharum spontaneum [fodder cane]
emb|CDX69111.1|  BnaC01g03420D                                          279   1e-87    
gb|ACL35349.1|  catalase                                                280   1e-87    Picea glauca
gb|AAL00886.1|  catalase                                                273   2e-87    Suaeda salsa
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       280   2e-87    Triticum aestivum [Canadian hard winter wheat]
gb|AIU99482.1|  catalase                                                279   3e-87    Saccharum hybrid cultivar ROC22
gb|AIU99486.1|  catalase                                                279   3e-87    Saccharum spontaneum [fodder cane]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               279   3e-87    Hordeum vulgare [barley]
gb|AAF61732.1|AF243517_1  catalase 2                                    279   4e-87    Helianthus annuus
ref|NP_001234186.1|  catalase isozyme 2                                 279   4e-87    
dbj|BAJ90861.1|  predicted protein                                      278   4e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABB72796.1|  catalase isozyme 1-like protein                         278   5e-87    Solanum tuberosum [potatoes]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         278   5e-87    Setaria italica
emb|CAE82295.1|  catalase                                               278   5e-87    Homogyne alpina
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                278   6e-87    Erythranthe guttata [common monkey flower]
dbj|BAJ88747.1|  predicted protein                                      279   8e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF79625.1|AC027665_26  F5M15.5                                      289   9e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AIU99487.1|  catalase                                                278   9e-87    Saccharum hybrid cultivar ROC22
gb|AAF61733.1|AF243518_1  catalase 3                                    278   9e-87    Helianthus annuus
gb|ADU56198.1|  catalase                                                278   9e-87    Musa acuminata AAA Group [Cavendish banana]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 279   1e-86    
gb|AAC17731.1|  catalase 1                                              278   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      277   1e-86    Cucumis melo [Oriental melon]
ref|NP_564121.1|  catalase 1                                            277   1e-86    Arabidopsis thaliana [mouse-ear cress]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               277   1e-86    Cucurbita pepo
ref|NP_001105415.1|  catalase isozyme 1                                 277   1e-86    
gb|AHF27429.1|  catalase                                                276   1e-86    Cucurbita moschata [ayote]
gb|AHF27432.1|  catalase                                                276   2e-86    Cucurbita maxima [Boston marrow]
emb|CDP01802.1|  unnamed protein product                                276   2e-86    Coffea canephora [robusta coffee]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 276   2e-86    
ref|XP_002521709.1|  catalase, putative                                 276   2e-86    Ricinus communis
gb|AIU99483.1|  catalase                                                276   2e-86    Saccharum hybrid cultivar ROC22
gb|ADM96039.1|  catalase                                                276   2e-86    
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             277   2e-86    
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 276   2e-86    
gb|AIZ77475.1|  catalase                                                276   2e-86    
gb|ACV30589.1|  catalase                                                266   3e-86    
gb|AIP93616.1|  CAT1                                                    276   3e-86    
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    276   3e-86    
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      276   3e-86    
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      276   4e-86    
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               276   4e-86    
gb|AAC19398.1|  root catalase                                           276   6e-86    
gb|AAF61734.1|AF243519_1  catalase 4                                    276   6e-86    
gb|ADU56199.1|  catalase                                                275   7e-86    
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    275   7e-86    
ref|XP_002890395.1|  F5M15.5                                            286   8e-86    
ref|XP_010692546.1|  PREDICTED: catalase                                275   1e-85    
ref|XP_002510677.1|  catalase, putative                                 285   1e-85    
gb|AAG61140.2|AF332973_1  catalase 2                                    275   1e-85    
tpg|DAA43177.1|  TPA: catalase2                                         275   1e-85    
gb|AAK67359.2|AF390210_1  catalase                                      275   1e-85    
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               275   1e-85    
prf||1803522A  catalase                                                 275   2e-85 
ref|NP_001105310.1|  catalase isozyme 2                                 274   2e-85    
gb|ACJ73905.1|  CAT1                                                    263   3e-85    
emb|CDY31877.1|  BnaC07g15270D                                          274   3e-85    
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         274   3e-85    
ref|XP_009103333.1|  PREDICTED: catalase-1                              274   3e-85    
emb|CDY01363.1|  BnaA07g11360D                                          274   3e-85    
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      273   4e-85    
gb|ADK25939.1|  catalase                                                264   8e-85    
gb|ABV55108.1|  catalase 2                                              272   1e-84    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             272   1e-84    
tpg|DAA43178.1|  TPA: catalase2                                         273   1e-84    
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      272   2e-84    
gb|ABY21704.1|  catalase-1 precursor                                    271   2e-84    
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 281   2e-84    
dbj|BAH37035.1|  catalase 1                                             271   2e-84    
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             271   3e-84    
gb|ADN94253.1|  catalase                                                271   3e-84    
gb|AHB72694.1|  catalase                                                271   3e-84    
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               271   3e-84    
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             271   3e-84    
gb|AFD29285.1|  catalase                                                271   4e-84    
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             270   6e-84    
gb|ACH63223.1|  catalase                                                269   2e-83    
ref|NP_001031073.1|  catalase 3                                         268   2e-83    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   271   3e-83    
gb|AAB07026.1|  catalase 1                                              268   3e-83    
gb|KHG21219.1|  Catalase isozyme 1                                      266   5e-83    
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            265   1e-81    
gb|AJF34884.1|  catalase                                                263   6e-81    
gb|ACL81498.1|  catalase                                                262   1e-80    
emb|CDY31490.1|  BnaC05g15990D                                          260   6e-80    
emb|CDY29518.1|  BnaA06g14520D                                          260   6e-80    
ref|XP_009149540.1|  PREDICTED: catalase-1                              260   7e-80    
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         259   1e-79    
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             259   3e-79    
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         258   4e-79    
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              257   5e-79    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 256   1e-78    
ref|XP_010477308.1|  PREDICTED: catalase-1                              256   1e-78    
ref|XP_010105996.1|  Catalase isozyme 1                                 252   1e-78    
gb|AAC17730.1|  catalase 2                                              253   2e-78    
ref|XP_001779509.1|  predicted protein                                  256   2e-78    
dbj|BAJ92414.1|  predicted protein                                      256   3e-78    
dbj|BAH19523.1|  AT4G35090                                              255   3e-78    
ref|NP_001031791.1|  catalase 2                                         255   3e-78    
gb|AAX88799.1|  catalase                                                255   4e-78    
gb|EMS51034.1|  Catalase isozyme 2                                      255   8e-78    
gb|AAZ29552.1|  catalase-C                                              255   8e-78    
gb|ADY02963.1|  catalase                                                254   8e-78    
emb|CAH61266.1|  catalase                                               254   8e-78    
ref|NP_001045673.1|  Os02g0115700                                       254   8e-78    
dbj|BAH56915.1|  AT1G20620                                              254   9e-78    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          254   1e-77    
gb|ABN71233.2|  catalase                                                254   1e-77    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               254   1e-77    
ref|XP_001752315.1|  predicted protein                                  254   2e-77    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      251   1e-76    
ref|XP_001784759.1|  predicted protein                                  251   1e-76    
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      251   2e-76    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      251   2e-76    
gb|ADQ28492.1|  catalase                                                251   2e-76    
gb|AGI65617.1|  catalase                                                249   3e-76    
gb|ABK24449.1|  unknown                                                 250   4e-76    
gb|EMT06167.1|  Catalase isozyme 2                                      254   7e-76    
gb|EMS61345.1|  Catalase isozyme 1                                      252   1e-75    
dbj|BAH20283.1|  AT1G20620                                              236   3e-75    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          247   4e-75    
gb|AGT16203.1|  catalase                                                245   3e-74    
gb|AII23739.1|  catalase                                                244   5e-74    
emb|CAA43814.1|  catalase                                               244   5e-74    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           244   6e-74 
gb|ABR16304.1|  unknown                                                 243   8e-74    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    244   8e-74    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          244   1e-73    
gb|ABK24543.1|  unknown                                                 243   2e-73    
gb|AFR42410.1|  catalase                                                230   6e-73    
ref|XP_005645077.1|  catalase                                           240   3e-72    
gb|AFR42412.1|  catalase                                                226   2e-71    
gb|AGT16188.1|  catalase                                                236   9e-71    
gb|AGT16054.1|  catalase                                                236   9e-71    
gb|AGT15888.1|  catalase                                                236   9e-71    
gb|AGT16310.1|  catalase                                                236   1e-70    
gb|AFW66787.1|  catalase3                                               236   1e-70    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               236   1e-70    
gb|AHZ13843.1|  catalase                                                235   3e-70    
gb|ABK41476.1|  catalase                                                234   4e-70    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              233   2e-69    
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     230   1e-68    
gb|AFW66785.1|  catalase3 isoform 1                                     235   1e-68    
gb|KIY96954.1|  catalase                                                226   2e-68    
gb|EMS35721.1|  Catalase isozyme 1                                      222   1e-67    
gb|AEY70510.1|  catalase                                                221   2e-67    
dbj|BAD07937.1|  catalase catA-like protein                             216   6e-67    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      226   1e-66    
ref|XP_011396830.1|  Catalase isozyme 2                                 223   1e-65    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        222   3e-65    
ref|NP_001105416.1|  catalase isozyme 3                                 222   3e-65    
ref|XP_002950455.1|  catalase                                           221   4e-65    
gb|AFW66789.1|  catalase3                                               215   1e-64    
ref|XP_001696763.1|  catalase/peroxidase                                220   2e-64    
dbj|BAA34714.1|  catalase                                               219   2e-64    
emb|CAA73663.1|  catalase                                               216   3e-63    
gb|AAB70006.1|  catalase                                                216   5e-63    
ref|XP_005708279.1|  catalase                                           215   8e-63    
gb|AID50071.1|  catalase                                                204   1e-62    
gb|AFW66788.1|  catalase3                                               214   2e-62    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             213   2e-62    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            214   3e-62 
emb|CAA10286.1|  catalase                                               199   5e-61    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              209   4e-60    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      208   6e-60    
gb|AAR84577.1|  catalase 1b                                             206   7e-60    
gb|AFI48111.1|  catalase isozyme B                                      194   5e-59    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    204   6e-59    
gb|ABY68162.1|  catalase                                                193   1e-58    
gb|ABY68159.1|  catalase                                                193   1e-58    
gb|ABY68158.1|  catalase                                                193   2e-58    
gb|ABY68164.1|  catalase                                                193   2e-58    
gb|AFI48054.1|  catalase isozyme B                                      192   5e-58    
gb|ABY68160.1|  catalase                                                192   5e-58    
gb|ABY68161.1|  catalase                                                191   9e-58    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    201   1e-57    
gb|AFI48068.1|  catalase isozyme B                                      190   2e-57    
gb|AFI48101.1|  catalase isozyme B                                      190   2e-57    
gb|AFI48131.1|  catalase isozyme B                                      187   2e-56    
gb|AFI48098.1|  catalase isozyme B                                      187   3e-56    
gb|AFI48130.1|  catalase isozyme B                                      185   2e-55    
gb|KDD77132.1|  catalase                                                194   1e-54    
gb|ABB88582.1|  catalase                                                194   1e-54    
gb|AAO16182.1|  catalase-1                                              181   4e-54    
emb|CBI29556.3|  unnamed protein product                                179   3e-53    
gb|AGS17821.1|  catalase 2                                              181   6e-51    
gb|AAP57673.1|  catalase                                                177   1e-50    
gb|ABB51561.1|  truncated catalase 2                                    181   2e-50    
gb|AFH53190.1|  catalase                                                176   2e-50    
gb|AFH53189.1|  catalase                                                176   2e-50    
gb|AFK46618.1|  unknown                                                 171   4e-50    
gb|AFH53187.1|  catalase                                                175   5e-50    
ref|XP_005536240.1|  catalase                                           182   5e-50    
dbj|BAD94702.1|  catalase                                               169   3e-49    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             176   1e-48    
gb|ABY68163.1|  catalase                                                166   3e-48    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 174   2e-47    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      173   2e-47    
emb|CDP22058.1|  unnamed protein product                                166   2e-47    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 174   2e-47    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             171   2e-46    
gb|ACU23083.1|  unknown                                                 163   8e-46    
ref|XP_005712277.1|  unnamed protein product                            167   8e-45    
gb|AEA86295.1|  putative catalase                                       156   1e-43    
ref|NP_973873.1|  catalase 3                                            161   8e-43    
gb|ABS89000.1|  catalase                                                154   9e-43    
gb|AAR25790.1|  catalase                                                152   1e-42    
gb|KEH36313.1|  catalase heme-binding enzyme                            160   1e-42    
gb|AFA36510.1|  catalase                                                148   8e-40    
gb|KJE89728.1|  catalase isozyme 2                                      154   1e-39    
ref|XP_004366029.2|  catalase isozyme 2                                 154   2e-39    
gb|ABS72010.1|  putative catalase                                       139   7e-38    
ref|XP_005644653.1|  catalase-domain-containing protein                 149   7e-38    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   2e-37    
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   6e-37    
gb|ACJ71245.1|  catalase 2                                              144   8e-37    
gb|AHB35639.1|  catalase                                                139   9e-37    
gb|ACY30463.1|  catalase                                                142   1e-36    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     142   1e-36    
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 135   3e-36    
gb|ADR01107.1|  catalase 3                                              142   4e-36    
gb|ACJ71244.1|  catalase 2                                              141   9e-36    
emb|CAA42026.1|  catalase                                               132   2e-35    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     140   3e-35    
ref|XP_005647994.1|  catalase-domain-containing protein                 139   2e-34    
gb|AAZ03546.1|  Catalase                                                133   2e-34    
ref|WP_032664185.1|  catalase                                           138   4e-34    
ref|WP_032632526.1|  catalase                                           137   5e-34    
ref|WP_015881004.1|  catalase                                           137   8e-34    
ref|WP_043304355.1|  catalase                                           137   8e-34    
gb|ABN79860.2|  catalase                                                133   9e-34    
gb|KIQ35234.1|  catalase                                                137   9e-34    
ref|WP_004887231.1|  catalase                                           137   1e-33    
ref|WP_026826608.1|  catalase                                           137   1e-33    
ref|WP_032610664.1|  catalase                                           136   2e-33    
ref|WP_016429054.1|  hypothetical protein                               136   2e-33    
ref|WP_029723487.1|  catalase                                           136   2e-33    
gb|KGS11078.1|  catalase                                                132   2e-33    
ref|WP_032632922.1|  catalase                                           134   6e-33    
ref|WP_038401366.1|  catalase                                           134   6e-33    
gb|EGH29791.1|  catalase                                                130   6e-33    
gb|AHG41775.1|  catalase                                                134   7e-33    
ref|WP_032622880.1|  catalase                                           134   9e-33    
ref|WP_031421259.1|  catalase                                           134   9e-33    
ref|WP_043193175.1|  catalase                                           134   9e-33    
ref|WP_044323073.1|  catalase                                           134   1e-32    
ref|WP_044321845.1|  catalase                                           133   2e-32    
ref|WP_032606634.1|  catalase                                           133   2e-32    
ref|WP_037022052.1|  catalase                                           133   2e-32    
gb|EQM67709.1|  catalase                                                133   2e-32    
ref|WP_044037961.1|  catalase                                           133   3e-32    
ref|WP_004665787.1|  MULTISPECIES: catalase                             133   3e-32    
ref|WP_041924592.1|  catalase                                           133   3e-32    



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 181/181 (100%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA
Sbjct  312  IDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQP
Sbjct  372  HHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT
Sbjct  432  GDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 181/181 (100%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA
Sbjct  312  IDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQP
Sbjct  372  HHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT
Sbjct  432  GDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   359 bits (922),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = -1

Query  709  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  530
            EM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDG
Sbjct  1    EMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDG  60

Query  529  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  350
            YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWA
Sbjct  61   YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWA  120

Query  349  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  191
            PDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  121  PDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKC 
Sbjct  243  IDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCP  302

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQP
Sbjct  303  HHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQP  362

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  363  GERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPS  422

Query  193  M  191
            +
Sbjct  423  I  423



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P PLR++TG+RDKC++EKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIVEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLNIRPT
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENE +A +PA +VPGIY+S+DK+LQARIFAY+DTHR+RLGPNY+ LPVNAPKCA
Sbjct  312  VDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P P +IVTG+R+K +IEKENNFKQP
Sbjct  372  HHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WISY TQAD+SLGQK+ASRL+ RP+
Sbjct  432  GERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGPNY++LPVNAPKC 
Sbjct  297  IDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCP  356

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  IEKENNFKQP
Sbjct  357  HRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQP  416

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP+
Sbjct  417  GERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPS  476

Query  193  M  191
            +
Sbjct  477  I  477



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +PAH+VPG+Y+SDDKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+ G+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGPNY++LPVNAPKC 
Sbjct  313  IDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCP  372

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  IEKENNFKQP
Sbjct  373  HRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQP  432

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP+
Sbjct  433  GERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPS  492

Query  193  M  191
            +
Sbjct  493  I  493



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVIHKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WISY +Q DRSLGQK+A+RLN++P+
Sbjct  432  GERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +PA +VPG+Y+S+DKMLQ R+FAY+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP P  I+TG+RDKCVIEKENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WISY +QADRS GQK+A+RLN+RP+
Sbjct  432  GERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP+
Sbjct  432  GERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDN+FAENEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKC 
Sbjct  81   IDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCN  140

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVIEKENNFKQP
Sbjct  141  YHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQP  200

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP 
Sbjct  201  GDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPN  260

Query  193  M  191
             
Sbjct  261  F  261



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENE +A +PA +VPGIYFS+DK+LQARIFAY+DTHR+RLGPNY+ LPVNAPKCA
Sbjct  312  VDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P P +IVTG+R++ +IEKENNFKQ 
Sbjct  372  HHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WISY TQAD+S+GQK+AS L+ RP+
Sbjct  432  GERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   294 bits (752),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDN+FAENEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKC 
Sbjct  90   IDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCN  149

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVIEKENNFKQP
Sbjct  150  YHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQP  209

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP 
Sbjct  210  GDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPN  269

Query  193  M  191
             
Sbjct  270  F  270



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG+RDKC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD++LGQK+ASRLN+RPT
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A +PAH+VPGIY+S+DK+LQ RIFAY+DTHRHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAYSDTHRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDGYMN +HRDEE+DYFPS++D  R+AER P P R++TGRR++ VIEKENNFKQP
Sbjct  372  HHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
             +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WISY +QAD+SLGQK+A RLN+RPT
Sbjct  432  VERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +PAH+VPGIY+SDDK+LQ RIFAY+DT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP+
Sbjct  432  GERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++LPVNAPKC 
Sbjct  111  IDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCP  170

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK P
Sbjct  171  HHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLP  230

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP 
Sbjct  231  GDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPN  290

Query  193  M  191
            +
Sbjct  291  I  291



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  203  IDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  262

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ 
Sbjct  263  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQA  322

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  323  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPT  382

Query  193  M  191
            M
Sbjct  383  M  383



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP P  I++G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  128  IDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  187

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC IEKENNFKQP
Sbjct  188  HHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQP  247

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP 
Sbjct  248  GERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPN  307

Query  193  M  191
            +
Sbjct  308  I  308



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE VA  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCV  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+P  I +GRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
             
Sbjct  492  F  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A  P  IVPGI FS+DKMLQ RIFAY DT RHRLGPNY+LLPVNAPKCA
Sbjct  312  IDNFFAENEMLAFSPHMIVPGINFSNDKMLQTRIFAYGDTQRHRLGPNYLLLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P P  ++TGRRD+ VIEKE+NFKQ 
Sbjct  372  YHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+SY +QAD+S GQK+ASRLN+RPT
Sbjct  432  GDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   298 bits (764),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVIHKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WISY +Q D+SLGQK+A+RLN++P 
Sbjct  432  GERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPC  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   298 bits (764),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P +I TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN++P+
Sbjct  432  GERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP+
Sbjct  432  GERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPS  491

Query  193  M  191
            +
Sbjct  492  V  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ R+F+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP P  + TG+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI+Y +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P  +++G+RDKCVI+KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPT
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP+
Sbjct  432  GERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+IEKENNFKQP
Sbjct  372  HHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WISY +QAD+SLG+K+ASRLN+RPT
Sbjct  432  GERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  164  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  223

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQP
Sbjct  224  HHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQP  283

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP+
Sbjct  284  GERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPS  343

Query  193  M  191
            +
Sbjct  344  I  344



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQP
Sbjct  372  FHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
            G+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  432  GERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQP
Sbjct  372  FHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
            G+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  432  GERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCT  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQP
Sbjct  372  HHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+
Sbjct  432  GERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P  +VTGRR+K +I KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSIINKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WISY +Q D+SLGQK+A+RLN++PT
Sbjct  432  GERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   296 bits (757),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF+ENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP P  ++TGRR+KCVI KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVIHKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WISY +Q DRSLGQK+A+RLN++P+
Sbjct  432  GERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y SDDK+LQ RIF+Y+D  RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  ++TG+RDKC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W SY +QAD++LGQK+ASRLN+RPT
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WISY +QAD+SLGQK+A+RLN++P+
Sbjct  432  GERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+IEKENNFKQP
Sbjct  372  HHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WISY +QAD+SLG+K+ASRLN+RPT
Sbjct  432  GERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+ASRLN+RP 
Sbjct  432  GDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPA  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+AS LN+RPT
Sbjct  432  GDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP P R++TG+R+KC+I KENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMISKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WISY +Q D+SL QK+A+RL+++P+
Sbjct  432  GERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKLATRLSVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++ GRR+ CVIEKENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P+ +VPGIYFSDDK+LQARIFAY DT RHR+GPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFSPSLVVPGIYFSDDKVLQARIFAYGDTQRHRIGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP P   + GRRD+ +IEKENNFKQP
Sbjct  372  HHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WISYL+QADRSLGQKVAS LN+RP+
Sbjct  432  GDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKVASHLNMRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP P  + TGRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WISY TQ D+ LGQK+A+RLN+RP+
Sbjct  432  GERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPPNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P R++ G+RD+C+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCIIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+SY +QAD+SLGQK+ASRLN++PT
Sbjct  432  GERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P RI+TGRR+KCVI+KENNFKQP
Sbjct  372  HHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WISY +Q D+SLG+K+A+RLN++P+
Sbjct  432  GERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  164  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  223

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+IEKENNFK+P
Sbjct  224  HHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEP  283

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP+
Sbjct  284  GERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPS  343

Query  193  M  191
            +
Sbjct  344  I  344



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TG+RD+C+IEKENNFKQP
Sbjct  372  HHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WISY TQAD+SLGQK+ASRLN+RPT
Sbjct  432  GERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGPNY+ LPVNAPKC 
Sbjct  404  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCT  463

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQP
Sbjct  464  HHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQP  523

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+
Sbjct  524  GERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPS  583

Query  193  M  191
            M
Sbjct  584  M  584



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I +GRR+KC IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L+ RP 
Sbjct  432  GERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP 
Sbjct  432  GERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP 
Sbjct  432  GERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   293 bits (751),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++LPVNAPKC 
Sbjct  307  IDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCP  366

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK P
Sbjct  367  HHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLP  426

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP 
Sbjct  427  GDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPN  486

Query  193  M  191
            +
Sbjct  487  I  487



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   287 bits (735),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  135  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  194

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNNS DG MNF+HRDEEVDY PS+FD  R AE++P P  ++ G R  CV  KENNFKQ 
Sbjct  195  HHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVTPKENNFKQA  254

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WISYL+QAD+S GQKVASRL ++P 
Sbjct  255  GERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKVASRLTVKPP  314

Query  193  M  191
            M
Sbjct  315  M  315



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP 
Sbjct  432  GERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  85   IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  144

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P   + G+RD+  IEKENNFKQP
Sbjct  145  HHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICIEKENNFKQP  204

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+SY TQAD+SLGQK+ASRLNIRPT
Sbjct  205  GEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPT  264

Query  193  M  191
            M
Sbjct  265  M  265



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  309  IDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  368

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ 
Sbjct  369  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQA  428

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI  L+QAD+S GQKVASRL ++PT
Sbjct  429  GERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKVASRLTLKPT  488

Query  193  M  191
            M
Sbjct  489  M  489



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP P  I+TG+RDKCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WISY +QADRS GQK+A+RLN+RP+
Sbjct  432  GERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  197  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  256

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ 
Sbjct  257  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQA  316

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  317  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  376

Query  193  M  191
            +
Sbjct  377  I  377



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++LPVNAPKC 
Sbjct  312  IDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK P
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKACIEKENNFKLP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+SY +QAD+SLGQK+ASRLN+RP 
Sbjct  432  GDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQKIASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENEM+A  P+ IVPGIYFS+DKMLQ RIFAYADT RHR+GPNY+ LPVNAPKC 
Sbjct  333  VDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAYADTQRHRIGPNYLQLPVNAPKCP  392

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R K VIEKENNFKQP
Sbjct  393  HHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVIEKENNFKQP  452

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+SY TQAD+SLGQK+ASRLN+RP 
Sbjct  453  GDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPA  512

Query  193  M  191
            M
Sbjct  513  M  513



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +PA +VPGIY+SDDK+LQ RIFAY+DT RHRLGPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAYSDTQRHRLGPNYMQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP P  I+TG+R++ VIEKENNFKQP
Sbjct  372  HHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WISY +QAD+SLGQK+A+RLN+RP+
Sbjct  432  GERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKIATRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP+
Sbjct  432  GERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P P  +++G+R+K  IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPT
Sbjct  432  GERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P RI+ G R+KC I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI+Y +Q D+ LGQK+ASRLNI+PT
Sbjct  432  GEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPT  491

Query  193  M  191
            +
Sbjct  492  L  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDN+FAENEM+A DP HIVPGI++S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKCA
Sbjct  312  IDNWFAENEMLAFDPGHIVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I +GRR+KCVIEKENNFKQP
Sbjct  372  YHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+SY ++ D SLGQK+ASRLN+RP 
Sbjct  432  GERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  320  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  379

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  380  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQP  439

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  440  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  499

Query  193  M  191
            +
Sbjct  500  I  500



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP P  + +GRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QA +SLGQK+ASRLN++P 
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGPNY+ +P NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN++P+
Sbjct  432  GERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  I  G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P P R++TG+R+K +IEKENNFKQP
Sbjct  372  HHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLNIRPT
Sbjct  432  GEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I +GRR++C+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  363  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  422

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  423  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQP  482

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  483  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  542

Query  193  M  191
            +
Sbjct  543  I  543



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  VDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDN+FAE E +A +PA +VPGIY+++DK+LQ RIFAY DT RHRLGPNYM LPVNAPKCA
Sbjct  312  IDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAYGDTQRHRLGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P P  ++ G+RD+CVI KENNFKQ 
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPT
Sbjct  432  GERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   290 bits (741),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  278  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  337

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ 
Sbjct  338  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQA  397

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  398  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  457

Query  193  M  191
            +
Sbjct  458  I  458



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  + TG+R++CVI+KENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVIQKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP+
Sbjct  432  GERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
             HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQP
Sbjct  372  QHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP 
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   290 bits (743),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
             HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQP
Sbjct  372  QHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP 
Sbjct  432  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P P RI+ G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P+
Sbjct  432  GERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGI +SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I TG R++C IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWISY +QADRSLGQK+AS LN+RP+
Sbjct  432  GERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+TGRR+KC+I KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRL  209
            G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL
Sbjct  432  GERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRL  486



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  296  IDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  355

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQP
Sbjct  356  HHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQP  415

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ +RLN+RP+
Sbjct  416  GERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLTARLNVRPS  475

Query  193  M  191
            +
Sbjct  476  I  476



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  376  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  435

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  436  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQP  495

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  496  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  555

Query  193  M  191
            +
Sbjct  556  I  556



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  332  IDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  391

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
             HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQP
Sbjct  392  QHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQP  451

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP 
Sbjct  452  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPN  511

Query  193  M  191
            +
Sbjct  512  I  512



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A +P  +VPGIY+SDDK LQAR FAY DT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTFAYGDTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P P ++V+G+R++CVIEKENNFKQP
Sbjct  372  HHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WISY +Q D+SLGQK+A+RLNI+P 
Sbjct  432  GDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQKIATRLNIKPH  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+AS LN+RP+
Sbjct  432  GERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+Y+DT RHRLGPNY+ LP NAPKC+
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIDKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP+
Sbjct  432  GERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  311  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  370

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQP
Sbjct  371  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQP  430

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  203
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  431  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  270  IDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  329

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R++C+IEKENNFKQP
Sbjct  330  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCIIEKENNFKQP  389

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  203
            G+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  390  GERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCIIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP+
Sbjct  432  GERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P P R++TG+R+K +IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WISY +QAD+SLGQK+ASRLNIRPT
Sbjct  432  GEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  313  IDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  372

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQP
Sbjct  373  HHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQP  432

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP+
Sbjct  433  GERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPS  492

Query  193  M  191
            +
Sbjct  493  I  493



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  + PGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVPPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVIKKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQP
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP+
Sbjct  432  GERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  310  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  369

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQP
Sbjct  370  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQP  429

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP+
Sbjct  430  GERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPS  489

Query  193  M  191
            +
Sbjct  490  I  490



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP N+PKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANSPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P R + G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P+
Sbjct  432  GERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>prf||2104177A catalase
Length=492

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVIEKENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
            G+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  432  GERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVIEKENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
            G+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  432  GERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  297  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  356

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  357  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  416

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP+
Sbjct  417  GERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPS  476

Query  193  M  191
            +
Sbjct  477  I  477



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI+KENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIQKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QADRS+GQK+AS LN+RP+
Sbjct  432  GERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+LLP NAPK A
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  + +GRR+K  IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP 
Sbjct  432  GERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI KENN KQ 
Sbjct  372  HHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP+
Sbjct  432  GERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI K+N+FKQP
Sbjct  372  FHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKIVIPKQNDFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+
Sbjct  432  GERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI K+N+FKQP
Sbjct  372  FHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKTVIPKQNDFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+
Sbjct  432  GERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI KENN KQ 
Sbjct  372  HHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  311  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  370

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  371  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  430

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  431  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  490

Query  193  M  191
            +
Sbjct  491  I  491



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P    TG R KCVI+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVIKKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  296  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  355

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQP
Sbjct  356  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQP  415

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP 
Sbjct  416  GERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPG  475

Query  193  M  191
            +
Sbjct  476  I  476



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP P +I +G+R+KC+IEKENNFKQP
Sbjct  372  HHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WISY +Q D+SLGQK+A+ LN++P 
Sbjct  432  GERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKLATHLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>prf||1906388A catalase
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGPNY+ +P NAPKCA
Sbjct  253  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCA  312

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IEKENNFKQP
Sbjct  313  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQP  372

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLN  206
            G+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN
Sbjct  373  GERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLN  428



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAE EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGPNY+ LPVNAPKCA
Sbjct  312  VDNFFAETEMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  I +G R KCVIEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+
Sbjct  432  GDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKVANRLNVRPS  491

Query  193  M  191
             
Sbjct  492  F  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  312  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ 
Sbjct  372  HHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  432  GERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQP
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQP
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC 
Sbjct  311  IDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCG  370

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ 
Sbjct  371  HHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQA  430

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PT
Sbjct  431  GERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPT  490

Query  193  M  191
            M
Sbjct  491  M  491



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDN+FAENEM+A +PAH+VPG+Y+S+DK+ Q R+FAY+DT RHRLG NY+ LPVNAPKC 
Sbjct  312  IDNWFAENEMLAFNPAHVVPGVYYSNDKLFQLRLFAYSDTQRHRLGTNYLQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P  I +GRR+KCVIEKE+NF+QP
Sbjct  372  YHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVIEKEDNFRQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+ASRLN+RP 
Sbjct  432  GDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  311  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  370

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQP
Sbjct  371  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQP  430

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  431  GDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  490

Query  193  M  191
            +
Sbjct  491  I  491



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGI++SDDK+LQ R+F+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P R++TG+R+KCVI KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVIGKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI+Y +Q D+SLGQK+A+RLN+RP+
Sbjct  432  GERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  305  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  364

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  365  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  424

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP 
Sbjct  425  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPN  484

Query  193  M  191
            +
Sbjct  485  I  485



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP 
Sbjct  432  GERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPG  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP 
Sbjct  432  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNF+QP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFQQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
            G+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  432  GERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI KENNFKQP
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVILKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  331  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  390

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQP
Sbjct  391  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQP  450

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP 
Sbjct  451  GERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPG  510

Query  193  M  191
            +
Sbjct  511  I  511



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  I +G+R++C+IEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCIIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+A+RLN+RP+
Sbjct  432  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  297  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  356

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  357  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  416

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+AS LN+RP+
Sbjct  417  GERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPS  476

Query  193  M  191
            +
Sbjct  477  I  477



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQP
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ R+F+YADT RHRLGPNY+ LPVN+PKC+
Sbjct  269  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCS  328

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  329  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  388

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+R +RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP 
Sbjct  389  GERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPN  448

Query  193  M  191
            +
Sbjct  449  I  449



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QAD SLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVIKKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P  I TGRR++ VI+KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRLN+RP+
Sbjct  432  GERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  173  VDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  232

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  233  HHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQA  292

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+
Sbjct  293  GERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPS  352

Query  193  M  191
            M
Sbjct  353  M  353



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  159  IDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCA  218

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P P   +TGRRDK VI KENNFKQP
Sbjct  219  HHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRDKTVIAKENNFKQP  278

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+S  +QADRSLGQK+ASRL+ +P+
Sbjct  279  GERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSLGQKLASRLSAKPS  338

Query  193  M  191
            M
Sbjct  339  M  339



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P P  + TG+R++CVIEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  200
            G+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLGQK+ASRLN++
Sbjct  432  GERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  312  IDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+
Sbjct  432  GERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  312  IDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+
Sbjct  432  GERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNF AENE +A  PA IVPGIY+SDDK+LQ R+F+YADT RHRLGPNY+ LPVN+PKC+
Sbjct  312  IDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP 
Sbjct  432  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+LLP NAPK A
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K  IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP 
Sbjct  432  GERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI KENNFK+P
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W SY  +ADRSLGQK+ASRLN+RP+
Sbjct  432  GDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPGI +S+DK+LQ RIF+Y+DT RHRLG NY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSYSDTQRHRLGSNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP P  I +GRRDKCVIEKENNF+QP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVIEKENNFEQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WISY TQ DRSLGQK+A RLN+RP+
Sbjct  432  GERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKLAFRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI KENNFK+P
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPK A
Sbjct  312  IDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKSA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++ GRR+KC+I KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMIAKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++Y  QAD+SLGQK+ASRLN+RP 
Sbjct  432  GERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  300  IDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  359

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  360  HHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  419

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  420  GERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  479

Query  193  M  191
            +
Sbjct  480  I  480



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  122  IDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  181

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I+KENNFKQ 
Sbjct  182  HHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQA  241

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+ASRL I+P 
Sbjct  242  GERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPN  301

Query  193  M  191
            M
Sbjct  302  M  302



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDN+FAENEM+A +PAH+VPGI++S+DK+ Q R FAY+DT RHRLGPNYM LPVNAPKC 
Sbjct  312  IDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTFAYSDTQRHRLGPNYMQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P P  I++GRR+KCVI KENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAIISGRREKCVIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+SY +Q D+SLGQK+ASRLN+RP 
Sbjct  432  GERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSYWSQCDQSLGQKLASRLNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPG+++SDDKMLQ RIF+Y+D+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSYSDSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+RD+C IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPT
Sbjct  432  GERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQ 
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNFKQ 
Sbjct  372  YHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNFKQ 
Sbjct  372  YHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI KENNFKQ 
Sbjct  372  YHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVINKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPPNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++TGRR+K VI KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RPT
Sbjct  432  GERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD  RHRLGPNY+LLP NAPK A
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADPQRHRLGPNYLLLPANAPKSA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K  IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP 
Sbjct  432  GERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNF QP
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFNQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P P  ++ G RD+ +I+KENNFKQP
Sbjct  372  HHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQIIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WISY +QAD+S+G K+ASRLN+RPT
Sbjct  432  GERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKLASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  295  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  354

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQP
Sbjct  355  HHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQP  414

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  415  GERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  474

Query  193  M  191
            +
Sbjct  475  I  475



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            ID+FFAENE +A  P  IVPGI++SDDK+LQ R+F+Y+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + +GRR++C+IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCIIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASR+N+RP 
Sbjct  432  GERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPN  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  IVPG+Y+++DK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    TG+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WISY +Q D+SLGQK+A+RLN++  
Sbjct  432  GERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKIAARLNMKAN  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAE EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGPNY+ LPVNAPKCA
Sbjct  312  VDNFFAETEMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  + +G R KCVIEKENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+
Sbjct  432  GERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKVANRLNVRPS  491

Query  193  M  191
             
Sbjct  492  F  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A+ PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNF+Q 
Sbjct  372  YHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P P  ++TGRR+K +I KENNFKQP
Sbjct  372  HHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLNIRP+
Sbjct  432  GERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNF+Q 
Sbjct  372  YHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNF+Q 
Sbjct  372  YHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P+ IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  I +G+R+KC+I+KENNF+QP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCIIDKENNFQQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY ++AD+SLGQK+ASRL++RP+
Sbjct  432  GERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G R++CVI KENNFK+P
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVIAKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFF ENE +A DPAH+VPGIYFS+DKMLQAR FAYADTHR+RLG NY+ LPVNAPKC 
Sbjct  312  VDNFFTENEQLAFDPAHVVPGIYFSNDKMLQARTFAYADTHRYRLGINYLQLPVNAPKCP  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            + N   DG MN VHRDEE+DYFPS+FD  R AERFP P  I+ GRR+K +I KENNFK+P
Sbjct  372  HTNMHRDGAMNMVHRDEEIDYFPSRFDPLREAERFPIPTAIIHGRREKQIIPKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G RYRSW P RQDRF+ R+VK+LS+PR+T+EIRS W+SYLTQAD+SLG KVASRLNIRPT
Sbjct  432  GVRYRSWDPARQDRFVGRFVKALSDPRLTYEIRSIWVSYLTQADKSLGMKVASRLNIRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  +VPG+ +S+DK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+A+RLN++P+
Sbjct  432  GERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNF  ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  305  IDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  364

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQP
Sbjct  365  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQP  424

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  425  GERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  484

Query  193  M  191
            +
Sbjct  485  I  485



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  312  IDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQP
Sbjct  372  HHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVNLTGRREKTVIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+
Sbjct  432  GERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENE +A  P  +VPGIY+SDDK+LQ R+FAY D  R+RLG NYM+LPVNAPKCA
Sbjct  312  VDNFFAENEQLAFSPGVVVPGIYYSDDKLLQCRVFAYGDAQRYRLGANYMMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P   ++ TG+R+K VI KENNFKQP
Sbjct  372  HHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVIPKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+SYL+Q DRSLG KVA+RLN+RPT
Sbjct  432  GDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKVATRLNMRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WISY +Q+D+SLGQK+A+RLN++  
Sbjct  432  GERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKIAARLNMKAN  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 163/185 (88%), Gaps = 4/185 (2%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLN  206
            G RYRS+ PD    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN
Sbjct  432  GGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLN  491

Query  205  IRPTM  191
            +RP++
Sbjct  492  VRPSI  496



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  312  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQP
Sbjct  372  HHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  + +G+R+KC+I KENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCIIGKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  432  GERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  VDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+
Sbjct  432  GERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT R+RLGPNY+ LPVNAPKCA
Sbjct  225  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRYRLGPNYLQLPVNAPKCA  284

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            YHNN +DG+MNF+ RDEE++YFPS+ D TR+AER+P P  + TG+R++CVIEKENNFKQP
Sbjct  285  YHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVIEKENNFKQP  344

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  200
            G+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLG K+AS  N++
Sbjct  345  GERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKLASHFNLK  402



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 164/185 (89%), Gaps = 4/185 (2%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLN  206
            G+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN
Sbjct  432  GERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLN  491

Query  205  IRPTM  191
            +RP++
Sbjct  492  VRPSI  496



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            +DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  VDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+
Sbjct  432  GERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKC+
Sbjct  312  IDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCS  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P P R + GRR+K VIEKENNFKQP
Sbjct  372  HHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRTLNGRREKMVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QADRSLGQK+A RL+++P+
Sbjct  432  GERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADRSLGQKLAGRLSVKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE+ P P    +  R+KC I K+NNFKQP
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTANFSACREKCNIPKQNNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSWAPDRQDRF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP+
Sbjct  432  GERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNMRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+P
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI Y +QAD++ GQK+ASRLN+RP+
Sbjct  432  GERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKLASRLNVRPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD TR+A+++P P R++TG R+KC+IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRVLTGCREKCIIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+ RVTHEI+  WISY +Q D SLGQK+ SRL  +P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWISYWSQCDTSLGQKLGSRLKAKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   278 bits (711),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  218  IDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  277

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I+KENNFKQ 
Sbjct  278  HHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQA  337

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+ASRL I+P 
Sbjct  338  GERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPN  397

Query  193  M  191
            M
Sbjct  398  M  398



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPK A
Sbjct  312  IDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKNA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+A++ P P    +GRR+K  IEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKVPIPSVPFSGRREKVSIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRSW PDRQ+RFI RWV +LS+PR+T EIRS WISY TQAD+SLGQK+ASRLN+RPT
Sbjct  432  GERYRSWDPDRQERFIRRWVDALSDPRLTQEIRSIWISYWTQADKSLGQKLASRLNVRPT  491

Query  193  M  191
            M
Sbjct  492  M  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD TR+AE+ P P R++TG R+KC+IEKENNFKQ 
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCREKCIIEKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+R+RS+ P RQDRFI RWV +LS+PRVTHE  + WI+Y +Q D SLGQK+ASRLN++P 
Sbjct  432  GERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWINYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF+ENE +A  P  +VPGIY+SDDKMLQ R FAY DT R+RLGPNY++LPVNAPKCA
Sbjct  312  IDNFFSENEQLAFSPGIVVPGIYYSDDKMLQCRTFAYGDTQRYRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            + N+ YDG MNF+HRDEEV+YFPS+ D  R+AER+P   RIVTGRR+KC+IEK+N+FKQP
Sbjct  372  HKNSHYDGLMNFMHRDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKCIIEKQNDFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            GDRYRSWA DRQ+RF+ RWV++L+ P+V+HE+RS W+SYL+++D SLGQKVA+RLN++P+
Sbjct  432  GDRYRSWAHDRQERFVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQKVANRLNMKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A     +VPGI++SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEMLAFS-MSLVPGIHYSDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCP  370

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQ  377
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ
Sbjct  371  HHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQ  430

Query  376  PGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
             GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP
Sbjct  431  AGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRP  490

Query  196  TM  191
             +
Sbjct  491  NI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA
Sbjct  304  IDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCA  363

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNF+QP
Sbjct  364  HHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCIIQKENNFQQP  423

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++ DRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  424  GERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS  483

Query  193  M  191
            +
Sbjct  484  I  484



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENEM+A     +VPGI++SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC 
Sbjct  312  IDNFFAENEMLAFS-MSLVPGIHYSDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCP  370

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQ  377
            +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ
Sbjct  371  HHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQ  430

Query  376  PGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  197
             GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP
Sbjct  431  AGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRP  490

Query  196  TM  191
             +
Sbjct  491  NI  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA
Sbjct  312  IDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TGRRD+C+++KENNFKQP
Sbjct  372  HHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPLPPPMLTGRRDRCMVQKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS++ DRQ+RFI+R V +LS+PRVTHEIRS WISY TQA +SLGQK+ASRLN++P+
Sbjct  432  GERYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWISYWTQACKSLGQKLASRLNVKPS  491

Query  193  M  191
            +
Sbjct  492  I  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  312  IDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P     GRR+K VIEKENNFKQP
Sbjct  372  HHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSSTCNGRREKMVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS  P RQ+RFINRW+ +LS+PR+THEI+S W+SY +QADRSLGQK+ASRL+ +P+
Sbjct  432  GERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLSYWSQADRSLGQKLASRLSAKPS  491

Query  193  M  191
            M
Sbjct  492  M  492



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA
Sbjct  160  IDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCA  219

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HR EEVDYFPS++D  RNA R+P P   + GRR+K VI KENNFKQP
Sbjct  220  HHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAHIAGRREKTVISKENNFKQP  279

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR+  P RQ+RFI RWV +LS+PR+THEIR+ W+S  +QADRSLGQK+ASRL+ +P+
Sbjct  280  GERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWSQADRSLGQKLASRLSAKPS  339

Query  193  M  191
            M
Sbjct  340  M  340



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   281 bits (719),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKC+
Sbjct  346  IDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCS  405

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P R + GRR+K VIEKENNFKQP
Sbjct  406  HHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKMVIEKENNFKQP  465

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QAD+SLGQK+ASRL+ +P+
Sbjct  466  GERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKLASRLSSKPS  525

Query  193  M  191
            M
Sbjct  526  M  526



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA
Sbjct  312  IDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ 
Sbjct  372  HHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQA  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P 
Sbjct  432  GERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPN  491

Query  193  M  191
            M
Sbjct  492  M  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKC 
Sbjct  300  IDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCG  359

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+++  R+AE++PTP  +  G+R++CVIEKENNFK+P
Sbjct  360  HHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRERCVIEKENNFKEP  419

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYR + P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+AS LN+RP 
Sbjct  420  GERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASHLNVRPN  479

Query  193  M  191
            +
Sbjct  480  I  480



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  IDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCA  554
            IDNFFAENE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA
Sbjct  312  IDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCA  371

Query  553  YHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQP  374
            +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+KCVIEKENNFKQP
Sbjct  372  HHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQP  431

Query  373  GDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  194
            G+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WI Y +Q+D+SLGQK+A+RLN++  
Sbjct  432  GERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFYWSQSDKSLGQKIAARLNMKAN  491

Query  193  M  191
            M
Sbjct  492  M  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485