BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF018B04

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775127.1|  PREDICTED: RING-H2 finger protein ATL80-like       150   2e-41   Nicotiana sylvestris
ref|XP_009601753.1|  PREDICTED: RING-H2 finger protein ATL80-like       148   3e-40   Nicotiana tomentosiformis
ref|XP_009772742.1|  PREDICTED: RING-H2 finger protein ATL8-like ...    150   4e-40   Nicotiana sylvestris
ref|XP_009604464.1|  PREDICTED: RING-H2 finger protein ATL80-like       146   1e-39   Nicotiana tomentosiformis
ref|XP_009772735.1|  PREDICTED: RING-H2 finger protein ATL8-like ...    149   1e-39   Nicotiana sylvestris
ref|XP_004232585.1|  PREDICTED: RING-H2 finger protein ATL8-like        146   1e-39   Solanum lycopersicum
ref|XP_009772726.1|  PREDICTED: RING-H2 finger protein ATL80-like       145   3e-39   Nicotiana sylvestris
emb|CDP01769.1|  unnamed protein product                                146   5e-39   Coffea canephora [robusta coffee]
gb|AFW90598.1|  E3 ubiquitin ligase                                     144   7e-39   Solanum tuberosum [potatoes]
ref|XP_002526834.1|  protein with unknown function                      140   4e-37   Ricinus communis
ref|XP_002887637.1|  hypothetical protein ARALYDRAFT_316562             139   7e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_002526830.1|  protein with unknown function                      140   1e-36   
ref|XP_009359625.1|  PREDICTED: RING-H2 finger protein ATL80-like...    139   2e-36   
ref|XP_009359623.1|  PREDICTED: RING-H2 finger protein ATL80-like...    139   3e-36   Pyrus x bretschneideri [bai li]
gb|KJB14191.1|  hypothetical protein B456_002G113500                    137   4e-36   Gossypium raimondii
ref|XP_011074071.1|  PREDICTED: RING-H2 finger protein ATL80-like       137   4e-36   
ref|XP_006302871.1|  hypothetical protein CARUB_v10021002mg             137   6e-36   Capsella rubella
gb|KDP36758.1|  hypothetical protein JCGZ_08049                         136   1e-35   Jatropha curcas
ref|XP_008379650.1|  PREDICTED: RING-H2 finger protein ATL80-like       137   1e-35   Malus domestica [apple tree]
ref|XP_004253245.1|  PREDICTED: RING-H2 finger protein ATL80-like       135   1e-35   Solanum lycopersicum
ref|XP_002307200.1|  hypothetical protein POPTR_0005s10190g             136   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008392292.1|  PREDICTED: RING-H2 finger protein ATL80-like       136   2e-35   
ref|XP_002266865.1|  PREDICTED: RING-H2 finger protein ATL80-like       134   2e-35   Vitis vinifera
ref|XP_002301903.1|  zinc finger family protein                         135   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002274304.2|  PREDICTED: RING-H2 finger protein ATL8             136   2e-35   
ref|XP_010534292.1|  PREDICTED: RING-H2 finger protein ATL80-like       135   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_006342165.1|  PREDICTED: RING-H2 finger protein ATL80-like       135   3e-35   Solanum tuberosum [potatoes]
gb|KDP43788.1|  hypothetical protein JCGZ_22415                         135   3e-35   Jatropha curcas
ref|XP_011100182.1|  PREDICTED: RING-H2 finger protein ATL80-like       135   3e-35   Sesamum indicum [beniseed]
ref|XP_011022135.1|  PREDICTED: RING-H2 finger protein ATL8-like        135   3e-35   Populus euphratica
ref|XP_009338623.1|  PREDICTED: RING-H2 finger protein ATL80-like       135   5e-35   
ref|XP_010416561.1|  PREDICTED: RING-H2 finger protein ATL8             134   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007018117.1|  RING/U-box superfamily protein, putative           134   7e-35   Theobroma cacao [chocolate]
ref|NP_177767.1|  RING-H2 finger protein ATL8                           134   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63811.1|  putative RING zinc finger protein                       134   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532473.1|  protein with unknown function                      134   7e-35   
gb|EPS68943.1|  hypothetical protein M569_05824                         134   1e-34   Genlisea aurea
ref|XP_010428701.1|  PREDICTED: RING-H2 finger protein ATL8-like        133   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002276539.1|  PREDICTED: RING-H2 finger protein ATL80            133   1e-34   Vitis vinifera
ref|XP_010471794.1|  PREDICTED: RING-H2 finger protein ATL8-like        133   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008242103.1|  PREDICTED: RING-H2 finger protein ATL8             134   1e-34   Prunus mume [ume]
ref|XP_004238452.1|  PREDICTED: RING-H2 finger protein ATL80-like       133   2e-34   Solanum lycopersicum
ref|XP_004287710.1|  PREDICTED: RING-H2 finger protein ATL8             133   2e-34   Fragaria vesca subsp. vesca
ref|XP_006390200.1|  hypothetical protein EUTSA_v10019183mg             133   2e-34   Eutrema salsugineum [saltwater cress]
emb|CAN59779.1|  hypothetical protein VITISV_024654                     136   2e-34   Vitis vinifera
ref|XP_011034822.1|  PREDICTED: RING-H2 finger protein ATL8-like        133   2e-34   Populus euphratica
ref|XP_002510714.1|  protein with unknown function                      132   2e-34   Ricinus communis
ref|XP_009766634.1|  PREDICTED: RING-H2 finger protein ATL8-like        132   3e-34   Nicotiana sylvestris
ref|XP_006366657.1|  PREDICTED: RING-H2 finger protein ATL80-like       132   3e-34   Solanum tuberosum [potatoes]
gb|KFK42061.1|  hypothetical protein AALP_AA2G206300                    132   3e-34   Arabis alpina [alpine rockcress]
ref|XP_010270525.1|  PREDICTED: RING-H2 finger protein ATL80            131   6e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010266252.1|  PREDICTED: RING-H2 finger protein ATL80            131   7e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010498523.1|  PREDICTED: RING-H2 finger protein ATL80-like       131   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010537218.1|  PREDICTED: RING-H2 finger protein ATL80-like       130   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_009104676.1|  PREDICTED: RING-H2 finger protein ATL8-like        130   1e-33   Brassica rapa
ref|XP_008449155.1|  PREDICTED: RING-H2 finger protein ATL80            130   1e-33   Cucumis melo [Oriental melon]
ref|XP_006435418.1|  hypothetical protein CICLE_v10004041mg             130   2e-33   Citrus clementina [clementine]
gb|KDO85202.1|  hypothetical protein CISIN_1g043163mg                   130   2e-33   Citrus sinensis [apfelsine]
gb|ABK56013.1|  zinc finger protein                                     130   2e-33   Brassica rapa
emb|CDY01352.1|  BnaA07g11250D                                          130   2e-33   
emb|CDY33648.1|  BnaC08g19480D                                          130   2e-33   Brassica napus [oilseed rape]
emb|CDY45988.1|  BnaA02g18080D                                          130   2e-33   Brassica napus [oilseed rape]
ref|XP_009103326.1|  PREDICTED: RING-H2 finger protein ATL80-like       130   2e-33   Brassica rapa
ref|XP_006342531.1|  PREDICTED: RING-H2 finger protein ATL80-like       130   2e-33   Solanum tuberosum [potatoes]
ref|XP_009595867.1|  PREDICTED: RING-H2 finger protein ATL80            130   2e-33   Nicotiana tomentosiformis
ref|NP_173506.1|  RING-H2 finger protein ATL80                          130   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ADW66128.1|  RING-H2 finger protein RHA3b                            129   2e-33   Solanum nigrum
ref|XP_008453009.1|  PREDICTED: RING-H2 finger protein ATL80            130   2e-33   Cucumis melo [Oriental melon]
ref|XP_011041176.1|  PREDICTED: RING-H2 finger protein ATL8             130   2e-33   Populus euphratica
ref|XP_007202550.1|  hypothetical protein PRUPE_ppa011201mg             130   3e-33   Prunus persica
ref|XP_004253118.1|  PREDICTED: RING-H2 finger protein ATL8-like        130   3e-33   Solanum lycopersicum
gb|ADI71977.1|  E3 ubiquitin ligase                                     130   3e-33   Capsicum annuum
ref|XP_010029567.1|  PREDICTED: RING-H2 finger protein ATL8-like        130   3e-33   Eucalyptus grandis [rose gum]
ref|XP_007046460.1|  Basic helix-loop-helix DNA-binding superfami...    129   3e-33   
ref|XP_006303328.1|  hypothetical protein CARUB_v10010177mg             130   4e-33   
emb|CDX68098.1|  BnaA07g21380D                                          129   4e-33   
gb|EYU23603.1|  hypothetical protein MIMGU_mgv1a014346mg                129   5e-33   Erythranthe guttata [common monkey flower]
ref|XP_004512286.1|  PREDICTED: RING-H2 finger protein ATL8-like        130   6e-33   Cicer arietinum [garbanzo]
emb|CDX87603.1|  BnaA07g32700D                                          129   6e-33   
ref|XP_004145558.1|  PREDICTED: RING-H2 finger protein ATL80-like       128   8e-33   Cucumis sativus [cucumbers]
ref|XP_010477335.1|  PREDICTED: RING-H2 finger protein ATL80            129   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004234505.1|  PREDICTED: RING-H2 finger protein ATL8-like        128   9e-33   Solanum lycopersicum
emb|CDY29504.1|  BnaA06g14660D                                          129   9e-33   Brassica napus [oilseed rape]
ref|XP_006416360.1|  hypothetical protein EUTSA_v10009964mg             129   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009149561.1|  PREDICTED: RING-H2 finger protein ATL80            128   1e-32   Brassica rapa
ref|XP_010462813.1|  PREDICTED: RING-H2 finger protein ATL80-like       129   1e-32   
emb|CDX85948.1|  BnaC06g21860D                                          128   1e-32   
ref|XP_003537694.1|  PREDICTED: RING-H2 finger protein ATL8-like        129   2e-32   Glycine max [soybeans]
ref|XP_003612411.1|  Ring finger protein                                128   2e-32   Medicago truncatula
ref|XP_009795598.1|  PREDICTED: RING-H2 finger protein ATL80-like       127   2e-32   Nicotiana sylvestris
ref|XP_009620555.1|  PREDICTED: RING-H2 finger protein ATL80-like       127   2e-32   Nicotiana tomentosiformis
ref|XP_009589982.1|  PREDICTED: RING-H2 finger protein ATL8-like        127   3e-32   Nicotiana tomentosiformis
emb|CDX88272.1|  BnaC06g37160D                                          127   3e-32   
ref|XP_009110211.1|  PREDICTED: RING-H2 finger protein ATL80            127   3e-32   Brassica rapa
ref|XP_004159747.1|  PREDICTED: RING-H2 finger protein ATL80-like       126   6e-32   
ref|NP_001241583.1|  uncharacterized protein LOC100794614               126   6e-32   Glycine max [soybeans]
ref|XP_009106302.1|  PREDICTED: RING-H2 finger protein ATL8             126   6e-32   Brassica rapa
ref|XP_004146217.1|  PREDICTED: RING-H2 finger protein ATL80-like       126   6e-32   Cucumis sativus [cucumbers]
ref|XP_002306993.2|  hypothetical protein POPTR_0005s27660g             126   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_004509462.1|  PREDICTED: RING-H2 finger protein ATL80-like       127   6e-32   Cicer arietinum [garbanzo]
ref|XP_002890411.1|  zinc finger family protein                         126   6e-32   
ref|XP_006343322.1|  PREDICTED: RING-H2 finger protein ATL8-like        125   9e-32   Solanum tuberosum [potatoes]
emb|CDY31495.1|  BnaC05g16040D                                          126   9e-32   Brassica napus [oilseed rape]
emb|CDX96619.1|  BnaA08g21620D                                          126   1e-31   
ref|XP_003629097.1|  Ring finger protein                                125   1e-31   Medicago truncatula
ref|XP_010935347.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    125   1e-31   
ref|XP_009776172.1|  PREDICTED: RING-H2 finger protein ATL8-like        125   2e-31   Nicotiana sylvestris
ref|XP_010686796.1|  PREDICTED: RING-H2 finger protein ATL80            124   5e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK44194.1|  hypothetical protein AALP_AA1G226700                    124   6e-31   Arabis alpina [alpine rockcress]
ref|XP_007156261.1|  hypothetical protein PHAVU_003G271400g             124   7e-31   Phaseolus vulgaris [French bean]
ref|XP_003527275.1|  PREDICTED: RING-H2 finger protein ATL80-like       123   8e-31   Glycine max [soybeans]
ref|XP_010094527.1|  RING-H2 finger protein ATL80                       122   2e-30   Morus notabilis
ref|XP_007135973.1|  hypothetical protein PHAVU_009G007400g             122   2e-30   Phaseolus vulgaris [French bean]
ref|XP_003517122.1|  PREDICTED: RING-H2 finger protein ATL8-like        122   3e-30   Glycine max [soybeans]
ref|XP_010908037.1|  PREDICTED: RING-H2 finger protein ATL8-like        122   3e-30   
ref|XP_009128176.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    122   5e-30   Brassica rapa
ref|XP_003547882.1|  PREDICTED: RING-H2 finger protein ATL80-like       120   1e-29   Glycine max [soybeans]
ref|XP_003533404.1|  PREDICTED: RING-H2 finger protein ATL80-like       120   2e-29   Glycine max [soybeans]
ref|XP_009413072.1|  PREDICTED: RING-H2 finger protein ATL80-like       119   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004500836.1|  PREDICTED: RING-H2 finger protein ATL80-like       119   4e-29   Cicer arietinum [garbanzo]
ref|XP_007158027.1|  hypothetical protein PHAVU_002G118000g             119   9e-29   Phaseolus vulgaris [French bean]
ref|XP_003603861.1|  RING-H2 finger protein ATL1B                       118   9e-29   Medicago truncatula
ref|XP_008812592.1|  PREDICTED: RING-H2 finger protein ATL80-like       116   4e-28   Phoenix dactylifera
ref|XP_008779008.1|  PREDICTED: RING-H2 finger protein ATL8-like        115   8e-28   Phoenix dactylifera
ref|XP_009420835.1|  PREDICTED: RING-H2 finger protein ATL8-like        114   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011014772.1|  PREDICTED: RING-H2 finger protein ATL80-like       114   3e-27   Populus euphratica
ref|XP_009395296.1|  PREDICTED: RING-H2 finger protein ATL8-like        114   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010064613.1|  PREDICTED: RING-H2 finger protein ATL80            113   6e-27   Eucalyptus grandis [rose gum]
ref|XP_008804625.1|  PREDICTED: RING-H2 finger protein ATL8             112   8e-27   Phoenix dactylifera
ref|XP_009410155.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    110   4e-26   
gb|KHN20089.1|  RING-H2 finger protein ATL80                            109   5e-26   Glycine soja [wild soybean]
ref|XP_010432277.1|  PREDICTED: RING-H2 finger protein ATL45-like       111   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008786682.1|  PREDICTED: RING-H2 finger protein ATL44            110   7e-26   Phoenix dactylifera
ref|XP_002310694.2|  hypothetical protein POPTR_0007s08550g             109   9e-26   
ref|XP_009372616.1|  PREDICTED: RING-H2 finger protein ATL80            109   1e-25   Pyrus x bretschneideri [bai li]
emb|CDX72540.1|  BnaC07g45620D                                          110   1e-25   
ref|XP_008373388.1|  PREDICTED: RING-H2 finger protein ATL8             108   3e-25   
ref|XP_006409305.1|  hypothetical protein EUTSA_v10023141mg             107   6e-25   Eutrema salsugineum [saltwater cress]
ref|NP_179337.1|  RING-H2 finger protein ATL44                          107   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572834.1|  PREDICTED: RING-H2 finger protein ATL80-like       107   9e-25   Brachypodium distachyon [annual false brome]
emb|CDY41651.1|  BnaC03g62330D                                          107   9e-25   Brassica napus [oilseed rape]
ref|XP_006298646.1|  hypothetical protein CARUB_v10014735mg             107   1e-24   Capsella rubella
ref|XP_009401006.1|  PREDICTED: RING-H2 finger protein ATL45            106   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010911522.1|  PREDICTED: RING-H2 finger protein ATL44-like       107   1e-24   Elaeis guineensis
ref|XP_010446920.1|  PREDICTED: RING-H2 finger protein ATL45-like       107   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002886113.1|  ring-H2 finger A3A                                 106   3e-24   
ref|XP_009109289.1|  PREDICTED: RING-H2 finger protein ATL45-like       106   3e-24   Brassica rapa
ref|XP_010515011.1|  PREDICTED: RING-H2 finger protein ATL44            106   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010467517.1|  PREDICTED: RING-H2 finger protein ATL44-like       105   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008237931.1|  PREDICTED: RING-H2 finger protein ATL80-like       105   4e-24   Prunus mume [ume]
ref|NP_001130972.1|  uncharacterized LOC100192077                       105   4e-24   Zea mays [maize]
ref|XP_009382752.1|  PREDICTED: RING-H2 finger protein ATL8-like        105   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412098.1|  hypothetical protein EUTSA_v10027339mg             105   6e-24   Eutrema salsugineum [saltwater cress]
ref|XP_009383554.1|  PREDICTED: RING-H2 finger protein ATL45-like       104   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953481.1|  PREDICTED: RING-H2 finger protein ATL8-like        104   1e-23   Setaria italica
ref|XP_007209706.1|  hypothetical protein PRUPE_ppa012461mg             103   1e-23   Prunus persica
ref|XP_002867072.1|  ring-H2 finger A3B                                 104   1e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006285317.1|  hypothetical protein CARUB_v10006700mg             103   2e-23   Capsella rubella
ref|XP_010489373.1|  PREDICTED: RING-H2 finger protein ATL44-like       103   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010437466.1|  PREDICTED: RING-H2 finger protein ATL45-like       103   3e-23   Camelina sativa [gold-of-pleasure]
ref|NP_195273.1|  putative RING-H2 finger protein RHA3b                 103   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150790.1|  PREDICTED: RING-H2 finger protein ATL44-like       102   5e-23   Brassica rapa
ref|XP_009138362.1|  PREDICTED: RING-H2 finger protein ATL45-like       102   7e-23   Brassica rapa
gb|KCW68133.1|  hypothetical protein EUGRSUZ_F01804                     100   7e-23   Eucalyptus grandis [rose gum]
ref|XP_002465936.1|  hypothetical protein SORBIDRAFT_01g048530          101   1e-22   Sorghum bicolor [broomcorn]
ref|XP_010530985.1|  PREDICTED: RING-H2 finger protein ATL44-like       101   2e-22   Tarenaya hassleriana [spider flower]
emb|CDY69366.1|  BnaAnng30200D                                          101   2e-22   Brassica napus [oilseed rape]
ref|XP_002520866.1|  RING-H2 finger protein ATL3C, putative             101   2e-22   
emb|CDX69143.1|  BnaC01g03100D                                          100   3e-22   
gb|KFK40135.1|  hypothetical protein AALP_AA3G335200                    100   3e-22   Arabis alpina [alpine rockcress]
ref|XP_009400319.1|  PREDICTED: RING-H2 finger protein ATL8-like      99.4    3e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75506.1|  BnaA01g01960D                                          100   3e-22   
emb|CDY49431.1|  BnaC07g06500D                                          100   5e-22   Brassica napus [oilseed rape]
ref|XP_009384604.1|  PREDICTED: RING-H2 finger protein ATL44-like     99.8    6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985867.1|  PREDICTED: RING-H2 finger protein ATL8-like        100   9e-22   Setaria italica
ref|XP_010103646.1|  RING-H2 finger protein ATL73                       100   1e-21   
ref|XP_009101519.1|  PREDICTED: RING-H2 finger protein ATL45            100   1e-21   Brassica rapa
emb|CDY24337.1|  BnaA07g02620D                                        99.4    1e-21   Brassica napus [oilseed rape]
ref|XP_002452741.1|  hypothetical protein SORBIDRAFT_04g031560        99.0    1e-21   Sorghum bicolor [broomcorn]
gb|ABK25761.1|  unknown                                               99.8    1e-21   Picea sitchensis
gb|ABK22591.1|  unknown                                               99.4    2e-21   Picea sitchensis
ref|XP_006649211.1|  PREDICTED: RING-H2 finger protein ATL80-like     99.4    2e-21   
ref|NP_001147382.1|  RING-H2 finger protein ATL1R                     98.6    2e-21   Zea mays [maize]
ref|NP_001168249.1|  uncharacterized LOC100382012                     98.2    3e-21   Zea mays [maize]
ref|XP_009121114.1|  PREDICTED: RING-H2 finger protein ATL44          99.0    3e-21   Brassica rapa
ref|NP_001047768.1|  Os02g0686100                                     98.2    3e-21   
ref|XP_002271473.1|  PREDICTED: RING-H2 finger protein ATL74          97.1    7e-21   Vitis vinifera
ref|XP_010931361.1|  PREDICTED: RING-H2 finger protein ATL74-like     96.7    8e-21   Elaeis guineensis
ref|XP_010690732.1|  PREDICTED: RING-H2 finger protein ATL80-like     96.7    1e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21651.1|  hypothetical protein JCGZ_03322                       97.1    1e-20   Jatropha curcas
ref|XP_010922739.1|  PREDICTED: RING-H2 finger protein ATL74-like     95.5    2e-20   Elaeis guineensis
ref|XP_010252063.1|  PREDICTED: RING-H2 finger protein ATL74          95.9    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010237950.1|  PREDICTED: RING-H2 finger protein ATL74-like     95.9    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_008792228.1|  PREDICTED: RING-H2 finger protein ATL74-like     95.1    3e-20   Phoenix dactylifera
ref|XP_003533659.1|  PREDICTED: RING-H2 finger protein ATL74-like     94.7    4e-20   Glycine max [soybeans]
ref|XP_008809453.1|  PREDICTED: RING-H2 finger protein ATL74-like...  94.7    4e-20   Phoenix dactylifera
ref|NP_001150572.1|  RING-H2 finger protein ATL1R                     94.4    5e-20   
ref|NP_001150083.1|  RING-H2 finger protein ATL1R                     94.7    5e-20   
ref|XP_003552318.1|  PREDICTED: RING-H2 finger protein ATL74-like     94.4    6e-20   Glycine max [soybeans]
ref|NP_001145674.1|  uncharacterized protein LOC100279177             94.0    1e-19   
ref|XP_008809452.1|  PREDICTED: RING-H2 finger protein ATL74-like...  94.4    1e-19   Phoenix dactylifera
ref|XP_010658180.1|  PREDICTED: RING-H2 finger protein ATL74          94.0    1e-19   
ref|XP_009395164.1|  PREDICTED: RING-H2 finger protein ATL74-like     93.2    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008662433.1|  PREDICTED: RING-H2 finger protein ATL74-like     93.6    1e-19   Zea mays [maize]
ref|XP_007205967.1|  hypothetical protein PRUPE_ppa012052mg           92.8    2e-19   
gb|KDO42949.1|  hypothetical protein CISIN_1g029206mg                 93.2    2e-19   Citrus sinensis [apfelsine]
gb|EAZ25203.1|  hypothetical protein OsJ_09003                        92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002325483.2|  hypothetical protein POPTR_0019s08600g           92.8    2e-19   
dbj|BAD23012.1|  RING zinc finger protein-like                        92.8    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010031086.1|  PREDICTED: RING-H2 finger protein ATL72 isof...  92.8    3e-19   Eucalyptus grandis [rose gum]
gb|KCW50353.1|  hypothetical protein EUGRSUZ_J00118                   92.8    3e-19   Eucalyptus grandis [rose gum]
ref|XP_011001401.1|  PREDICTED: RING-H2 finger protein ATL74          92.8    3e-19   Populus euphratica
ref|XP_010031085.1|  PREDICTED: RING-H2 finger protein ATL72 isof...  92.8    3e-19   Eucalyptus grandis [rose gum]
ref|XP_003623617.1|  RING-H2 finger protein ATL5H                     92.4    3e-19   Medicago truncatula
ref|XP_004502903.1|  PREDICTED: RING-H2 finger protein ATL78-like     93.2    3e-19   Cicer arietinum [garbanzo]
gb|EAY88139.1|  hypothetical protein OsI_09574                        91.7    3e-19   Oryza sativa Indica Group [Indian rice]
gb|EMT16971.1|  RING-H2 finger protein ATL1B                          92.0    4e-19   
ref|XP_011013335.1|  PREDICTED: RING-H2 finger protein ATL74-like     92.4    4e-19   Populus euphratica
ref|NP_001173220.1|  Os02g0832150                                     92.4    4e-19   
ref|NP_001235294.1|  uncharacterized protein LOC100527126             92.8    4e-19   
ref|XP_002319337.2|  hypothetical protein POPTR_0013s09370g           92.4    5e-19   
ref|XP_009346909.1|  PREDICTED: RING-H2 finger protein ATL74-like     92.0    6e-19   Pyrus x bretschneideri [bai li]
gb|KHN29152.1|  RING-H2 finger protein ATL78                          92.4    6e-19   Glycine soja [wild soybean]
ref|XP_006577152.1|  PREDICTED: RING-H2 finger protein ATL5-like      92.0    6e-19   Glycine max [soybeans]
ref|XP_011466420.1|  PREDICTED: RING-H2 finger protein ATL74          92.0    6e-19   Fragaria vesca subsp. vesca
ref|XP_008244900.1|  PREDICTED: RING-H2 finger protein ATL74-like     92.0    6e-19   Prunus mume [ume]
ref|XP_009372015.1|  PREDICTED: RING-H2 finger protein ATL74-like     91.7    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_003528016.1|  PREDICTED: RING-H2 finger protein ATL72-like     91.7    7e-19   Glycine max [soybeans]
ref|NP_001151707.1|  RING-H2 finger protein ATL5A                     91.3    7e-19   Zea mays [maize]
ref|XP_008370258.1|  PREDICTED: RING-H2 finger protein ATL74          91.7    8e-19   
ref|XP_006435916.1|  hypothetical protein CICLE_v10032803mg           91.7    8e-19   
emb|CDY34972.1|  BnaA01g27620D                                        92.8    8e-19   Brassica napus [oilseed rape]
emb|CDP13909.1|  unnamed protein product                              91.7    8e-19   Coffea canephora [robusta coffee]
gb|EMS62914.1|  RING-H2 finger protein ATL44                          91.3    8e-19   Triticum urartu
ref|XP_009114556.1|  PREDICTED: RING-H2 finger protein ATL2-like      92.4    8e-19   Brassica rapa
gb|KEH35547.1|  RING-H2 zinc finger protein                           90.9    8e-19   Medicago truncatula
ref|XP_008388346.1|  PREDICTED: RING-H2 finger protein ATL74-like     91.7    8e-19   
gb|EYU20094.1|  hypothetical protein MIMGU_mgv1a014454mg              91.3    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_007137692.1|  hypothetical protein PHAVU_009G147700g           91.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_006842471.1|  hypothetical protein AMTR_s00077p00074350        90.9    1e-18   
ref|XP_010423485.1|  PREDICTED: RING-H2 finger protein ATL73          90.5    1e-18   Camelina sativa [gold-of-pleasure]
gb|ACN27203.1|  unknown                                               90.5    1e-18   Zea mays [maize]
gb|AFK40012.1|  unknown                                               91.3    1e-18   Lotus japonicus
ref|XP_003630203.1|  Ring finger protein                              91.7    1e-18   
ref|XP_010452430.1|  PREDICTED: RING-H2 finger protein ATL73-like     90.5    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010036001.1|  PREDICTED: RING-H2 finger protein ATL74          90.5    1e-18   Eucalyptus grandis [rose gum]
ref|XP_002442771.1|  hypothetical protein SORBIDRAFT_08g002625        89.0    1e-18   
ref|XP_004954531.1|  PREDICTED: RING-H2 finger protein ATL80-like     90.9    1e-18   Setaria italica
emb|CDP12783.1|  unnamed protein product                              91.7    1e-18   Coffea canephora [robusta coffee]
ref|XP_010253089.1|  PREDICTED: RING-H2 finger protein ATL74-like     90.9    1e-18   Nelumbo nucifera [Indian lotus]
gb|KEH20889.1|  RING-H2 finger protein ATL1L                          90.9    1e-18   Medicago truncatula
ref|XP_009789233.1|  PREDICTED: RING-H2 finger protein ATL74-like     90.5    2e-18   Nicotiana sylvestris
gb|KHN34052.1|  RING-H2 finger protein ATL78                          90.5    2e-18   Glycine soja [wild soybean]
ref|XP_002298708.2|  hypothetical protein POPTR_0001s31720g           91.3    2e-18   Populus trichocarpa [western balsam poplar]
emb|CDP04045.1|  unnamed protein product                              90.1    2e-18   Coffea canephora [robusta coffee]
ref|XP_011045715.1|  PREDICTED: RING-H2 finger protein ATL78-like     90.9    2e-18   Populus euphratica
gb|AFW84736.1|  putative RING zinc finger domain superfamily protein  90.1    2e-18   
emb|CDY28347.1|  BnaC01g35170D                                        91.7    2e-18   Brassica napus [oilseed rape]
ref|XP_003525110.1|  PREDICTED: RING-H2 finger protein ATL78-like     90.9    2e-18   Glycine max [soybeans]
ref|XP_006289653.1|  hypothetical protein CARUB_v10003211mg           90.1    2e-18   Capsella rubella
ref|XP_010322128.1|  PREDICTED: RING-H2 finger protein ATL72-like...  89.4    2e-18   
ref|XP_004492554.1|  PREDICTED: RING-H2 finger protein ATL74-like     90.1    2e-18   Cicer arietinum [garbanzo]
ref|XP_009415472.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.7    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006605247.1|  PREDICTED: RING-H2 finger protein ATL5-like      90.5    2e-18   Glycine max [soybeans]
ref|XP_009628109.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.7    3e-18   Nicotiana tomentosiformis
gb|EAY82042.1|  hypothetical protein OsI_37229                        89.4    3e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_008456776.1|  PREDICTED: RING-H2 finger protein ATL74          90.1    3e-18   
ref|XP_010491062.1|  PREDICTED: RING-H2 finger protein ATL73-like     89.4    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004975603.1|  PREDICTED: RING-H2 finger protein ATL78-like     90.1    3e-18   
ref|NP_001151367.1|  RING-H2 finger protein ATL5A                     89.4    3e-18   
ref|XP_009774817.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.4    4e-18   Nicotiana sylvestris
gb|EMS58742.1|  RING-H2 finger protein ATL72                          87.8    4e-18   Triticum urartu
ref|XP_011469994.1|  PREDICTED: RING-H2 finger protein ATL74-like     90.1    4e-18   Fragaria vesca subsp. vesca
gb|AFK36272.1|  unknown                                               89.0    4e-18   Lotus japonicus
ref|XP_010260922.1|  PREDICTED: RING-H2 finger protein ATL78          90.1    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009757302.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.0    5e-18   Nicotiana sylvestris
ref|XP_008663190.1|  PREDICTED: RING-H2 finger protein ATL73-like...  89.4    5e-18   
ref|XP_008663188.1|  PREDICTED: RING-H2 finger protein ATL73-like...  89.4    5e-18   
ref|XP_004249864.1|  PREDICTED: RING-H2 finger protein ATL78-like     89.4    5e-18   Solanum lycopersicum
ref|XP_007218405.1|  hypothetical protein PRUPE_ppa011446mg           89.4    5e-18   
gb|EMS51300.1|  RING-H2 finger protein ATL80                          90.1    5e-18   
gb|KDP26113.1|  hypothetical protein JCGZ_22214                       89.7    5e-18   
ref|XP_008233881.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.7    5e-18   
ref|XP_009397078.1|  PREDICTED: RING-H2 finger protein ATL74-like     88.6    5e-18   
ref|XP_006481185.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.0    5e-18   
gb|KDO64081.1|  hypothetical protein CISIN_1g043554mg                 89.0    5e-18   
ref|XP_010931679.1|  PREDICTED: uncharacterized protein LOC105052539  89.4    5e-18   
ref|XP_004306591.1|  PREDICTED: RING-H2 finger protein ATL78          89.7    6e-18   
ref|NP_196147.1|  defective in anther dehiscence1-activating factor   88.6    6e-18   
ref|XP_010239893.1|  PREDICTED: RING-H2 finger protein ATL78-like     89.0    6e-18   
gb|EAY79719.1|  hypothetical protein OsI_34871                        88.2    6e-18   
ref|XP_004240864.1|  PREDICTED: RING-H2 finger protein ATL74-like...  89.4    6e-18   
gb|KJB73014.1|  hypothetical protein B456_011G209400                  89.0    7e-18   
ref|XP_006358749.1|  PREDICTED: RING-H2 finger protein ATL72-like     89.0    7e-18   
ref|XP_009333999.1|  PREDICTED: RING-H2 finger protein ATL78          89.4    7e-18   
gb|KJB78366.1|  hypothetical protein B456_012G030900                  89.4    7e-18   
gb|KGN45834.1|  hypothetical protein Csa_6G014550                     89.0    7e-18   
ref|XP_011002606.1|  PREDICTED: RING-H2 finger protein ATL74          88.6    7e-18   
ref|XP_007159812.1|  hypothetical protein PHAVU_002G269500g           89.4    7e-18   
ref|XP_010322127.1|  PREDICTED: RING-H2 finger protein ATL74-like...  89.0    7e-18   
ref|XP_007011313.1|  RING/U-box superfamily protein                   89.7    8e-18   
gb|AET04682.2|  RING-H2 finger protein ATL1L                          89.0    8e-18   
ref|XP_006660955.1|  PREDICTED: RING-H2 finger protein ATL80-like     89.0    8e-18   
gb|ACU18824.1|  unknown                                               89.4    8e-18   
ref|XP_002323073.2|  zinc finger family protein                       88.6    8e-18   
ref|XP_006854529.1|  hypothetical protein AMTR_s00030p00032810        88.6    8e-18   
gb|KDO53392.1|  hypothetical protein CISIN_1g042990mg                 87.8    9e-18   
ref|XP_006429572.1|  hypothetical protein CICLE_v10013579mg           88.6    9e-18   
ref|XP_006578803.1|  PREDICTED: RING-H2 finger protein ATL78-like     89.4    9e-18   
ref|XP_006285658.1|  hypothetical protein CARUB_v10007114mg           87.0    9e-18   
ref|XP_009622929.1|  PREDICTED: RING-H2 finger protein ATL74-like     88.2    1e-17   
ref|XP_003630197.1|  RING finger protein                              89.0    1e-17   
ref|XP_010053991.1|  PREDICTED: RING-H2 finger protein ATL79-like     89.0    1e-17   
ref|XP_006652278.1|  PREDICTED: RING-H2 finger protein ATL78-like     88.6    1e-17   
ref|XP_003630209.1|  Ring finger protein                              91.3    1e-17   
emb|CAE03757.1|  OSJNBa0013K16.6                                      88.2    1e-17   
ref|XP_002266740.1|  PREDICTED: RING-H2 finger protein ATL74          87.8    1e-17   
ref|XP_008679106.1|  PREDICTED: RING-H2 finger protein ATL80-like     88.6    1e-17   
ref|XP_002522191.1|  RING-H2 finger protein ATL1L, putative           88.6    1e-17   
ref|XP_003562145.1|  PREDICTED: RING-H2 finger protein ATL45          88.2    1e-17   
ref|XP_002458689.1|  hypothetical protein SORBIDRAFT_03g038270        88.2    1e-17   
ref|NP_001052775.2|  Os04g0419500                                     88.2    1e-17   
ref|XP_010451926.1|  PREDICTED: RING-H2 finger protein ATL74          87.0    1e-17   
ref|XP_007140087.1|  hypothetical protein PHAVU_008G083200g           87.4    1e-17   
gb|ABR17631.1|  unknown                                               87.8    1e-17   
ref|XP_010097125.1|  RING-H2 finger protein ATL73                     87.0    1e-17   
ref|XP_010424005.1|  PREDICTED: RING-H2 finger protein ATL74-like     87.0    1e-17   
ref|XP_010680476.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...  86.7    1e-17   
emb|CDX70162.1|  BnaA10g25110D                                        87.4    2e-17   
ref|XP_009122137.1|  PREDICTED: RING-H2 finger protein ATL73          87.4    2e-17   
gb|KFK38478.1|  hypothetical protein AALP_AA3G118200                  87.4    2e-17   
ref|XP_004503972.1|  PREDICTED: RING-H2 finger protein ATL78-like     88.2    2e-17   
emb|CAN65088.1|  hypothetical protein VITISV_035033                   88.2    2e-17   
gb|EMT00106.1|  RING-H2 finger protein ATL3C                          85.5    2e-17   
ref|XP_009411192.1|  PREDICTED: RING-H2 finger protein ATL73          87.8    2e-17   
ref|XP_004970394.1|  PREDICTED: RING-H2 finger protein ATL72-like     87.8    2e-17   
ref|XP_002446457.1|  hypothetical protein SORBIDRAFT_06g016320        88.6    2e-17   
ref|NP_187702.1|  RING-H2 finger protein ATL72                        87.0    2e-17   
gb|KJB67938.1|  hypothetical protein B456_010G218600                  87.4    2e-17   
ref|XP_008369369.1|  PREDICTED: RING-H2 finger protein ATL74-like     87.8    2e-17   
gb|KJB48009.1|  hypothetical protein B456_008G050200                  86.3    2e-17   
gb|KJB18812.1|  hypothetical protein B456_003G070100                  87.8    2e-17   
gb|EEE60987.1|  hypothetical protein OsJ_14782                        88.2    3e-17   
ref|XP_004494385.1|  PREDICTED: RING-H2 finger protein ATL5-like      86.7    3e-17   
ref|XP_002442772.1|  hypothetical protein SORBIDRAFT_08g002630        87.4    3e-17   
ref|XP_003630235.1|  RING-H2 finger protein ATL5F                     87.4    3e-17   
ref|XP_006464565.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.4    3e-17   
ref|XP_008391276.1|  PREDICTED: RING-H2 finger protein ATL78          87.8    3e-17   
ref|XP_011046374.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.4    3e-17   
ref|XP_006371010.1|  hypothetical protein POPTR_0019s02610g           87.4    3e-17   
ref|XP_003630211.1|  RING-H2 finger protein ATL1L                     87.4    3e-17   
gb|AFB32557.1|  hypothetical protein 0_15036_01                       85.5    3e-17   
ref|XP_009363798.1|  PREDICTED: RING-H2 finger protein ATL74-like     87.4    3e-17   
gb|AFB32552.1|  hypothetical protein 0_15036_01                       85.5    3e-17   
ref|XP_006427854.1|  hypothetical protein CICLE_v10027222mg           87.0    3e-17   
ref|XP_002528684.1|  RING-H2 finger protein ATL5A, putative           86.7    3e-17   
gb|ABA96288.1|  Zinc finger, C3HC4 type family protein, expressed     86.3    3e-17   
ref|XP_009384764.1|  PREDICTED: RING-H2 finger protein ATL72-like     86.3    3e-17   
dbj|BAJ94010.1|  predicted protein                                    86.7    3e-17   
ref|XP_009623345.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.4    4e-17   
ref|XP_006351103.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.0    4e-17   
ref|XP_010027695.1|  PREDICTED: RING-H2 finger protein ATL78          87.4    4e-17   
ref|XP_004517207.1|  PREDICTED: RING-H2 finger protein ATL5-like      87.0    4e-17   
ref|XP_011099792.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.0    4e-17   
ref|XP_011046373.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.0    4e-17   
ref|XP_003630207.1|  RING finger protein                              86.7    5e-17   
ref|XP_009619518.1|  PREDICTED: RING-H2 finger protein ATL78-like     87.0    5e-17   
gb|KHN47727.1|  RING-H2 finger protein ATL73                          85.1    5e-17   
ref|XP_011021043.1|  PREDICTED: RING-H2 finger protein ATL74-like     85.9    6e-17   
ref|XP_009772838.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.7    6e-17   
ref|XP_009603866.1|  PREDICTED: RING-H2 finger protein ATL73-like     84.7    6e-17   
gb|KCW54274.1|  hypothetical protein EUGRSUZ_I00237                   86.7    6e-17   
ref|XP_006406812.1|  hypothetical protein EUTSA_v10021205mg           87.4    6e-17   
ref|XP_009416899.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.3    6e-17   
emb|CDY28346.1|  BnaC01g35160D                                        87.0    6e-17   
emb|CAA74911.1|  ring finger protein                                  87.4    6e-17   
dbj|BAJ95045.1|  predicted protein                                    86.3    6e-17   
ref|XP_009125390.1|  PREDICTED: RING-H2 finger protein ATL74          85.1    6e-17   
gb|AFG44785.1|  hypothetical protein 0_4329_01                        84.7    6e-17   
ref|XP_003547414.1|  PREDICTED: RING-H2 finger protein ATL73-like     85.5    6e-17   
dbj|BAK04827.1|  predicted protein                                    87.0    6e-17   
ref|XP_010027694.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.7    6e-17   
ref|XP_002884820.1|  zinc finger family protein                       85.9    6e-17   
ref|XP_009342079.1|  PREDICTED: RING-H2 finger protein ATL78          86.7    7e-17   
emb|CAN75293.1|  hypothetical protein VITISV_042413                   86.7    7e-17   
gb|KHG05103.1|  RING-H2 finger ATL74 -like protein                    86.3    7e-17   
gb|KJB71523.1|  hypothetical protein B456_011G127700                  85.9    7e-17   
ref|XP_006299842.1|  hypothetical protein CARUB_v10016045mg           86.3    7e-17   
ref|XP_010680273.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.7    7e-17   
emb|CDX92270.1|  BnaA05g21370D                                        86.3    7e-17   
gb|KFK24948.1|  hypothetical protein AALP_AA8G046900                  85.5    8e-17   
ref|XP_009599867.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.3    8e-17   
ref|XP_003526853.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.7    8e-17   
gb|ACU18212.1|  unknown                                               86.7    8e-17   
gb|KHN09585.1|  RING-H2 finger protein ATL78                          86.7    8e-17   
ref|XP_007163125.1|  hypothetical protein PHAVU_001G208400g           87.0    8e-17   
gb|KJB75207.1|  hypothetical protein B456_012G031300                  85.9    8e-17   
ref|XP_003581570.1|  PREDICTED: RING-H2 finger protein ATL44-like     85.5    9e-17   
ref|XP_011045892.1|  PREDICTED: RING-H2 finger protein ATL2-like      85.9    9e-17   
ref|XP_006351100.1|  PREDICTED: RING-H2 finger protein ATL78-like     86.3    9e-17   
gb|EYU35209.1|  hypothetical protein MIMGU_mgv1a017957mg              85.5    9e-17   
ref|XP_006406566.1|  hypothetical protein EUTSA_v10021473mg           86.3    9e-17   
ref|XP_008366804.1|  PREDICTED: RING-H2 finger protein ATL74-like     85.9    9e-17   
gb|AET04685.2|  RING-H2 finger protein ATL1L                          86.3    9e-17   
ref|XP_011016839.1|  PREDICTED: RING-H2 finger protein ATL2-like      85.9    9e-17   
ref|XP_002282494.2|  PREDICTED: RING-H2 finger protein ATL78          86.3    1e-16   
ref|XP_009114603.1|  PREDICTED: RING-H2 finger protein ATL2-like      84.7    1e-16   
ref|XP_006351048.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.9    1e-16   
ref|XP_002453057.1|  hypothetical protein SORBIDRAFT_04g037520        86.7    1e-16   
ref|XP_009349074.1|  PREDICTED: RING-H2 finger protein ATL74-like     85.9    1e-16   
emb|CAE02923.1|  OSJNBb0108J11.16                                     88.2    1e-16   
gb|AFK42323.1|  unknown                                               85.9    1e-16   
ref|XP_010486714.1|  PREDICTED: RING-H2 finger protein ATL72-like     85.1    1e-16   
ref|XP_010543917.1|  PREDICTED: RING-H2 finger protein ATL73          85.5    1e-16   
ref|XP_004250442.2|  PREDICTED: RING-H2 finger protein ATL78-like     85.5    1e-16   
ref|XP_009414837.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.5    1e-16   
ref|XP_006398571.1|  hypothetical protein EUTSA_v10014876mg           84.3    1e-16   
gb|KDP21873.1|  hypothetical protein JCGZ_00660                       85.1    1e-16   
ref|XP_007048258.1|  RING zinc finger protein                         85.5    1e-16   
gb|AFG44796.1|  hypothetical protein 0_4329_01                        83.6    1e-16   
gb|KJB27683.1|  hypothetical protein B456_005G004700                  84.7    1e-16   
ref|XP_008663453.1|  PREDICTED: RING-H2 finger protein ATL74-like     85.1    2e-16   
ref|XP_002873203.1|  zinc finger family protein                       84.7    2e-16   
ref|XP_011045714.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.5    2e-16   
ref|XP_007138847.1|  hypothetical protein PHAVU_009G242500g           84.3    2e-16   
ref|XP_002298709.2|  zinc finger family protein                       85.5    2e-16   
ref|XP_009599868.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.5    2e-16   
gb|AFG44787.1|  hypothetical protein 0_4329_01                        83.6    2e-16   
ref|XP_006351190.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.7    2e-16   
ref|XP_009772408.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.5    2e-16   
ref|XP_003602549.1|  Ring-H2 zinc finger protein                      85.5    2e-16   
ref|XP_002319423.2|  hypothetical protein POPTR_0013s15290g           84.3    2e-16   
ref|XP_006279330.1|  hypothetical protein CARUB_v10012731mg           84.0    2e-16   
ref|XP_010241725.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.1    2e-16   
emb|CDY36281.1|  BnaA01g31370D                                        84.3    2e-16   
ref|XP_009122550.1|  PREDICTED: RING-H2 finger protein ATL72          84.3    2e-16   
ref|XP_009145859.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.1    2e-16   
ref|XP_009107878.1|  PREDICTED: RING-H2 finger protein ATL17          85.5    2e-16   
emb|CDY66109.1|  BnaAnng21490D                                        85.5    2e-16   
ref|XP_010911967.1|  PREDICTED: RING-H2 finger protein ATL78          84.7    2e-16   
ref|XP_007212035.1|  hypothetical protein PRUPE_ppa011240mg           84.7    2e-16   
ref|XP_004250441.1|  PREDICTED: RING-H2 finger protein ATL78-like...  84.7    2e-16   
dbj|BAK06500.1|  predicted protein                                    84.7    2e-16   
ref|XP_010312460.1|  PREDICTED: RING-H2 finger protein ATL78-like...  84.7    2e-16   
ref|XP_002872987.1|  zinc finger family protein                       83.6    2e-16   
ref|XP_008232929.1|  PREDICTED: RING-H2 finger protein ATL78          84.7    2e-16   
ref|XP_009772841.1|  PREDICTED: RING-H2 finger protein ATL72-like     83.6    2e-16   
tpg|DAA57058.1|  TPA: putative RING zinc finger domain superfamil...  84.3    3e-16   
ref|XP_004249865.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.7    3e-16   
ref|XP_004148642.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.7    3e-16   
ref|XP_010680272.1|  PREDICTED: RING-H2 finger protein ATL78-like     85.1    3e-16   
ref|XP_006855649.1|  hypothetical protein AMTR_s00044p00112360        84.0    3e-16   
emb|CDX95503.1|  BnaC01g33950D                                        84.7    3e-16   
ref|XP_010487800.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.7    3e-16   
ref|XP_004502830.1|  PREDICTED: RING-H2 finger protein ATL72-like     83.6    3e-16   
ref|XP_010912405.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.3    3e-16   
emb|CDY61981.1|  BnaC03g73800D                                        84.3    3e-16   
ref|XP_003576814.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.0    3e-16   
ref|XP_010109653.1|  RING-H2 finger protein ATL72                     84.3    3e-16   
ref|XP_002883149.1|  hypothetical protein ARALYDRAFT_479387           84.3    3e-16   
ref|XP_009780401.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.7    4e-16   
ref|XP_002452232.1|  hypothetical protein SORBIDRAFT_04g022150        84.7    4e-16   
gb|EYU43498.1|  hypothetical protein MIMGU_mgv1a017986mg              84.3    4e-16   
ref|XP_011076816.1|  PREDICTED: RING-H2 finger protein ATL74-like     83.2    4e-16   
gb|KDO87170.1|  hypothetical protein CISIN_1g024682mg                 84.7    4e-16   
ref|XP_004250440.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    4e-16   
ref|XP_006444389.1|  hypothetical protein CICLE_v10021708mg           84.7    4e-16   
ref|XP_006351101.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    4e-16   
ref|XP_009599874.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.3    4e-16   
ref|XP_011084821.1|  PREDICTED: RING-H2 finger protein ATL73-like     83.2    4e-16   
ref|NP_195808.1|  RING-H2 finger protein ATL74                        82.8    4e-16   
ref|XP_008441014.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    4e-16   
ref|XP_006479997.1|  PREDICTED: RING-H2 finger protein ATL64-like     84.7    4e-16   
ref|XP_010465991.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    5e-16   
ref|XP_009112396.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    5e-16   
ref|XP_009772864.1|  PREDICTED: RING-H2 finger protein ATL72-like...  83.2    5e-16   
gb|EAY76312.1|  hypothetical protein OsI_04246                        84.0    5e-16   
ref|XP_002326072.2|  hypothetical protein POPTR_0019s15050g           83.6    5e-16   
ref|NP_001044653.1|  Os01g0822800                                     83.6    5e-16   
ref|XP_008460910.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    5e-16   
gb|EMT06540.1|  RING-H2 finger protein ATL1R                          82.0    5e-16   
ref|XP_006371011.1|  zinc finger family protein                       84.0    6e-16   
ref|XP_006388246.1|  hypothetical protein POPTR_0267s00200g           84.0    6e-16   
ref|XP_001766556.1|  predicted protein                                81.6    6e-16   
ref|XP_009603869.1|  PREDICTED: RING-H2 finger protein ATL72-like     82.8    6e-16   
gb|KJB27682.1|  hypothetical protein B456_005G004600                  82.8    6e-16   
ref|XP_009780400.1|  PREDICTED: RING-H2 finger protein ATL78-like     83.2    6e-16   
ref|XP_010507135.1|  PREDICTED: RING-H2 finger protein ATL78-like     83.6    6e-16   
emb|CDY34970.1|  BnaA01g27640D                                        81.3    7e-16   
ref|XP_010490473.1|  PREDICTED: RING-H2 finger protein ATL72          82.8    7e-16   
emb|CDX99317.1|  BnaC05g34320D                                        83.6    7e-16   
ref|XP_010490498.1|  PREDICTED: RING-H2 finger protein ATL74-like     82.4    7e-16   
ref|XP_009765992.1|  PREDICTED: RING-H2 finger protein ATL78-like     84.0    7e-16   
ref|XP_009135597.1|  PREDICTED: RING-H2 finger protein ATL77-like     83.6    7e-16   
emb|CDX82327.1|  BnaA03g34940D                                        83.6    7e-16   
ref|XP_010670603.1|  PREDICTED: RING-H2 finger protein ATL73          83.2    7e-16   
ref|XP_006407493.1|  hypothetical protein EUTSA_v10021678mg           82.4    7e-16   
dbj|BAB01805.1|  unnamed protein product                              83.6    7e-16   
dbj|BAD29376.1|  EL5-like                                             81.6    7e-16   
ref|XP_009772859.1|  PREDICTED: RING-H2 finger protein ATL72-like...  82.8    8e-16   



>ref|XP_009775127.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=184

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLT  532
            RCAWLRR+R    G +S   +    LKKKVL+SLPKFTY  + +        A+CAICL 
Sbjct  60   RCAWLRRVRERTGGQSSSAANRG--LKKKVLQSLPKFTYDNTSSTTGAA---AECAICLA  114

Query  531  EYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAG  352
            EY EGDEIRVLPQC HGFHVQCIDTWLGSHSSCPSCRQILVV RCRKCG  E P+VS   
Sbjct  115  EYREGDEIRVLPQCDHGFHVQCIDTWLGSHSSCPSCRQILVVGRCRKCG--EFPAVSGTS  172

Query  351  AGEQ  340
             G Q
Sbjct  173  NGAQ  176



>ref|XP_009601753.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=197

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 96/135 (71%), Gaps = 9/135 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG-LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAWLRR      GGA GQ ++    LKKKVL+SLPKFTY PS   A      A+CAIC
Sbjct  56   ARCAWLRRGTGAGAGGAGGQSAAANKGLKKKVLQSLPKFTYDPSSTTAKGTPFTAECAIC  115

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS-  361
            L EY  GDEIRVLPQC H FH+QCIDTWLGSHSSCPSCRQILVVARCRKCG  E P++S 
Sbjct  116  LAEYAVGDEIRVLPQCGHSFHLQCIDTWLGSHSSCPSCRQILVVARCRKCG--EFPAISH  173

Query  360  -----PAGAGEQSQS  331
                 PA   ++S+S
Sbjct  174  KTDGAPATTPDESRS  188



>ref|XP_009772742.1| PREDICTED: RING-H2 finger protein ATL8-like isoform X2 [Nicotiana 
sylvestris]
Length=268

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 95/134 (71%), Gaps = 10/134 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR  A   G      S+NKGLKKKVL+SLPKFTY PS   A      A+CAICL
Sbjct  123  ARCAWLRR--ATGGGAGGQSSSANKGLKKKVLQSLPKFTYDPSSTTAKGTPFTAECAICL  180

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS--  361
             EY  GDEIRVLPQC H FH+QCIDTWLGSHSSCPSCRQILVVARCRKCG  E P+VS  
Sbjct  181  AEYAVGDEIRVLPQCGHSFHLQCIDTWLGSHSSCPSCRQILVVARCRKCG--EFPAVSHK  238

Query  360  ----PAGAGEQSQS  331
                PA    +S+S
Sbjct  239  TDGAPATTPAESRS  252



>ref|XP_009604464.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=184

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 7/117 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR+  G   G     ++N+GLKKKVL+SLPKFTY    + ++     A+CAICL
Sbjct  59   ARCAWLRRV--GGATGGQSSSAANRGLKKKVLQSLPKFTYD---STSSTTGATAECAICL  113

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSV  364
             EY EGDEIRVLPQC HGFHVQCIDTWLGSHSSCPSCRQILVV RCRKCG  E P+V
Sbjct  114  AEYREGDEIRVLPQCGHGFHVQCIDTWLGSHSSCPSCRQILVVGRCRKCG--EFPAV  168



>ref|XP_009772735.1| PREDICTED: RING-H2 finger protein ATL8-like isoform X1 [Nicotiana 
sylvestris]
Length=270

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 90/128 (70%), Gaps = 4/128 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   G  GG S   +    LKKKVL+SLPKFTY PS   A      A+CAICL
Sbjct  123  ARCAWLRRATGGGAGGQSSSANKG--LKKKVLQSLPKFTYDPSSTTAKGTPFTAECAICL  180

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             EY  GDEIRVLPQC H FH+QCIDTWLGSHSSCPSCRQILVVARCRKCG  E P+VS  
Sbjct  181  AEYAVGDEIRVLPQCGHSFHLQCIDTWLGSHSSCPSCRQILVVARCRKCG--EFPAVSHK  238

Query  354  GAGEQSQS  331
              G  + +
Sbjct  239  TDGAPATT  246



>ref|XP_004232585.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=193

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR       G S   ++   LKKKVL+SLPKFTY PS + A      A+CAICL
Sbjct  52   ARCAWLRRGIGAGGNGGSQPSANKG-LKKKVLQSLPKFTYDPS-STANGAAFTAECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
             EY  GDEIRVLPQC H FH+QCIDTWLGSHSSCPSCRQILVVARCRKCG  E P+VS
Sbjct  110  AEYAVGDEIRVLPQCGHSFHLQCIDTWLGSHSSCPSCRQILVVARCRKCG--EFPAVS  165



>ref|XP_009772726.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=198

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 88/120 (73%), Gaps = 4/120 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG--LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRR      GGA GQ S+     LKKKVL+SLPKFTY PS   A       +CAI
Sbjct  56   ARCAWLRRATGAGGGGAGGQSSAAANKGLKKKVLQSLPKFTYDPSSTTAKGTPFTTECAI  115

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
            CL EY  GDEIRVLPQC H FH+QCIDTWLGSHSSCPSCRQILVVARCRKCG  E P+VS
Sbjct  116  CLAEYAVGDEIRVLPQCGHSFHLQCIDTWLGSHSSCPSCRQILVVARCRKCG--EFPAVS  173



>emb|CDP01769.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKE----IPADC  547
            ARCAWLRR     NG   GQ S NKGLKKK+++SLPK+TY  S +A    +    +  DC
Sbjct  66   ARCAWLRR-GTPGNGRVPGQRSPNKGLKKKIVQSLPKYTYDSSSSATGAGDGIGAVTGDC  124

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL EY +GDEIRVLPQC HGFHVQCIDTWLGSHSSCPSCRQILVVARC+KCG  E P+
Sbjct  125  AICLAEYADGDEIRVLPQCGHGFHVQCIDTWLGSHSSCPSCRQILVVARCQKCG--EFPA  182

Query  366  VSPAGAGEQSQSA  328
            ++ +GA + +  A
Sbjct  183  MNVSGAAQVATPA  195



>gb|AFW90598.1| E3 ubiquitin ligase [Solanum tuberosum]
Length=170

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   GA G    Q S+NKGLKKKVL+SLPKFTY PS + A      A+CAICL
Sbjct  29   ARCAWLRR-GIGAGGIGGSQPSANKGLKKKVLQSLPKFTYDPS-STANGAAFTAECAICL  86

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
             EY  GDEIRVLPQC H FH+QCIDTWLGSHSSCPSCRQILVV RCRKCG  E+P+VS
Sbjct  87   AEYAVGDEIRVLPQCGHIFHLQCIDTWLGSHSSCPSCRQILVVTRCRKCG--ELPAVS  142



>ref|XP_002526834.1| protein with unknown function [Ricinus communis]
 gb|EEF35569.1| protein with unknown function [Ricinus communis]
Length=207

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 8/126 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE----KEIPADC  547
            ARCAWLRR   G+      Q ++NKGLKKK+L+SLPKFTYG + A AA     K    +C
Sbjct  50   ARCAWLRRT--GSASNYPSQAAANKGLKKKILQSLPKFTYGSAAATAAAAGSCKYASTEC  107

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+EEGDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILV+ARC KCG  + P+
Sbjct  108  AICLGEFEEGDEVRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVMARCHKCG--QFPT  165

Query  366  VSPAGA  349
            +S  G 
Sbjct  166  ISSCGG  171



>ref|XP_002887637.1| hypothetical protein ARALYDRAFT_316562 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63896.1| hypothetical protein ARALYDRAFT_316562 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 90/125 (72%), Gaps = 8/125 (6%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRRI               ++NKGLKKKVLRSLPK TY P  +  AEK +  +CA
Sbjct  49   SRCAWLRRIASRNRSDQTHPPPVAAANKGLKKKVLRSLPKLTYSPD-SPPAEKLV--ECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSV  364
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KCG   +P  
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKCG--GLPGS  163

Query  363  SPAGA  349
            S +G+
Sbjct  164  STSGS  168



>ref|XP_002526830.1| protein with unknown function [Ricinus communis]
 gb|EEF35565.1| protein with unknown function [Ricinus communis]
Length=258

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 8/126 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE----KEIPADC  547
            ARCAWLRR   G+      Q ++NKGLKKK+L+SLPKFTYG + A AA     K    +C
Sbjct  101  ARCAWLRRT--GSASSYPSQAAANKGLKKKILQSLPKFTYGSAAATAAAAGSCKYASTEC  158

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+EEGDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILV+ARC KCG  + P+
Sbjct  159  AICLGEFEEGDEVRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVMARCHKCG--QFPT  216

Query  366  VSPAGA  349
            +S  G 
Sbjct  217  ISSCGG  222



>ref|XP_009359625.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009359626.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X3 [Pyrus 
x bretschneideri]
Length=215

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR+  G     S   S+NKGLKKKVL+SLPKFTYG +  A    ++ ++CAICL
Sbjct  56   ARCAWLRRVSGGRAAIGSASSSANKGLKKKVLQSLPKFTYG-TGGAEPPPKLGSECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
             E+ EG EIRVLPQC H FHV CIDTWLGSHSSCPSCRQILVVARC KCG    P
Sbjct  115  GEFAEGHEIRVLPQCGHVFHVGCIDTWLGSHSSCPSCRQILVVARCHKCGGFPAP  169



>ref|XP_009359623.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X1 [Pyrus 
x bretschneideri]
Length=227

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR+  G     S   S+NKGLKKKVL+SLPKFTYG +  A    ++ ++CAICL
Sbjct  56   ARCAWLRRVSGGRAAIGSASSSANKGLKKKVLQSLPKFTYG-TGGAEPPPKLGSECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
             E+ EG EIRVLPQC H FHV CIDTWLGSHSSCPSCRQILVVARC KCG    P
Sbjct  115  GEFAEGHEIRVLPQCGHVFHVGCIDTWLGSHSSCPSCRQILVVARCHKCGGFPAP  169



>gb|KJB14191.1| hypothetical protein B456_002G113500 [Gossypium raimondii]
Length=189

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 90/131 (69%), Gaps = 10/131 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqx----ssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARCAWLRR+        S        +NKGLKKK+L+SLPK T+ P F+A       +DC
Sbjct  52   ARCAWLRRLSGAFAPNPSASSRPTPPANKGLKKKILKSLPKATFSPDFSAKF-----SDC  106

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL VARC+KCG    P 
Sbjct  107  AICLTEFAAGDEIRVLPQCGHGFHVVCIDTWLGSHSSCPSCRQIL-VARCQKCGGLPGPG  165

Query  366  VSPAGAGEQSQ  334
             S +G   +++
Sbjct  166  ASTSGTNTEAR  176



>ref|XP_011074071.1| PREDICTED: RING-H2 finger protein ATL80-like [Sesamum indicum]
Length=188

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 5/127 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RRI    +  +    ++NKGLKKKVL+SLPK TYG     A++    +DCAICL
Sbjct  56   ARCAWIRRIAGRNSDSSPSSAAANKGLKKKVLKSLPKLTYGKDNELASKL---SDCAICL  112

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             E+  G+EIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL  ARC+KCG   +P+ + +
Sbjct  113  AEFATGEEIRVLPQCGHGFHVVCIDTWLGSHSSCPSCRQILGTARCQKCG--RVPAATCS  170

Query  354  GAGEQSQ  334
             AG Q +
Sbjct  171  AAGIQPE  177



>ref|XP_006302871.1| hypothetical protein CARUB_v10021002mg [Capsella rubella]
 gb|EOA35769.1| hypothetical protein CARUB_v10021002mg [Capsella rubella]
Length=186

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 84/112 (75%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRRI               ++NKGLKKKVLRSLPK TY P  ++ AEK +  +CA
Sbjct  49   SRCAWLRRIASRNRSDQTDQPPVAAANKGLKKKVLRSLPKLTYSPE-SSPAEKLV--ECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKC  157



>gb|KDP36758.1| hypothetical protein JCGZ_08049 [Jatropha curcas]
Length=192

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 83/114 (73%), Gaps = 9/114 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs----snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARC WLRR+ + AN       S    +NKGLKKKVLRSLPK T+   F A       +DC
Sbjct  56   ARCGWLRRLSSTANSQTPPPPSLPSSANKGLKKKVLRSLPKETFSADFTAKF-----SDC  110

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            AICL E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KCG
Sbjct  111  AICLAEFTAGDEIRVLPQCGHGFHVNCIDTWLGSHSSCPSCRQILVVARCQKCG  164



>ref|XP_008379650.1| PREDICTED: RING-H2 finger protein ATL80-like [Malus domestica]
Length=216

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   G     S   S+NKGLKKKVL+SLPKFTYG +  A    ++ ++CAICL
Sbjct  56   ARCAWLRRGSEGRAAIGSASSSANKGLKKKVLQSLPKFTYG-TGGAEPPPKLGSECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
             E+ EG EIRVLPQC H FHV CIDTWLGSHSSCPSCRQILVVARC KCG    P
Sbjct  115  GEFAEGHEIRVLPQCGHVFHVGCIDTWLGSHSSCPSCRQILVVARCHKCGGFPAP  169



>ref|XP_004253245.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum lycopersicum]
Length=183

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 7/131 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   G + G     ++NKGLKKKVLRSLPKF + P   A++  E  ++CAICL
Sbjct  60   ARCAWLRRT--GGSTGGQSSAAANKGLKKKVLRSLPKFKFDP---ASSSTEAASECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             EY  GDEI+VLPQCRH FHV CIDTWLGSHSSCP+CRQIL   RCR+CG  E    S A
Sbjct  115  AEYTRGDEIKVLPQCRHVFHVHCIDTWLGSHSSCPTCRQILQTGRCRRCG--EFSGNSNA  172

Query  354  GAGEQSQSAIN  322
            G   Q ++ + 
Sbjct  173  GTQIQGRNCLT  183



>ref|XP_002307200.1| hypothetical protein POPTR_0005s10190g [Populus trichocarpa]
 gb|ABK93092.1| unknown [Populus trichocarpa]
 gb|EEE94196.1| hypothetical protein POPTR_0005s10190g [Populus trichocarpa]
Length=200

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR+  GA+ G   Q  +NKG+KKK L+ LP+FTY      A       +CAICL
Sbjct  46   ARCAWLRRVTGGASSGPPPQAKANKGVKKKNLQLLPRFTYSAGGGGATTSFGTTECAICL  105

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             E+ EGDE+RVLPQC HGFHV CID WLGSHSSCPSCRQILVVARC+KCG
Sbjct  106  GEFVEGDEVRVLPQCGHGFHVGCIDKWLGSHSSCPSCRQILVVARCQKCG  155



>ref|XP_008392292.1| PREDICTED: RING-H2 finger protein ATL80-like [Malus domestica]
Length=215

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   G     S   S+NKGLKKKVL+SLPKFTYG S  A    ++ ++CAICL
Sbjct  56   ARCAWLRRGPXGRAAIGSASSSANKGLKKKVLQSLPKFTYG-SGGAEPPPKLGSECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
             E+ EG EIR+LPQC H FHV CIDTWLGSHSSCPSCRQILVVARC KCG    P
Sbjct  115  GEFAEGHEIRILPQCGHVFHVGCIDTWLGSHSSCPSCRQILVVARCHKCGGFPAP  169



>ref|XP_002266865.1| PREDICTED: RING-H2 finger protein ATL80-like [Vitis vinifera]
Length=153

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 84/110 (76%), Gaps = 7/110 (6%)
 Frame = -3

Query  714  ARCAWLRRIRagang--gasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWL RI   AN   G++ Q  +NKGLKKK+LRSLPK TY     AA     P DCAI
Sbjct  49   ARCAWLCRISGAANLPDGSAPQTPANKGLKKKILRSLPKVTY-----AAETAGNPTDCAI  103

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRK  391
            CLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARCRK
Sbjct  104  CLTEFVGGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVARCRK  153



>ref|XP_002301903.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81176.1| zinc finger family protein [Populus trichocarpa]
Length=200

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 81/112 (72%), Gaps = 8/112 (7%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARCAWLRR                 +NKGLKKKVLRSLPK T+   F+     ++P DCA
Sbjct  54   ARCAWLRRFSSRNPTPPVPPPPPSVANKGLKKKVLRSLPKQTFSEDFSG----KLP-DCA  108

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KC
Sbjct  109  ICLTEFSAGDEIRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCQKC  160



>ref|XP_002274304.2| PREDICTED: RING-H2 finger protein ATL8 [Vitis vinifera]
Length=228

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = -3

Query  714  ARCAWLRRIRagang--gasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRRI   AN   G++ Q  +NKGLKKK+LRSLPK TY     AA       DCAI
Sbjct  49   ARCAWLRRISGAANLPGGSAPQTPANKGLKKKILRSLPKVTY-----AAETAGNLTDCAI  103

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
            CLTE+  GDEIRVLPQC HGFHV CIDTWLGSH SCPSCRQILVVARC+KCG   +P+ S
Sbjct  104  CLTEFVGGDEIRVLPQCGHGFHVGCIDTWLGSHCSCPSCRQILVVARCQKCG--GVPASS  161

Query  360  PAGAGE  343
             +   E
Sbjct  162  SSTGAE  167



>ref|XP_010534292.1| PREDICTED: RING-H2 finger protein ATL80-like [Tarenaya hassleriana]
Length=191

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = -3

Query  714  ARCAWLRRIRagang----gasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            +RCAWLRR  A  +           ++NKGLKKKVLRSLPK TY P    + E E  A+C
Sbjct  51   SRCAWLRRFTAADSSGQAPSPPPHPAANKGLKKKVLRSLPKLTYSPE---SPEAEKFAEC  107

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            AICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC+KC
Sbjct  108  AICLTEFTAGDEIRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVGRCQKC  160



>ref|XP_006342165.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=180

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 90/123 (73%), Gaps = 8/123 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs-snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAW+RRI A A G ++     +NKGLKKKVL+SLPKF+Y    AA       ++CAIC
Sbjct  45   ARCAWIRRISARATGNSAFSSPPANKGLKKKVLKSLPKFSYSAEHAAKF-----SECAIC  99

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            L E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KCG  E+P  S 
Sbjct  100  LAEFVVGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVTRCHKCG--ELPVASS  157

Query  357  AGA  349
            + A
Sbjct  158  SSA  160



>gb|KDP43788.1| hypothetical protein JCGZ_22415 [Jatropha curcas]
Length=209

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 94/132 (71%), Gaps = 6/132 (5%)
 Frame = -3

Query  714  ARCAWLRRIRagangga--sgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE--KEIPADC  547
            ARCAWLRR   G+   +       +NKGLKKK+++SLPKFTYG + A      K    +C
Sbjct  50   ARCAWLRRGSGGSTSRSTSQAAAVANKGLKKKIVQSLPKFTYGATAAGGGSSCKFASTEC  109

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+ EGDE+R+LPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KCG  + P+
Sbjct  110  AICLGEFAEGDEVRILPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVARCQKCG--QFPA  167

Query  366  VSPAGAGEQSQS  331
            +S    G  +++
Sbjct  168  ISSGRGGPAAET  179



>ref|XP_011100182.1| PREDICTED: RING-H2 finger protein ATL80-like [Sesamum indicum]
Length=185

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 9/140 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqx----ssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARC+W+RR     +           ++NKGLKKKVL+SLPK TYG     A +    +DC
Sbjct  48   ARCSWIRRFTGRNSTPTESGAPPRSAANKGLKKKVLKSLPKQTYGEDKEQAGKL---SDC  104

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+ +G+EIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KCG     +
Sbjct  105  AICLAEFTDGEEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCQKCGSLPAGT  164

Query  366  VSPAGAG--EQSQSAINILL  313
             S AG    E S + +N  L
Sbjct  165  ASAAGRAQPELSDNHVNRFL  184



>ref|XP_011022135.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
Length=200

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR+  G + G   Q  +NKG+KKK L+ LP+FTY      A       +CAICL
Sbjct  46   ARCAWLRRVTGGVSSGPPPQAKANKGVKKKNLQLLPRFTYSAGGGGATTSFGTTECAICL  105

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             E+ EGDE+RVLPQC HGFHV CID WLGSHSSCPSCRQILVVARC+KCG
Sbjct  106  GEFVEGDEVRVLPQCGHGFHVGCIDKWLGSHSSCPSCRQILVVARCQKCG  155



>ref|XP_009338623.1| PREDICTED: RING-H2 finger protein ATL80-like [Pyrus x bretschneideri]
Length=215

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   G    +S   S+NKGLKKKVL+SLPKFTYG +  A    ++ ++CAICL
Sbjct  56   ARCAWLRRGPGGRAAMSSASSSANKGLKKKVLQSLPKFTYG-TGGAEPPPKLGSECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
             E+ EG EIR+LPQC H FHV CIDTWLGSHSSCPSCRQILVVARC KCG    P
Sbjct  115  GEFVEGHEIRILPQCGHVFHVGCIDTWLGSHSSCPSCRQILVVARCHKCGGFPAP  169



>ref|XP_010416561.1| PREDICTED: RING-H2 finger protein ATL8 [Camelina sativa]
Length=186

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRRI               ++NKGLKKKVLRSLPK TY P  +  AEK +  +CA
Sbjct  49   SRCAWLRRIATRNRSDQTHQPPVAAANKGLKKKVLRSLPKLTYSPD-SPPAEKLV--ECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVLCIDTWLGSHSSCPSCRQILVVARCHKC  157



>ref|XP_007018117.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY15342.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=193

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs----snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARCAWLRR+   +    +        +NKGLKKK+L+SLPK T+    +A       +DC
Sbjct  55   ARCAWLRRLSGSSASNPADTPRPTPPANKGLKKKILKSLPKATFSAESSAKF-----SDC  109

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+E GDEIRVLPQC HGFHV CID WLGSHSSCPSCRQILVVARC KCG    P 
Sbjct  110  AICLAEFEVGDEIRVLPQCGHGFHVACIDMWLGSHSSCPSCRQILVVARCHKCGGLPGPG  169

Query  366  VSPAGAGEQSQ  334
             S +G   +++
Sbjct  170  ASTSGTDTEAR  180



>ref|NP_177767.1| RING-H2 finger protein ATL8 [Arabidopsis thaliana]
 sp|Q8LC69.2|ATL8_ARATH RecName: Full=RING-H2 finger protein ATL8 [Arabidopsis thaliana]
 gb|AAF16660.1|AC012394_9 putative RING zinc finger protein; 36546-35989 [Arabidopsis thaliana]
 gb|AAG51946.1|AC015450_7 putative RING zinc finger protein; 5217-5774 [Arabidopsis thaliana]
 dbj|BAC43477.1| putative RING finger protein [Arabidopsis thaliana]
 gb|AAO63979.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEE35838.1| RING-H2 finger protein ATL8 [Arabidopsis thaliana]
Length=185

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 82/112 (73%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRRI               ++NKGLKKKVLRSLPK TY P  +  AEK +  +CA
Sbjct  49   SRCAWLRRIASRNRSDQTHPPPVAAANKGLKKKVLRSLPKLTYSPD-SPPAEKLV--ECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVTRCHKC  157



>gb|AAM63811.1| putative RING zinc finger protein [Arabidopsis thaliana]
Length=186

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 82/112 (73%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRRI               ++NKGLKKKVLRSLPK TY P  +  AEK +  +CA
Sbjct  49   SRCAWLRRIASRNRSDQTHPPPVAAANKGLKKKVLRSLPKLTYSPD-SPPAEKLV--ECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVTRCHKC  157



>ref|XP_002532473.1| protein with unknown function [Ricinus communis]
 gb|EEF29897.1| protein with unknown function [Ricinus communis]
Length=204

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 91/132 (69%), Gaps = 10/132 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLR   + ++  +    +    LKKK+L+SLPKFTYG   AA + K    +CAICL
Sbjct  50   ARCAWLRHSGSASSSPSHAAANKG--LKKKILQSLPKFTYGS--AAGSCKFASTECAICL  105

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             E+ +GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC  CG    P++S +
Sbjct  106  GEFAQGDEVRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVARCHTCG--RFPTISSS  163

Query  354  ----GAGEQSQS  331
                GA  ++ S
Sbjct  164  SSCDGANAEADS  175



>gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea]
Length=198

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RR+  G +  +S   ++NKGLKKKVL SLPK T+      AA+    +DCAICL
Sbjct  59   ARCAWIRRLGGGESAASSLPAAANKGLKKKVLNSLPKTTFAEDSKLAAKL---SDCAICL  115

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            +++  G+E+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILV ARC+ C C + P V+ A
Sbjct  116  SDFSAGEELRVLPQCGHGFHVVCIDTWLGSHSSCPSCRQILVAARCQNCQCSQPPPVAAA  175

Query  354  GAG  346
             +G
Sbjct  176  CSG  178



>ref|XP_010428701.1| PREDICTED: RING-H2 finger protein ATL8-like [Camelina sativa]
Length=186

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRR+               ++NKGLKKKVLRSLPK TY P  +  AEK +  +CA
Sbjct  49   SRCAWLRRMATRNRADQTHQPPVAAANKGLKKKVLRSLPKLTYSPD-SPPAEKLV--ECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVLCIDTWLGSHSSCPSCRQILVVARCHKC  157



>ref|XP_002276539.1| PREDICTED: RING-H2 finger protein ATL80 [Vitis vinifera]
 emb|CBI21575.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR  AG    ++ Q ++NKGLKKK+L+SLPK T+  + +        A+CAICL
Sbjct  49   ARCAWLRRGSAGGARASATQPAANKGLKKKILQSLPKLTHDATVSGKF-----AECAICL  103

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
             E+ EGDEIRVLPQC HGFHV C+DTWL SHSSCPSCRQILVV RCR+CG  + P++S
Sbjct  104  AEFVEGDEIRVLPQCGHGFHVLCVDTWLSSHSSCPSCRQILVVTRCRQCG--KFPAIS  159



>ref|XP_010471794.1| PREDICTED: RING-H2 finger protein ATL8-like [Camelina sativa]
Length=186

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 80/112 (71%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRRI               ++NKGLKKKVLRSLPK TY P    A   E   +CA
Sbjct  49   SRCAWLRRIATRNRSDQTHQPPVAAANKGLKKKVLRSLPKLTYSPDSPPA---EQLVECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVLCIDTWLGSHSSCPSCRQILVVARCHKC  157



>ref|XP_008242103.1| PREDICTED: RING-H2 finger protein ATL8 [Prunus mume]
Length=215

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs-snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAWLRR         S   + +NKG+KKKVL+SLPKFTYG   A    K + ++CAIC
Sbjct  55   ARCAWLRRGSGAGGASLSSAQAPANKGVKKKVLQSLPKFTYGIGGAEPPPK-LASECAIC  113

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            L E+ EGDEIRVLPQC H FHV C+D WLGSHSSCPSCRQILVVARC+KCG
Sbjct  114  LGEFAEGDEIRVLPQCGHVFHVGCVDMWLGSHSSCPSCRQILVVARCQKCG  164



>ref|XP_004238452.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum lycopersicum]
Length=183

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs-snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAW+RRI A A G +      +NKGLKKKVL+SLPKF+Y    AA       ++CAIC
Sbjct  47   ARCAWIRRISARATGNSVFSSPPANKGLKKKVLKSLPKFSYSAEHAAKF-----SECAIC  101

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            L E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KCG
Sbjct  102  LAEFAVGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVTRCHKCG  152



>ref|XP_004287710.1| PREDICTED: RING-H2 finger protein ATL8 [Fragaria vesca subsp. 
vesca]
Length=208

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +    ++NKGLKKKVL+ LPKFTYG    AA  K + ++CAICL
Sbjct  53   ARCAWLRR-APVPGGQSQASSAANKGLKKKVLQQLPKFTYGDGGPAAPPK-MGSECAICL  110

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGC-KEIPSVSP  358
             E+ EGDEIR LPQC H FHV CIDTWLGSHSSCPSCRQ+LVVARC KCG    IP   P
Sbjct  111  GEFAEGDEIRALPQCGHVFHVGCIDTWLGSHSSCPSCRQVLVVARCHKCGNFPAIPESEP  170



>ref|XP_006390200.1| hypothetical protein EUTSA_v10019183mg [Eutrema salsugineum]
 gb|ESQ27486.1| hypothetical protein EUTSA_v10019183mg [Eutrema salsugineum]
Length=190

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 87/116 (75%), Gaps = 10/116 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg-------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP  556
            +RC WLRR+ +G    A+          ++NKGLKKKVLRSLPK TY P  +  AEK   
Sbjct  49   SRCLWLRRLVSGNRAAANSDQTHPPPVAAANKGLKKKVLRSLPKLTYSPD-STPAEKF--  105

Query  555  ADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            A+CAICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KC
Sbjct  106  AECAICLTEFAAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCQKC  161



>emb|CAN59779.1| hypothetical protein VITISV_024654 [Vitis vinifera]
Length=312

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 90/126 (71%), Gaps = 9/126 (7%)
 Frame = -3

Query  714  ARCAWLRRIRagang--gasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRRI   AN   G++ Q  +NKGLKKK+LRSLPK TY    A         DCAI
Sbjct  49   ARCAWLRRISGAANLPGGSAPQTPANKGLKKKILRSLPKVTYAAETAGNL-----TDCAI  103

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
            CLTE+  GDEIRVLPQC HGFHV CIDTWLGSH SCPSCRQILVVARC+KCG   +P+ S
Sbjct  104  CLTEFVGGDEIRVLPQCGHGFHVGCIDTWLGSHCSCPSCRQILVVARCQKCG--GVPASS  161

Query  360  PAGAGE  343
             +   E
Sbjct  162  SSTGAE  167



>ref|XP_011034822.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
 ref|XP_011034823.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
Length=198

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 80/112 (71%), Gaps = 8/112 (7%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARCAWLRR                 +NKGLKKKVLRSLPK T+   F+     ++P DCA
Sbjct  54   ARCAWLRRFSSRNPTPPVPPPPPAVANKGLKKKVLRSLPKQTFSEDFSG----KLP-DCA  108

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC+KC
Sbjct  109  ICLTEFSAGDEIRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVTRCQKC  160



>ref|XP_002510714.1| protein with unknown function [Ricinus communis]
 gb|EEF52901.1| protein with unknown function [Ricinus communis]
Length=194

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 91/130 (70%), Gaps = 14/130 (11%)
 Frame = -3

Query  714  ARCAWLRRI------RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPA  553
            ARCAWLRR+      R GA        ++NKGLKKK+LRSLPK T+     +A       
Sbjct  58   ARCAWLRRLSSMANSRGGAPAQPPVPSAANKGLKKKILRSLPKQTF-----SADSTPKFY  112

Query  552  DCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEI  373
            DCAICL E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KCG   +
Sbjct  113  DCAICLAEFAPGDEIRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCQKCG--GL  170

Query  372  PSVSPAGAGE  343
            P+ S +G GE
Sbjct  171  PA-SASGGGE  179



>ref|XP_009766634.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana sylvestris]
Length=191

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 89/123 (72%), Gaps = 8/123 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs-snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAW+RRI A A G ++     +NKGLKKKVL+SLPK +Y    AA       ++CAIC
Sbjct  56   ARCAWIRRISARATGNSAFSSPPANKGLKKKVLKSLPKLSYTTEHAAKF-----SECAIC  110

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            L E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KCG  E+P  S 
Sbjct  111  LAEFAVGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVTRCHKCG--ELPVASS  168

Query  357  AGA  349
            + A
Sbjct  169  SSA  171



>ref|XP_006366657.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=183

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 89/131 (68%), Gaps = 7/131 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR   G   G     ++NKGLKKKVL SLPKF + P   A +  E  A+CAICL
Sbjct  60   ARCAWLRR--TGGATGGQSAAAANKGLKKKVLHSLPKFKFDP---ATSSTEAAAECAICL  114

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             EY  GDEI+VLPQC HGFHV+CIDTWLGSHSSCP+CRQIL    CR+CG  E    S A
Sbjct  115  AEYIRGDEIKVLPQCGHGFHVRCIDTWLGSHSSCPTCRQILQTGPCRRCG--EFSGNSNA  172

Query  354  GAGEQSQSAIN  322
            GA  Q ++ + 
Sbjct  173  GAQIQGRNCLT  183



>gb|KFK42061.1| hypothetical protein AALP_AA2G206300 [Arabis alpina]
Length=175

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq------xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPA  553
            +RCAWLRR+       +          ++NKGLKKKVLRSLPK TY P  ++  EK +  
Sbjct  49   SRCAWLRRLANRTAANSDQTQPPHVASAANKGLKKKVLRSLPKVTYSPE-SSPTEKLV--  105

Query  552  DCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            +CAICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KC
Sbjct  106  ECAICLTEFVAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVTRCHKC  160



>ref|XP_010270525.1| PREDICTED: RING-H2 finger protein ATL80 [Nelumbo nucifera]
Length=189

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = -3

Query  714  ARCAWLRRIRagangg--asgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRR+  GA G      Q  +NKGLKKK+LRSLPK T+          +   DC I
Sbjct  49   ARCAWLRRVSGGAAGSGRTQPQAPANKGLKKKILRSLPKQTFNGGGDLNGNGKF-VDCVI  107

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
            CLTE+ EGDEIRVLPQC H FHV CIDTWLGSHSSCPSCRQILVVARC+KCG    P  S
Sbjct  108  CLTEFVEGDEIRVLPQCGHAFHVGCIDTWLGSHSSCPSCRQILVVARCQKCG--GFPETS  165

Query  360  PAGAGEQSQ  334
             + A   ++
Sbjct  166  GSAAAVDTE  174



>ref|XP_010266252.1| PREDICTED: RING-H2 finger protein ATL80 [Nelumbo nucifera]
Length=189

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs--snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRR   GA      Q    +NKGLKKK+L+SLPK T+         K   ADCAI
Sbjct  49   ARCAWLRRASGGAARTGRTQPQPPANKGLKKKILKSLPKQTFNGDINGKG-KLADADCAI  107

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CLTE+ +GDEIRVLPQC H FHV CIDTWLGSHSSCPSCRQ+LVVARC+KCG
Sbjct  108  CLTEFVQGDEIRVLPQCGHAFHVGCIDTWLGSHSSCPSCRQVLVVARCQKCG  159



>ref|XP_010498523.1| PREDICTED: RING-H2 finger protein ATL80-like [Camelina sativa]
Length=198

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 84/119 (71%), Gaps = 12/119 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg---------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKE  562
            +RC WLRR+ AG    +             ++NKGLKKKVL+SLPK T+ P    +   E
Sbjct  51   SRCVWLRRLAAGNRTASGSHQGQSPSPPVAAANKGLKKKVLQSLPKLTFSPE---SPSSE  107

Query  561  IPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
              A+CAICLTE+  GDE+RVLPQC HGFHV CIDTWLG+HSSCPSCRQILVVARC KCG
Sbjct  108  KFAECAICLTEFSAGDELRVLPQCGHGFHVSCIDTWLGTHSSCPSCRQILVVARCHKCG  166



>ref|XP_010537218.1| PREDICTED: RING-H2 finger protein ATL80-like [Tarenaya hassleriana]
Length=184

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 82/112 (73%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss---nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RCAWLRR+ A    G S        NKGLKK VLRSLPK TY      + E E  A+CA
Sbjct  45   SRCAWLRRLSASGPSGQSPPPPPAASNKGLKKNVLRSLPKLTYS---VESPESEKFAECA  101

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICL+E+  GDEIRVLPQC HGFH+ CIDTWLGSHSSCPSCRQILVVARC+KC
Sbjct  102  ICLSEFVSGDEIRVLPQCGHGFHLSCIDTWLGSHSSCPSCRQILVVARCQKC  153



>ref|XP_009104676.1| PREDICTED: RING-H2 finger protein ATL8-like [Brassica rapa]
Length=185

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 82/112 (73%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RC WLRRI    +          ++N+GLKKK+LRSLPK TY P  +  AEK +  +C 
Sbjct  49   SRCTWLRRIAAPNSVQTHHQPPVAAANRGLKKKILRSLPKLTYSPD-SPPAEKLV--ECV  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWL SHSSCPSCRQILVVARC+KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLESHSSCPSCRQILVVARCQKC  157



>ref|XP_008449155.1| PREDICTED: RING-H2 finger protein ATL80 [Cucumis melo]
Length=178

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 88/122 (72%), Gaps = 14/122 (11%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR           Q S+N+GLKKK+L+SLPKF Y  +     + +I A+CAICL
Sbjct  48   ARCAWLRR---------GNQASANRGLKKKILQSLPKFRYKST---VGDGKIAAECAICL  95

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             E+ EG+EIR LPQC H FHV C+DTWLG+HSSCPSCRQILVVARC+KCG  + P+V   
Sbjct  96   AEFLEGEEIRQLPQCGHCFHVSCVDTWLGTHSSCPSCRQILVVARCQKCG--QFPAVVQG  153

Query  354  GA  349
            GA
Sbjct  154  GA  155



>ref|XP_006435418.1| hypothetical protein CICLE_v10004041mg [Citrus clementina]
 ref|XP_006473922.1| PREDICTED: RING-H2 finger protein ATL80-like [Citrus sinensis]
 gb|ESR48658.1| hypothetical protein CICLE_v10004041mg [Citrus clementina]
Length=198

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 80/115 (70%), Gaps = 11/115 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG------LKKKVLRSLPKFTYGPSFAAAAEKEIPA  553
            ARCAWLRR+  G     +   +S +       LKKK+LR+LPK T+     A       +
Sbjct  50   ARCAWLRRLSGGGAAATNPSGTSTRNSPANKGLKKKILRTLPKQTFTSESVAKF-----S  104

Query  552  DCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            DCAICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KC
Sbjct  105  DCAICLTEFVNGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCQKC  159



>gb|KDO85202.1| hypothetical protein CISIN_1g043163mg, partial [Citrus sinensis]
Length=172

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 80/115 (70%), Gaps = 11/115 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG------LKKKVLRSLPKFTYGPSFAAAAEKEIPA  553
            ARCAWLRR+  G     +   +S +       LKKK+LR+LPK T+     A       +
Sbjct  24   ARCAWLRRLSGGGAAATNPSGTSTRNSPANKGLKKKILRTLPKQTFTSESVAKF-----S  78

Query  552  DCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            DCAICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC+KC
Sbjct  79   DCAICLTEFVNGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCQKC  133



>gb|ABK56013.1| zinc finger protein [Brassica rapa]
Length=196

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 87/121 (72%), Gaps = 14/121 (12%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq-----------xssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG    A  Q            ++NKGLKKKVL+SLPK T+ P  + ++E
Sbjct  51   SRCVWLRRLAAGNRTHAGSQGGSVQSPPPPVAAANKGLKKKVLQSLPKLTFSPD-SPSSE  109

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            K    +CAICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  110  KF--TECAICLTEFSNGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKC  167

Query  387  G  385
            G
Sbjct  168  G  168



>emb|CDY01352.1| BnaA07g11250D [Brassica napus]
Length=196

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 87/121 (72%), Gaps = 14/121 (12%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq-----------xssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG    A  Q            ++NKGLKKKVL+SLPK T+ P  + ++E
Sbjct  51   SRCVWLRRLAAGNRTHAGSQGGSGQSPPPPVAAANKGLKKKVLQSLPKLTFSPD-SPSSE  109

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            K    +CAICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  110  KF--TECAICLTEFSNGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKC  167

Query  387  G  385
            G
Sbjct  168  G  168



>emb|CDY33648.1| BnaC08g19480D [Brassica napus]
Length=197

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 83/118 (70%), Gaps = 11/118 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaga--------nggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            +RC WLRR+ AG                 ++NKGLKKKVL+SLPK T+ P    +   E 
Sbjct  51   SRCVWLRRLAAGNRSSSGGSGQSPPPQVAAANKGLKKKVLQSLPKLTFSPE---SPSSEK  107

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             A+CAICLTE+  GDE+RVLPQC HGFH+ CIDTWLGSHSSCPSCRQILVVARC KCG
Sbjct  108  FAECAICLTEFTAGDELRVLPQCGHGFHLSCIDTWLGSHSSCPSCRQILVVARCHKCG  165



>emb|CDY45988.1| BnaA02g18080D [Brassica napus]
Length=186

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 91/122 (75%), Gaps = 7/122 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            +RC WLRR+ A  +   S Q  +NKGLKKKVL+SLPK TY    +  AEK   A+CAICL
Sbjct  49   SRCVWLRRL-ANRSAANSDQPPANKGLKKKVLKSLPKLTYSLD-SPPAEKL--AECAICL  104

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV-ARCRKCGCKEIPSVSP  358
            TE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV ARC+KCG   +P  S 
Sbjct  105  TEFAAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVIARCQKCG--GLPGSSS  162

Query  357  AG  352
            AG
Sbjct  163  AG  164



>ref|XP_009103326.1| PREDICTED: RING-H2 finger protein ATL80-like [Brassica rapa]
Length=196

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 87/121 (72%), Gaps = 14/121 (12%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq-----------xssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG    A  Q            ++NKGLKKKVL+SLPK T+ P  + ++E
Sbjct  51   SRCVWLRRLAAGNRTHAGSQGGSVQSPPPPVAAANKGLKKKVLQSLPKLTFSPD-SPSSE  109

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            K    +CAICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  110  KF--TECAICLTEFSNGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKC  167

Query  387  G  385
            G
Sbjct  168  G  168



>ref|XP_006342531.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=192

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 89/128 (70%), Gaps = 8/128 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCAIC  538
            ARCAW+RRI AG N        +NKGLKKKVL+SLPKF+Y P      E+ +  ++CAIC
Sbjct  57   ARCAWIRRI-AGGNSDDDPLPPANKGLKKKVLKSLPKFSYTP------ERSVQFSECAIC  109

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            L E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQI VV+RC  CG   + + S 
Sbjct  110  LMEFVIGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVSRCSMCGELPVTNSSA  169

Query  357  AGAGEQSQ  334
            A  GE   
Sbjct  170  AVGGETGN  177



>ref|XP_009595867.1| PREDICTED: RING-H2 finger protein ATL80 [Nicotiana tomentosiformis]
Length=191

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs-snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAW+RRI A A G ++     +NKGLKKKVL+SLPK +Y    AA       ++CAIC
Sbjct  56   ARCAWIRRISARATGNSAFSSPPANKGLKKKVLKSLPKLSYTTEHAAKF-----SECAIC  110

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
            L E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQILVV RC KCG  E+P
Sbjct  111  LAEFVVGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQILVVTRCHKCG--ELP  164



>ref|NP_173506.1| RING-H2 finger protein ATL80 [Arabidopsis thaliana]
 sp|Q9LM69.1|ATL80_ARATH RecName: Full=RING-H2 finger protein ATL80 [Arabidopsis thaliana]
 gb|AAF80624.1|AC069251_17 F2D10.34 [Arabidopsis thaliana]
 gb|AAK76523.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30028.1| RING-H2 finger protein ATL80 [Arabidopsis thaliana]
Length=197

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 83/117 (71%), Gaps = 11/117 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg--------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            +RC WLRR+ AG    +            ++NKGLKKKVL+SLPK T+ P    + E E 
Sbjct  51   SRCVWLRRLAAGNRTVSGSQTQSPQPPVAAANKGLKKKVLQSLPKLTFSPE---SPESEK  107

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             A+CAICL E+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  108  FAECAICLAEFSAGDELRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCHKC  164



>gb|ADW66128.1| RING-H2 finger protein RHA3b [Solanum nigrum]
Length=142

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 88/128 (69%), Gaps = 6/128 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RRI AG N        +NKGLKKKVLRSLPKF+Y    +A       ++CAICL
Sbjct  7    ARCAWIRRI-AGINSADPPSLPANKGLKKKVLRSLPKFSYTSERSAKF-----SECAICL  60

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQI VV+RC  CG   + S S  
Sbjct  61   MEFVVGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVSRCHMCGELPVTSSSSD  120

Query  354  GAGEQSQS  331
              GE + S
Sbjct  121  VRGETAGS  128



>ref|XP_008453009.1| PREDICTED: RING-H2 finger protein ATL80 [Cucumis melo]
Length=185

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqx----ssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARCAWLR +     G  S +     +SNKGLKKK+LRSLPK+T+   F+A       +DC
Sbjct  48   ARCAWLRHLAGDGAGAGSTRPPPPPASNKGLKKKILRSLPKYTFTAEFSAQF-----SDC  102

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+  GDEIRVLPQC HGFHV CIDTW  SHSSCPSCRQILVV++C+KCG    P+
Sbjct  103  AICLAEFAVGDEIRVLPQCGHGFHVSCIDTWFRSHSSCPSCRQILVVSQCQKCG--GFPA  160

Query  366  VSPAGAGEQSQ  334
             S +  G +S+
Sbjct  161  SSSSNGGTESR  171



>ref|XP_011041176.1| PREDICTED: RING-H2 finger protein ATL8 [Populus euphratica]
Length=194

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 81/112 (72%), Gaps = 8/112 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq---xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARCAWLRR+ +      +       +NKGLKKK LRSLPK T+    A  +     +DCA
Sbjct  54   ARCAWLRRLSSHTPAPPAPLPPPSVANKGLKKKTLRSLPKQTFSEDSAGKS-----SDCA  108

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL+VARC+KC
Sbjct  109  ICLTEFSVGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILMVARCQKC  160



>ref|XP_007202550.1| hypothetical protein PRUPE_ppa011201mg [Prunus persica]
 gb|EMJ03749.1| hypothetical protein PRUPE_ppa011201mg [Prunus persica]
Length=220

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG-LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARCAWLRR         S   +S    +KKKVL+SLPKFTYG   A    K + ++CAIC
Sbjct  55   ARCAWLRRGSGAGGASLSSAQASANKGVKKKVLQSLPKFTYGIGGAEPPPK-LASECAIC  113

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            L E+ EGDEIRVLPQC H FHV C+D WLGSHSSCPSCRQILVVARC+KCG
Sbjct  114  LGEFAEGDEIRVLPQCGHVFHVGCVDMWLGSHSSCPSCRQILVVARCQKCG  164



>ref|XP_004253118.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=186

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RRI  G +  +    ++   LKKKVL+SLPKF+Y P  +        ++CAICL
Sbjct  51   ARCAWIRRITGGNSDDSPFPPANKG-LKKKVLKSLPKFSYTPEQSVQF-----SECAICL  104

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQI VV+RC  CG   + + S A
Sbjct  105  MEFVIGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVSRCSMCGELPVMNSSAA  164

Query  354  GAGE  343
              GE
Sbjct  165  VGGE  168



>gb|ADI71977.1| E3 ubiquitin ligase [Capsicum annuum]
Length=197

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxs-snkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAIC  538
            ARC W+RRI     G ++   + +NKGLKKKVL+SLPKF YG     A   +  ++CAIC
Sbjct  56   ARCNWIRRISGSIAGNSAFASAPANKGLKKKVLKSLPKFNYG-----AEHADKFSECAIC  110

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
            L E+  G+EIRVLPQC HGFHV CIDTWLGSHSSCPSCR ILVV RC KCG  E+P
Sbjct  111  LAEFAVGEEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRSILVVTRCHKCG--ELP  164



>ref|XP_010029567.1| PREDICTED: RING-H2 finger protein ATL8-like [Eucalyptus grandis]
 gb|KCW56484.1| hypothetical protein EUGRSUZ_I02211 [Eucalyptus grandis]
Length=201

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 95/145 (66%), Gaps = 19/145 (13%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss---------nkGLKKKVLRSLPKFTYGPS--------  586
            ARCAWLRR    +   A+   ++         N+GLKKK L+SLPK  YGP         
Sbjct  47   ARCAWLRRYPPASAASATAAAAAVASRPPPAANRGLKKKALQSLPKIVYGPGEAGAAAAA  106

Query  585  FAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV  406
             AA A   +P +CAICL E+ EGDE+R+LPQC HGFHV CID WLGSHSSCPSCRQILVV
Sbjct  107  AAAGAAGRLPVECAICLAEFAEGDEVRLLPQCGHGFHVGCIDPWLGSHSSCPSCRQILVV  166

Query  405  ARCRKCGCKEIPSVSPAGAGEQSQS  331
            ARC+KCG  + P+V  AGA  Q ++
Sbjct  167  ARCQKCG--QFPAVPAAGAEVQLKA  189



>ref|XP_007046460.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007046461.1| Basic helix-loop-helix-containing protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX90617.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX90618.1| Basic helix-loop-helix-containing protein, putative isoform 1 
[Theobroma cacao]
Length=185

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAE--KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCI  463
            LKKKVL+SLPK TY    A + +  K    +CAICL E+ EGDEIRVLPQC HGFHV C+
Sbjct  70   LKKKVLQSLPKVTYNKDAAISTDTVKFASMECAICLGEFAEGDEIRVLPQCGHGFHVGCV  129

Query  462  DTWLGSHSSCPSCRQILVVARCRKCG  385
            DTWLGSHSSCPSCRQILVVARC KCG
Sbjct  130  DTWLGSHSSCPSCRQILVVARCHKCG  155



>ref|XP_006303328.1| hypothetical protein CARUB_v10010177mg [Capsella rubella]
 gb|EOA36226.1| hypothetical protein CARUB_v10010177mg [Capsella rubella]
Length=234

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 83/118 (70%), Gaps = 11/118 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg--------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            +RC WLRR  AG    +            ++NKGLKKKVL+SLPK TY P   ++ +   
Sbjct  86   SRCVWLRRHAAGNRTASGSPGQTPQPQVAAANKGLKKKVLQSLPKLTYSPESPSSKKF--  143

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             A+CAICL E+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KCG
Sbjct  144  -AECAICLAEFSAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKCG  200



>emb|CDX68098.1| BnaA07g21380D [Brassica napus]
Length=185

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RC WLRRI    +          ++N+GLKKK+LRSLPK TY P  +   EK +  +C 
Sbjct  49   SRCTWLRRIAAPNSVQTHHQPPVAAANRGLKKKILRSLPKLTYSPD-SPPGEKLV--ECV  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWL SHSSCPSCRQILVVARC+KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLESHSSCPSCRQILVVARCQKC  157



>gb|EYU23603.1| hypothetical protein MIMGU_mgv1a014346mg [Erythranthe guttata]
Length=192

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 88/128 (69%), Gaps = 8/128 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss-----nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPAD  550
            ARCAW+RR+  G++   +    +     NKGLKKKVL SLPK TYG       ++E  +D
Sbjct  52   ARCAWIRRLAGGSSAPPAAPPRAAAAAANKGLKKKVLNSLPKLTYGEE---TEQQENLSD  108

Query  549  CAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
            CAICL E+  G+EIR+LPQC HGFHV CIDTWL SHSSCPSCR+ILVVARC+ CG     
Sbjct  109  CAICLAEFAAGEEIRLLPQCGHGFHVSCIDTWLRSHSSCPSCRKILVVARCKNCGSLPET  168

Query  369  SVSPAGAG  346
            + S A AG
Sbjct  169  TTSSAAAG  176



>ref|XP_004512286.1| PREDICTED: RING-H2 finger protein ATL8-like [Cicer arietinum]
Length=217

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 85/123 (69%), Gaps = 6/123 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +  Q  +NKGLKKKVL+SLPKF Y  S     +    ++CAICL
Sbjct  54   ARCAWLRR--DSGAGNSPQQALANKGLKKKVLQSLPKFAYVDS--TPGKWLATSECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            +E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL V RC+KCG    P+    
Sbjct  110  SEFTAGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILAVTRCQKCG--RFPATGAE  167

Query  354  GAG  346
             AG
Sbjct  168  AAG  170



>emb|CDX87603.1| BnaA07g32700D [Brassica napus]
Length=192

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKKVLRSLPK TY P  +  AEK   A+CAICLTE+  GDE+RVLPQC HGFHV CIDT
Sbjct  82   LKKKVLRSLPKLTYSPD-SPPAEKL--AECAICLTEFAAGDELRVLPQCGHGFHVACIDT  138

Query  456  WLGSHSSCPSCRQILVVARCRKC  388
            WLGSHSSCPSCRQ+LVVARC+KC
Sbjct  139  WLGSHSSCPSCRQVLVVARCQKC  161



>ref|XP_004145558.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 ref|XP_004172116.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 gb|KGN55526.1| hypothetical protein Csa_4G664340 [Cucumis sativus]
Length=185

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqx----ssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARCAWLR +     G  S +     +SNKGLKKK+LRSLPK+T+   F+A       +DC
Sbjct  48   ARCAWLRHLAGDGGGAGSTRPPPPPASNKGLKKKILRSLPKYTFTAEFSAQF-----SDC  102

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPS  367
            AICL E+  GDEIRVLPQC HGFH+ CIDTW  SHSSCPSCRQILVV++C+KCG    P+
Sbjct  103  AICLAEFAVGDEIRVLPQCGHGFHMSCIDTWFRSHSSCPSCRQILVVSQCQKCG--GFPA  160

Query  366  VSPAGAGEQSQ  334
             S +  G +S+
Sbjct  161  SSSSNGGTESR  171



>ref|XP_010477335.1| PREDICTED: RING-H2 finger protein ATL80 [Camelina sativa]
Length=198

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 12/119 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg---------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKE  562
            +RC WLRR+ AG    +             ++NKGLKKKVL+SLPK T+ P    +   E
Sbjct  51   SRCVWLRRLAAGNRTASGSHQGQSPSPPVAAANKGLKKKVLQSLPKLTFSPE---SPSSE  107

Query  561  IPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
              A+CAICLTE+  GDE+RVLPQC HGFHV CIDTWLG+HSSCPSCRQILVVA C KCG
Sbjct  108  KFAECAICLTEFSAGDELRVLPQCGHGFHVPCIDTWLGTHSSCPSCRQILVVATCHKCG  166



>ref|XP_004234505.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=178

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 91/133 (68%), Gaps = 13/133 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARC WLRR     +   +     NKGLKKKVL+ LPKF Y PS   + E    A+CAICL
Sbjct  56   ARCTWLRR-----DPPENPPPVKNKGLKKKVLKYLPKFKYDPS---SGELPFAAECAICL  107

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV--ARCRKCGCKEIPSVS  361
             EY EGDEIRVLP C H FH+QC+DTWL ++SSCPSCRQILVV  ARCRKCG  E+P++S
Sbjct  108  VEYVEGDEIRVLPNCGHRFHLQCVDTWLLTNSSCPSCRQILVVARARCRKCG--EVPAIS  165

Query  360  -PAGAGEQSQSAI  325
              A  G Q  +A+
Sbjct  166  GEASDGGQILTAV  178



>emb|CDY29504.1| BnaA06g14660D [Brassica napus]
Length=202

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 83/120 (69%), Gaps = 14/120 (12%)
 Frame = -3

Query  714  ARCAWLRRIRagangga-----------sgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG    +               ++NKGLKKKVL+SLPK T+ P    +  
Sbjct  51   SRCVWLRRLAAGTRTSSGSQDGSGQSPPQQAAAANKGLKKKVLQSLPKLTFSPE---SPS  107

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             E  A+CAICLTE+  GDE+RVLPQC HGFH+ CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  108  SEKFAECAICLTEFTAGDELRVLPQCGHGFHLSCIDTWLGSHSSCPSCRQILVVARCHKC  167



>ref|XP_006416360.1| hypothetical protein EUTSA_v10009964mg [Eutrema salsugineum]
 gb|ESQ34713.1| hypothetical protein EUTSA_v10009964mg [Eutrema salsugineum]
Length=200

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 83/120 (69%), Gaps = 14/120 (12%)
 Frame = -3

Query  714  ARCAWLRRIRaganggas-----------gqxssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG     S              ++NKGLKKKVL+SLPK T+ P    +  
Sbjct  51   SRCVWLRRLAAGNRTAPSSQGVSGQSPPPTVAAANKGLKKKVLQSLPKLTFSPE---SPS  107

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             E  ++CAICLTE+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  108  SEKFSECAICLTEFSAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKC  167



>ref|XP_009149561.1| PREDICTED: RING-H2 finger protein ATL80 [Brassica rapa]
 gb|AGW83699.1| RING zinc finger protein [Brassica rapa subsp. chinensis]
Length=202

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 83/120 (69%), Gaps = 14/120 (12%)
 Frame = -3

Query  714  ARCAWLRRIRagangga-----------sgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG    +               ++NKGLKKKVL+SLPK T+ P    +  
Sbjct  51   SRCVWLRRLAAGTRTSSGSQDGSGQSPPQQAAAANKGLKKKVLQSLPKLTFSPE---SPS  107

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             E  A+CAICLTE+  GDE+RV+PQC HGFH+ CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  108  SEKFAECAICLTEFSAGDELRVMPQCGHGFHLSCIDTWLGSHSSCPSCRQILVVARCHKC  167



>ref|XP_010462813.1| PREDICTED: RING-H2 finger protein ATL80-like [Camelina sativa]
Length=221

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 12/119 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg---------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKE  562
            +RC WLRR+ AG    +             ++NKGLKKKVL+SLPK T+ P    +   E
Sbjct  51   SRCVWLRRLAAGNRTASGSHQGQSPSPPVAAANKGLKKKVLQSLPKLTFSPE---SPSSE  107

Query  561  IPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
              A+CAICLTE+  GDE+RVLPQC HGFHV CIDTWLG+HSSCPSCRQILVVA C KCG
Sbjct  108  KFAECAICLTEFSAGDELRVLPQCGHGFHVPCIDTWLGTHSSCPSCRQILVVATCHKCG  166



>emb|CDX85948.1| BnaC06g21860D [Brassica napus]
Length=185

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 80/112 (71%), Gaps = 6/112 (5%)
 Frame = -3

Query  714  ARCAWLRRI---RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            +RC WLRRI    +          ++N+GLKKKVLRSLPK  Y P  +   EK +  +C 
Sbjct  49   SRCTWLRRIAAPNSVQTHHQPPVAAANRGLKKKVLRSLPKLAYSPD-SPPGEKLV--ECV  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDE+RVLPQC HGFHV CIDTWL SHSSCPSCRQILVVARC+KC
Sbjct  106  ICLTEFAAGDELRVLPQCGHGFHVSCIDTWLESHSSCPSCRQILVVARCQKC  157



>ref|XP_003537694.1| PREDICTED: RING-H2 finger protein ATL8-like [Glycine max]
Length=226

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +  Q  +NKGLKKKVL+SLPKF Y  S    ++    ++CAICL
Sbjct  54   ARCAWLRR--GSGAGNSPRQALANKGLKKKVLQSLPKFAYVDS--NPSKWLATSECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             E+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQ+L VARC+KCG
Sbjct  110  AEFAAGDEIRVLPQCGHGFHVPCIDTWLGSHSSCPSCRQVLAVARCQKCG  159



>ref|XP_003612411.1| Ring finger protein [Medicago truncatula]
 gb|AES95369.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
 gb|AFK36320.1| unknown [Medicago truncatula]
Length=215

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 81/110 (74%), Gaps = 4/110 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +  Q  +NKGLKKKVL+SLPKF+Y  S     +     +CAICL
Sbjct  54   ARCAWLRR--DSGAGNSPQQALANKGLKKKVLQSLPKFSYVDS--NPGKWLATTECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            +++  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL V RC+KCG
Sbjct  110  SDFAAGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILAVTRCQKCG  159



>ref|XP_009795598.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=182

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARC+W+RR   G +   S   +    LKKKVL+SLPKF+Y          E  ++CAICL
Sbjct  57   ARCSWIRRFSTGNSAVPSPPANKG--LKKKVLKSLPKFSY----THERSTEF-SECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            TE+  GDEI+VLPQC HGFHV CIDTWLGSHSSCPSCRQI VV RC KCG  E+P    +
Sbjct  110  TEFAIGDEIKVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVTRCHKCG--ELPMAVAS  167

Query  354  GAGEQSQSAINILL  313
             +       +N  L
Sbjct  168  SSSAPRDYHVNAFL  181



>ref|XP_009620555.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=182

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 88/134 (66%), Gaps = 9/134 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RR        A+    +NKGLKKKVL+SLPKF+Y         +E  ++CAICL
Sbjct  57   ARCAWIRRF--ATGNSAAPSPPANKGLKKKVLKSLPKFSY----TLERSREF-SECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            TE+  GDEI+VLPQC HGFHV CIDTWLGSHSSCPSCRQI VV RC KCG  E+P    +
Sbjct  110  TEFAIGDEIKVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVTRCHKCG--ELPVAVAS  167

Query  354  GAGEQSQSAINILL  313
             +       +N  L
Sbjct  168  SSSGPIDYHVNAFL  181



>ref|XP_009589982.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana tomentosiformis]
Length=201

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 88/135 (65%), Gaps = 16/135 (12%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP--ADCAI  541
            ARC WLRR              +NKGLKKKVL+SLPK+ Y PS   A    +P  A+CAI
Sbjct  64   ARCTWLRR------DTPEIPPPANKGLKKKVLKSLPKYKYDPSSTGAGNSALPVTAECAI  117

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV--ARCRKCGCKEIPS  367
            CL EY +GDEIRVLP C H FH+QC+DTWL SH+SCPSCRQILV   +RCRKCG  E+P 
Sbjct  118  CLVEYVQGDEIRVLPHCGHVFHLQCVDTWLASHASCPSCRQILVGSRSRCRKCG--ELPP  175

Query  366  VSPAGAGEQSQSAIN  322
             S    G+ +  +I 
Sbjct  176  FS----GDSNSGSIT  186



>emb|CDX88272.1| BnaC06g37160D [Brassica napus]
Length=191

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 3/83 (4%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKKVLRSLPK TY P  +  AEK   A+CAICL E+  GDE+RVLPQC HGFHV CIDT
Sbjct  82   LKKKVLRSLPKLTYSPD-SPPAEKL--AECAICLMEFAAGDELRVLPQCGHGFHVTCIDT  138

Query  456  WLGSHSSCPSCRQILVVARCRKC  388
            WLGSHSSCPSCRQ+LVVARC+KC
Sbjct  139  WLGSHSSCPSCRQVLVVARCQKC  161



>ref|XP_009110211.1| PREDICTED: RING-H2 finger protein ATL80 [Brassica rapa]
Length=197

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 79/117 (68%), Gaps = 11/117 (9%)
 Frame = -3

Query  714  ARCAWLRRI--------RaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            +RC WLRR+                    ++NKGLKKKVL+SLPK T+ P    +   E 
Sbjct  51   SRCVWLRRLAAGNRSSSGGSGQSPPPQVTAANKGLKKKVLQSLPKMTFSPE---SPSSEK  107

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             A+CAICLTE+  GDE+RVLPQC HGFH+ CIDTWLGSHSSCPSCRQILV ARC KC
Sbjct  108  FAECAICLTEFTAGDELRVLPQCGHGFHLSCIDTWLGSHSSCPSCRQILVAARCHKC  164



>ref|XP_004159747.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
Length=180

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 12/110 (11%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR           Q S+N+GLKKK+L+SLPKF Y    +   + +I A+CAICL
Sbjct  48   ARCAWLRR---------GNQASANRGLKKKILQSLPKFRYK---STVGDGKIAAECAICL  95

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             E+ EG+EIR LPQC H FHV C+DTWLG+HSSCPSCRQILVVARC+KCG
Sbjct  96   AEFLEGEEIRQLPQCGHCFHVSCVDTWLGTHSSCPSCRQILVVARCQKCG  145



>ref|NP_001241583.1| uncharacterized protein LOC100794614 [Glycine max]
 gb|ACU23399.1| unknown [Glycine max]
Length=184

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 82/113 (73%), Gaps = 9/113 (8%)
 Frame = -3

Query  714  ARCAWLRRIRagangga--sgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCA  544
            ARC  LRR+R  ++     S   ++NKG+KKKVLRSLPK T      A AE  +  ADCA
Sbjct  45   ARCGCLRRLRLSSSATTPQSPTSAANKGVKKKVLRSLPKLT------ATAESAVKFADCA  98

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLTE+  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQILVV+RC KCG
Sbjct  99   ICLTEFAAGDEIRVLPQCGHGFHVSCIDAWLRSHSSCPSCRQILVVSRCDKCG  151



>ref|XP_009106302.1| PREDICTED: RING-H2 finger protein ATL8 [Brassica rapa]
Length=192

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 68/83 (82%), Gaps = 3/83 (4%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKKVLRSL K TY P    + + E  A+CAICLTE+  GDE+RVLPQC HGFHV CIDT
Sbjct  82   LKKKVLRSLSKLTYSPD---SPQAEKLAECAICLTEFAAGDELRVLPQCGHGFHVACIDT  138

Query  456  WLGSHSSCPSCRQILVVARCRKC  388
            WLGSHSSCPSCRQ+LVVARC+KC
Sbjct  139  WLGSHSSCPSCRQVLVVARCQKC  161



>ref|XP_004146217.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 gb|KGN55591.1| hypothetical protein Csa_3G000150 [Cucumis sativus]
Length=181

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 12/110 (11%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR           Q S+N+GLKKK+L+SLPKF Y    +   + +I A+CAICL
Sbjct  48   ARCAWLRR---------GNQASANRGLKKKILQSLPKFRYK---STVGDGKIAAECAICL  95

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             E+ EG+EIR LPQC H FHV C+DTWLG+HSSCPSCRQILVVARC+KCG
Sbjct  96   AEFLEGEEIRQLPQCGHCFHVSCVDTWLGTHSSCPSCRQILVVARCQKCG  145



>ref|XP_002306993.2| hypothetical protein POPTR_0005s27660g [Populus trichocarpa]
 gb|EEE93989.2| hypothetical protein POPTR_0005s27660g [Populus trichocarpa]
Length=194

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq---xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARCAWLRR+ +              +NKGLKKK LRSLPK T+    A        +DCA
Sbjct  54   ARCAWLRRLSSHTPAPPVPLPPPSVANKGLKKKTLRSLPKQTFSEDSAGKF-----SDCA  108

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            ICLTE+  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL+V RC+KC
Sbjct  109  ICLTEFSVGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILMVDRCQKC  160



>ref|XP_004509462.1| PREDICTED: RING-H2 finger protein ATL80-like [Cicer arietinum]
Length=205

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 5/130 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +    S+NKGLKKKVL SLPKFTY     +  +  + ++CAICL
Sbjct  50   ARCAWLRR--GPVAGNSPAPGSANKGLKKKVLNSLPKFTY--LDGSPGKWVVSSECAICL  105

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            +E+  G+E+RVLPQC HGFHV C+DTWLGSHSSCPSCR    +ARC+KCG  + P+ + A
Sbjct  106  SEFTAGEEVRVLPQCGHGFHVACVDTWLGSHSSCPSCRAPFAIARCQKCGLYQ-PNSAGA  164

Query  354  GAGEQSQSAI  325
             AGE    ++
Sbjct  165  VAGETEPKSV  174



>ref|XP_002890411.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66670.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 80/117 (68%), Gaps = 11/117 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasg--------qxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            +RC WLRR  AG    +            ++NKGLKKKVL+SLPK  + P    + E E 
Sbjct  51   SRCVWLRRFAAGNRTASGSQGQSPPPPVAAANKGLKKKVLQSLPKLAFSPE---SPESEK  107

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
              +CAICL E+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  108  FVECAICLAEFSAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVARCHKC  164



>ref|XP_006343322.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum tuberosum]
Length=178

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 87/131 (66%), Gaps = 16/131 (12%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARC WLRR     +   +     NKGLKKKVL+ LPKF Y PS     E    A+CAICL
Sbjct  56   ARCTWLRR-----DPPENPPPVKNKGLKKKVLKYLPKFKYDPS---NGELPFAAECAICL  107

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV--ARCRKCGCKEIPSVS  361
             EY EGDEIRVLP C H FH+QC+DTWL ++SSCPSCRQILVV  ARCRKCG  E+P++S
Sbjct  108  VEYVEGDEIRVLPNCGHRFHLQCVDTWLLTNSSCPSCRQILVVARARCRKCG--EVPAIS  165

Query  360  PAGAGEQSQSA  328
                GE S   
Sbjct  166  ----GESSDGG  172



>emb|CDY31495.1| BnaC05g16040D [Brassica napus]
Length=198

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 82/120 (68%), Gaps = 14/120 (12%)
 Frame = -3

Query  714  ARCAWLRRIRagangga-----------sgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE  568
            +RC WLRR+ AG    +               ++NKGLKKK L+SLPK T+ P    +  
Sbjct  51   SRCVWLRRLAAGTRTSSGSQDGSGQSPPQQAAAANKGLKKKALQSLPKVTFSPE---SPS  107

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             E  A+CAICLTE+  GDE+RVLPQC HGFH+ CIDTWLGSHSSCPSCRQILVVARC KC
Sbjct  108  SEKFAECAICLTEFSAGDELRVLPQCGHGFHLSCIDTWLGSHSSCPSCRQILVVARCHKC  167



>emb|CDX96619.1| BnaA08g21620D [Brassica napus]
Length=197

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 81/117 (69%), Gaps = 11/117 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaga--------nggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            +RC WLRR+ AG                 ++NKGLKKKVL+SLPK T+ P    +   E 
Sbjct  51   SRCVWLRRLAAGNRSSSGGSGQSPPPQVTAANKGLKKKVLQSLPKMTFSPE---SPSSEK  107

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             A+CAICLTE+  GDE+RVLPQC HGFH+ CIDTWLGSHSSCPSCRQILV ARC KC
Sbjct  108  FAECAICLTEFTAGDELRVLPQCGHGFHLSCIDTWLGSHSSCPSCRQILVAARCHKC  164



>ref|XP_003629097.1| Ring finger protein [Medicago truncatula]
 gb|AET03573.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=203

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 5/127 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +     +NKGLKKKVL SLPKFTY        +  + ++CAIC+
Sbjct  47   ARCAWLRR--TPVAGASPSAAVANKGLKKKVLNSLPKFTYLDD--TPGKWVVSSECAICI  102

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            +E+  G+E+RVLPQC HGFHV C+DTWLGSHSSCPSCR    VARC+KCG  + P+ +  
Sbjct  103  SEFTAGEEVRVLPQCGHGFHVACVDTWLGSHSSCPSCRAPFAVARCQKCGLYQ-PTAAGE  161

Query  354  GAGEQSQ  334
             AGE  Q
Sbjct  162  VAGETEQ  168



>ref|XP_010935347.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL8-like 
[Elaeis guineensis]
Length=182

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 84/132 (64%), Gaps = 10/132 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RR  + A+   +   +  KGLKKK LRSLP F++  S   A       +C ICL
Sbjct  50   ARCAWIRRFSSTAHPPPAAAAAPPKGLKKKALRSLPTFSFDGSVKLA-------ECPICL  102

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV---ARCRKCGCKEIPSV  364
             E+  GDEIR+LP C HGFHV C+DTWLGSHSSCPSCRQILV+   +RCR+CG     + 
Sbjct  103  AEFAAGDEIRILPHCGHGFHVTCVDTWLGSHSSCPSCRQILVLPATSRCRRCGATSDDAT  162

Query  363  SPAGAGEQSQSA  328
            +P  A E    A
Sbjct  163  APTTAVEAGAKA  174



>ref|XP_009776172.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana sylvestris]
Length=201

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 80/114 (70%), Gaps = 10/114 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAE--KEIPADCAI  541
            ARC WLRR      G       +NKGLKKKVL+SLPK+ Y PS   A      + A+CAI
Sbjct  64   ARCTWLRR------GTPENMPPANKGLKKKVLKSLPKYKYDPSSTVAGNGASAVTAECAI  117

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV--ARCRKCG  385
            CL EY +GDEIRVLPQC H FH+QC+DTWL SH+SCPSCRQILV   +RCRKCG
Sbjct  118  CLVEYVQGDEIRVLPQCGHVFHLQCVDTWLASHASCPSCRQILVGTRSRCRKCG  171



>ref|XP_010686796.1| PREDICTED: RING-H2 finger protein ATL80 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 80/110 (73%), Gaps = 7/110 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR+   A G  S    +NKGLKKKVL+SLPK  Y     A    ++  DCAICL
Sbjct  51   ARCAWLRRL---AGGATSASSPANKGLKKKVLKSLPKVAYSADQHAG---KLSDDCAICL  104

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            +++  G+EIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL V RC KCG
Sbjct  105  SDFSAGEEIRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILAV-RCHKCG  153



>gb|KFK44194.1| hypothetical protein AALP_AA1G226700 [Arabis alpina]
Length=201

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 80/124 (65%), Gaps = 20/124 (16%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq---------------xssnkGLKKKVLRSLPKFTYGPSFA  580
            +RC WLRR+ +G                        ++NKGLKKKVL+SLPK T+ P   
Sbjct  51   SRCVWLRRLASGNRTTVYSSGSQTGSGQSPPSPPVAAANKGLKKKVLQSLPKVTFSPE--  108

Query  579  AAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVAR  400
                 E  A+CAICL E+  GDE+RVLPQC HGFHV CIDTWLGSHSSCPSCRQILVVAR
Sbjct  109  ---SSEKFAECAICLAEFVAGDELRVLPQCGHGFHVSCIDTWLGSHSSCPSCRQILVVAR  165

Query  399  CRKC  388
            C KC
Sbjct  166  CHKC  169



>ref|XP_007156261.1| hypothetical protein PHAVU_003G271400g [Phaseolus vulgaris]
 gb|ESW28255.1| hypothetical protein PHAVU_003G271400g [Phaseolus vulgaris]
Length=199

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR  A   GG S    +NKGLKK+V+ SLPKFTY    A   ++   ++C ICL
Sbjct  47   ARCAWLRRPPASVGGGGSPPAPANKGLKKRVVNSLPKFTY----AGEGDRCKWSECPICL  102

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVS  361
            TE+  GDE+RVLPQC HGFHV C+DTWL SHSSCPSCR   VVARC+KCG    P+V+
Sbjct  103  TEFAGGDEVRVLPQCGHGFHVACVDTWLSSHSSCPSCRAPFVVARCQKCG--HFPAVA  158



>ref|XP_003527275.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=184

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 81/112 (72%), Gaps = 9/112 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgq--xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCAI  541
            RC  LRR+R  ++         S+NKG+KKKVLRSLPK T      A+AE  +  ADCAI
Sbjct  46   RCGCLRRLRLSSSNATPQPPPASANKGVKKKVLRSLPKVT------ASAESAVKFADCAI  99

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CLTE+  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQILVV+RC KCG
Sbjct  100  CLTEFAAGDEIRVLPQCGHGFHVSCIDAWLRSHSSCPSCRQILVVSRCDKCG  151



>ref|XP_010094527.1| RING-H2 finger protein ATL80 [Morus notabilis]
 gb|EXB56281.1| RING-H2 finger protein ATL80 [Morus notabilis]
Length=186

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss------nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPA  553
            ARCAWLRR+  G +  AS   S       NKGLKKK+LRSLPK ++    A        +
Sbjct  49   ARCAWLRRLSGGGSSAASASSSRPPPPPPNKGLKKKILRSLPKLSFTADLAPKF-----S  103

Query  552  DCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            DCAICL E+  GDEIR LPQC H FHV CIDTWLGSHSSCPSCRQILVVARC+KCG
Sbjct  104  DCAICLAEFAIGDEIRELPQCGHAFHVACIDTWLGSHSSCPSCRQILVVARCQKCG  159



>ref|XP_007135973.1| hypothetical protein PHAVU_009G007400g [Phaseolus vulgaris]
 gb|ESW07967.1| hypothetical protein PHAVU_009G007400g [Phaseolus vulgaris]
Length=185

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 80/112 (71%), Gaps = 8/112 (7%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq-xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCAI  541
            ARC  LRR+R  +         ++NKG+KKKVLRSLPK T      A AE  +  ADCAI
Sbjct  46   ARCGCLRRLRFSSASTPQPPPAAANKGVKKKVLRSLPKLT------ANAESAVKFADCAI  99

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CL+E+  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQILV++RC KCG
Sbjct  100  CLSEFAAGDEIRVLPQCGHGFHVSCIDGWLRSHSSCPSCRQILVISRCDKCG  151



>ref|XP_003517122.1| PREDICTED: RING-H2 finger protein ATL8-like [Glycine max]
Length=223

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW R+      G +  Q  +NKGLKKKVL+SLPKF Y  S    ++    ++CAICL
Sbjct  54   ARCAWFRQ--GSGGGSSPRQALANKGLKKKVLQSLPKFAYVDS--NPSKWVATSECAICL  109

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             ++  GDEIRVLPQC HGFHV CIDTWLGSHSSCPSCRQIL V RC+KCG
Sbjct  110  ADFAAGDEIRVLPQCGHGFHVPCIDTWLGSHSSCPSCRQILAVTRCQKCG  159



>ref|XP_010908037.1| PREDICTED: RING-H2 finger protein ATL8-like [Elaeis guineensis]
Length=196

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR    ++G  S     NKGLKKKVLRSLPK +Y  + A A  +   ADC ICL
Sbjct  72   ARCAWLRR----SSGDPSPPPPPNKGLKKKVLRSLPKLSYDGAVAVAGGRL--ADCPICL  125

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVAR-----CRKCGCKEIP  370
             E+ EGDEIR+LP C HGFHV C+DTWLGSHSSCPSCRQ+LV A      C +CG     
Sbjct  126  AEFVEGDEIRILPPCGHGFHVGCVDTWLGSHSSCPSCRQVLVAAPAAPSWCSRCGASSAA  185

Query  369  SV  364
            +V
Sbjct  186  TV  187



>ref|XP_009128176.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL8-like 
[Brassica rapa]
Length=209

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 73/96 (76%), Gaps = 6/96 (6%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK L+SLPK  Y    A  AEK   A+CAICLTE+  GDE+RVLPQC HGFHV CIDT
Sbjct  97   LKKKALKSLPKLAYSLD-APPAEKL--AECAICLTEFAAGDELRVLPQCGHGFHVSCIDT  153

Query  456  WLGSHSSCPSCRQILVV-ARCRKCGCKEIPSVSPAG  352
            WLGSHSSCPSCRQILVV ARC+KCG   +P  S AG
Sbjct  154  WLGSHSSCPSCRQILVVIARCQKCG--GLPGSSSAG  187



>ref|XP_003547882.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=201

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 79/113 (70%), Gaps = 7/113 (6%)
 Frame = -3

Query  714  ARCAWLRR--IRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRR  +    +G      ++NKGLKKKV+ SLPKFTY    A   ++   ++CAI
Sbjct  47   ARCAWLRRGPVAGSGSGAGESPATANKGLKKKVVNSLPKFTY----AGGGDRCKWSECAI  102

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQ-ILVVARCRKCG  385
            CLTE+  GDEIRVLPQC HGFHV C+DTWL SHSSCPSCR    V ARC KCG
Sbjct  103  CLTEFGAGDEIRVLPQCGHGFHVACVDTWLASHSSCPSCRAPFAVTARCHKCG  155



>ref|XP_003533404.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=203

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq--xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAWLRR  AG++   +     ++NKGLKKKV+ SLPKFTY    A   ++   ++CAI
Sbjct  48   ARCAWLRRGTAGSSAAGAVSSPATANKGLKKKVVNSLPKFTY----ADDGDRRKWSECAI  103

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQ-ILVVARCRKCG  385
            CLTE+  GDE+RVLPQC HGFHV C+DTWL SHSSCPSCR    VVARC+KCG
Sbjct  104  CLTEFGAGDEVRVLPQCGHGFHVACVDTWLASHSSCPSCRAPFAVVARCQKCG  156



>ref|XP_009413072.1| PREDICTED: RING-H2 finger protein ATL80-like [Musa acuminata 
subsp. malaccensis]
Length=191

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 79/117 (68%), Gaps = 15/117 (13%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR         +     +KGLKKK LR+LPK +YG + AA       A+C ICL
Sbjct  51   ARCAWLRR-----ASPGARPAPPSKGLKKKALRALPKVSYGAATAAGGRL---AECPICL  102

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVA-------RCRKCG  385
             E+ EGDEIR+LPQC HGFHV C+DTWL SHSSCPSCR++LVVA       RC++CG
Sbjct  103  AEFAEGDEIRILPQCGHGFHVGCVDTWLVSHSSCPSCRRVLVVAADAAQPSRCQRCG  159



>ref|XP_004500836.1| PREDICTED: RING-H2 finger protein ATL80-like [Cicer arietinum]
Length=198

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 81/114 (71%), Gaps = 10/114 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgq---xssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-ADC  547
            ARC  LRR+R  +    S      ++NKG+KKKVLRSLPK T      A AE  +  +DC
Sbjct  49   ARCGCLRRLRISSTTLTSTTTPPAAANKGVKKKVLRSLPKHT------ATAESAVKFSDC  102

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            AICL+E+  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQILVV+RC KCG
Sbjct  103  AICLSEFTAGDEIRVLPQCGHGFHVSCIDAWLRSHSSCPSCRQILVVSRCDKCG  156



>ref|XP_007158027.1| hypothetical protein PHAVU_002G118000g [Phaseolus vulgaris]
 gb|ESW30021.1| hypothetical protein PHAVU_002G118000g [Phaseolus vulgaris]
Length=220

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR      G +  Q   NKGLKKKVL+SLPKF Y  S    ++    ++C ICL
Sbjct  53   ARCAWLRR--GPGGGNSPRQAVVNKGLKKKVLQSLPKFAYVDS--NPSKWVATSECVICL  108

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
             ++  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQ+L V RC+KCG    P+ + A
Sbjct  109  GDFAAGDEIRVLPQCGHGFHVSCIDEWLRSHSSCPSCRQVLAVTRCQKCG--RFPATA-A  165

Query  354  GAGEQSQSAINI  319
            GA     S + +
Sbjct  166  GASRSGASELEL  177



>ref|XP_003603861.1| RING-H2 finger protein ATL1B [Medicago truncatula]
 gb|AES74112.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=193

 Score =   118 bits (295),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 11/115 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss----nkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-AD  550
             RC  LRR+R  +    +   +     NKG+KKKVLRSLPK T      A  E  +  +D
Sbjct  50   TRCGCLRRLRLSSTTNNTSPAAPPAAANKGVKKKVLRSLPKLT------ATEESAVKFSD  103

Query  549  CAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CAICL+E+  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQILVV+RC KCG
Sbjct  104  CAICLSEFTAGDEIRVLPQCGHGFHVSCIDLWLRSHSSCPSCRQILVVSRCDKCG  158



>ref|XP_008812592.1| PREDICTED: RING-H2 finger protein ATL80-like [Phoenix dactylifera]
Length=188

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR    +           KGLKKK LRSLP  ++  S A+AA     A+C ICL
Sbjct  50   ARCAWLRR---SSASAQPPAARPTKGLKKKALRSLPTLSFDGSTASAAGCGQLAECPICL  106

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV---ARCRKCG  385
             E+  GDEIR+LP C HGFHV C+DTWL SHSSCPSCRQILVV   +RC  CG
Sbjct  107  AEFAAGDEIRILPHCGHGFHVACVDTWLVSHSSCPSCRQILVVPAPSRCPTCG  159



>ref|XP_008779008.1| PREDICTED: RING-H2 finger protein ATL8-like [Phoenix dactylifera]
Length=199

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss----nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADC  547
            ARCAWLRR     +        S    +KGLKKK LRSLPK +Y  + A    +   ADC
Sbjct  51   ARCAWLRRPSGDPSDLGGSGAPSRPPPDKGLKKKALRSLPKLSYDGAIAVPGGRL--ADC  108

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVAR-----CRKC  388
             ICL E+ EGDEIR+LP C HGFHV C+DTWLGSHSSCPSCR+ILVVA      CR+C
Sbjct  109  PICLAEFVEGDEIRILPPCGHGFHVACVDTWLGSHSSCPSCRRILVVAAGAPSWCRRC  166



>ref|XP_009420835.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 7/116 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG--LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAI  541
            ARCAW+RR    ++  ++          LKKKVLR+LP  ++  S AAA   E+  +CAI
Sbjct  50   ARCAWIRRSSTSSSSSSTAGPPPPPSKGLKKKVLRALPTLSFDSSAAAAGGVEL-VECAI  108

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV----ARCRKCG  385
            CLTE+ +GD++RVLPQC HGFH  C+DTWL SHSSCPSCR++LVV    +RC  CG
Sbjct  109  CLTEFADGDDVRVLPQCGHGFHACCVDTWLRSHSSCPSCRRVLVVPAPPSRCHSCG  164



>ref|XP_011014772.1| PREDICTED: RING-H2 finger protein ATL80-like [Populus euphratica]
Length=198

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 78/114 (68%), Gaps = 9/114 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAA-----AEKEIPAD  550
            ARCA +RR+     GG+      NKG+KKK L+ LP+F+Y     +        K    +
Sbjct  48   ARCACIRRV----TGGSPSSDKDNKGVKKKNLQRLPRFSYSAGDGSGEGGGATTKFGSTE  103

Query  549  CAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            CAICL E+ EGDE+RVLPQC H FHV CIDTWLGSHSSCPSCRQILVVARC+KC
Sbjct  104  CAICLGEFVEGDEVRVLPQCGHSFHVVCIDTWLGSHSSCPSCRQILVVARCQKC  157



>ref|XP_009395296.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=183

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLR   + A   +S    + KGLKKK LRSLP  ++  S A     ++ +DC ICL
Sbjct  52   ARCAWLRP--SPAAAASSVFRPTGKGLKKKALRSLPTLSFDSSAAPGGSGKL-SDCPICL  108

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV  406
             E+ +GD++RVLPQC HGFHV C+DTWLGSHSSCPSCR+ILVV
Sbjct  109  AEFADGDQVRVLPQCGHGFHVVCVDTWLGSHSSCPSCRRILVV  151



>ref|XP_010064613.1| PREDICTED: RING-H2 finger protein ATL80, partial [Eucalyptus 
grandis]
Length=201

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 82/120 (68%), Gaps = 15/120 (13%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqx--------ssnkGLKKKVLRSLPKFTYGPSFAAAAEKEI  559
            ARCAWLRR+ + ++GGA             +NKGLKKKVLRSLPK T  P    AA++  
Sbjct  51   ARCAWLRRLSSFSSGGAPPPSSPPPPPSSKANKGLKKKVLRSLPKLTVTPD---AADRY-  106

Query  558  PADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILV--VARCRKCG  385
             +DC ICL E+ +GDEIRVLP C H FHV CID WLGSHSSCPSCR+ILV   A C KCG
Sbjct  107  -SDCTICLLEFADGDEIRVLPHCGHAFHVSCIDPWLGSHSSCPSCRRILVAAAAACDKCG  165



>ref|XP_008804625.1| PREDICTED: RING-H2 finger protein ATL8 [Phoenix dactylifera]
Length=177

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 72/113 (64%), Gaps = 12/113 (11%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR  A +           KGLKKK LRSLP   +  S   A       +C ICL
Sbjct  50   ARCAWLRR--ASSTPPPPPPPPPTKGLKKKALRSLPTLAFDGSVKLA-------ECPICL  100

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV---ARCRKCG  385
             ++  GDEIR+LP C HGFHV C+DTWLGSHSSCPSCRQILV    +RCR+CG
Sbjct  101  ADFAAGDEIRILPHCGHGFHVTCVDTWLGSHSSCPSCRQILVFPAPSRCRRCG  153



>ref|XP_009410155.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL45-like 
[Musa acuminata subsp. malaccensis]
Length=183

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK LR+LP+  Y      AA  E PA+C ICL E+EEGDE+R LPQC HGFHV C+D 
Sbjct  73   LKKKALRALPRVAY------AAGSEGPAECPICLAEFEEGDELRELPQCGHGFHVGCVDA  126

Query  456  WLGSHSSCPSCRQILVVA----RCRKCGCKEIPSVSPAGAGEQSQSAIN  322
            WL SH SCPSCR+ LVVA    R R CG   +   + A  G+   S   
Sbjct  127  WLASHPSCPSCRRALVVAAPPSRXRXCGATSVDVATAAARGDGDASVFG  175



>gb|KHN20089.1| RING-H2 finger protein ATL80, partial [Glycine soja]
Length=133

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 73/105 (70%), Gaps = 9/105 (9%)
 Frame = -3

Query  714  ARCAWLRR--IRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCA  544
            ARC  LRR  + +          S+NKG+KKKVLRSLPK T      A+AE  +  ADCA
Sbjct  35   ARCGCLRRPPLPSSNATPQPPPASANKGVKKKVLRSLPKVT------ASAESAVKFADCA  88

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILV  409
            ICLTE+  GDEIRVLPQC HGFHV CID WL SHSSCPSCRQILV
Sbjct  89   ICLTEFAAGDEIRVLPQCGHGFHVSCIDAWLRSHSSCPSCRQILV  133



>ref|XP_010432277.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=212

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 79/126 (63%), Gaps = 16/126 (13%)
 Frame = -3

Query  714  ARCAWLRRIRagangga--sgqxssnkGLKKKVLRSLPKFTY--GPSFAAAAEKEIP---  556
            ARCAWLRR+    +           NKGLKKK L++LPK TY   PS + AA +++P   
Sbjct  48   ARCAWLRRLTGVNSAATGEYPPPPPNKGLKKKALQALPKSTYTASPSTSKAAAEDLPCSS  107

Query  555  ---------ADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVA  403
                      +CAIC+TE+ EG+EIR+LP C H FHV CID WL S SSCPSCR+ILV  
Sbjct  108  SGGDGDDSSTECAICITEFAEGEEIRILPLCNHAFHVACIDKWLTSRSSCPSCRRILVPV  167

Query  402  RCRKCG  385
            +C +CG
Sbjct  168  KCDRCG  173



>ref|XP_008786682.1| PREDICTED: RING-H2 finger protein ATL44 [Phoenix dactylifera]
Length=181

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 72/117 (62%), Gaps = 12/117 (10%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAWLRR     +            LKKK LRSLPK +Y  + A A  +   ADC ICL
Sbjct  51   ARCAWLRRSSGNPSSPPPPPNKG---LKKKALRSLPKLSYDGAVAVAGGRL--ADCPICL  105

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVAR-------CRKCG  385
             E+ EGDEIR+LP C H FHV C+DTWL SHSSCPSCR++LVVA        C +CG
Sbjct  106  AEFVEGDEIRILPPCGHRFHVGCVDTWLVSHSSCPSCRRVLVVAAAPTTPSWCSRCG  162



>ref|XP_002310694.2| hypothetical protein POPTR_0007s08550g [Populus trichocarpa]
 gb|EEE91144.2| hypothetical protein POPTR_0007s08550g [Populus trichocarpa]
Length=165

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 77/114 (68%), Gaps = 9/114 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAA-----AEKEIPAD  550
            ARCA  RR+     GG+     +NKG+KKK L+ LP+F+Y     +        K    +
Sbjct  21   ARCACTRRV----TGGSPSSDKANKGVKKKNLQLLPRFSYSAGDGSGEGGGATTKFGSTE  76

Query  549  CAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
            CAICL E+ EGDE+RVLPQC H FHV CIDTWL SHSSCPSCRQILVVARC+KC
Sbjct  77   CAICLGEFVEGDEVRVLPQCGHSFHVVCIDTWLRSHSSCPSCRQILVVARCQKC  130



>ref|XP_009372616.1| PREDICTED: RING-H2 finger protein ATL80 [Pyrus x bretschneideri]
Length=166

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 75/114 (66%), Gaps = 9/114 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss---nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARC WLRR+ A A             NKGLKKKVLRSLPK TY     +        +CA
Sbjct  55   ARCVWLRRLTAAATTTTPPLPPPPPPNKGLKKKVLRSLPKLTYTADCTSKF-----TECA  109

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQIL-VVARCRKCG  385
            ICLTE+  GDEIR LPQC HGFHV+CIDTWL SHSSCPSCRQ+  + ++C KCG
Sbjct  110  ICLTEFASGDEIRELPQCGHGFHVECIDTWLRSHSSCPSCRQVPEISSKCHKCG  163



>emb|CDX72540.1| BnaC07g45620D [Brassica napus]
Length=190

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 73/115 (63%), Gaps = 6/115 (5%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG-LKKKVLRSLPKFTYG----PSFAAAAEKEIPAD  550
            ARCAWLRR+    +             LKKK L+SLPK T+     PS  +A + +   +
Sbjct  48   ARCAWLRRLTGVNSAAVGESPPPPSKGLKKKALQSLPKSTFAAADSPS-TSAGDGDSSTE  106

Query  549  CAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CAICLTE+ +G+EIRVLP C H FHV CID WL S SSCPSCR++LV  +C +CG
Sbjct  107  CAICLTEFTDGEEIRVLPLCSHAFHVACIDKWLTSRSSCPSCRRVLVPMKCDRCG  161



>ref|XP_008373388.1| PREDICTED: RING-H2 finger protein ATL8 [Malus domestica]
Length=190

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 74/114 (65%), Gaps = 9/114 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss---nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARC WLRR+ A A             NKGLKKKVLRSLPK TY     +        +CA
Sbjct  79   ARCVWLRRLTAAATTTTPPLPPPPPPNKGLKKKVLRSLPKLTYTADCTSKF-----TECA  133

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVA-RCRKCG  385
            ICLTE+  GDEIR LPQC HGFHV CIDTWL SHSSCPSCRQ+  ++ +C KCG
Sbjct  134  ICLTEFASGDEIRELPQCGHGFHVACIDTWLRSHSSCPSCRQVPEISNKCHKCG  187



>ref|XP_006409305.1| hypothetical protein EUTSA_v10023141mg [Eutrema salsugineum]
 gb|ESQ50758.1| hypothetical protein EUTSA_v10023141mg [Eutrema salsugineum]
Length=185

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTY----GPSFAAAAEKEIPADCA  544
            RCAWLRR             S NKGLKKKVL+SLP+ T+      S AAA +    ++CA
Sbjct  51   RCAWLRRF-----TTGGDSPSPNKGLKKKVLQSLPRSTFTAAESTSGAAADDGGDSSECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLT++ +G+EIRVLP C H FHV+CID WL S SSCPSCR+IL   RC +CG
Sbjct  106  ICLTDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCRRILTPVRCDRCG  158



>ref|NP_179337.1| RING-H2 finger protein ATL44 [Arabidopsis thaliana]
 sp|O22755.1|ATL44_ARATH RecName: Full=RING-H2 finger protein ATL44; AltName: Full=RING-H2 
zinc finger protein RHA3a [Arabidopsis thaliana]
 gb|AAK44054.1|AF370239_1 putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAC68673.1| RING-H2 finger protein RHA3a [Arabidopsis thaliana]
 gb|AAD32903.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAL33807.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEC06631.1| RING-H2 finger protein ATL44 [Arabidopsis thaliana]
Length=185

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 74/112 (66%), Gaps = 8/112 (7%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYG---PSFAAAAEKEIPADCAI  541
            RCAWLRR             S NKGLKKK L+SLP+ T+     +  AAAE+    +CAI
Sbjct  50   RCAWLRRF-----TAGGDSPSPNKGLKKKALQSLPRSTFTAAESTSGAAAEEGDSTECAI  104

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CLT++ +G+EIRVLP C H FHV+CID WL S SSCPSCR+IL   RC +CG
Sbjct  105  CLTDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCRRILTPVRCDRCG  156



>ref|XP_003572834.1| PREDICTED: RING-H2 finger protein ATL80-like [Brachypodium distachyon]
Length=193

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 74/119 (62%), Gaps = 21/119 (18%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSF----AAAAEKEIPAD-CAICLTEYEEGDEIRVLPQCRHGFHV  472
            +KK+VLRSLP  TY        A ++E E  AD CAICL E+E+G E+RVLPQC HGFH 
Sbjct  69   VKKEVLRSLPTVTYVSDGRGGKADSSESEAEADECAICLAEFEDGQEMRVLPQCGHGFHA  128

Query  471  QCIDTWLGSHSSCPSCRQILVVA-------RCRKCGCK---------EIPSVSPAGAGE  343
             C+DTWL SHSSCPSCR++LV A       RCR+CG +           P  +P G GE
Sbjct  129  ACVDTWLRSHSSCPSCRRVLVAADQMPRGERCRRCGARPGPGVGIGIGAPLKAPCGGGE  187



>emb|CDY41651.1| BnaC03g62330D [Brassica napus]
Length=193

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPS---FAAAAEKEIPADCA  544
            ARCAW+RR+    +         NKGLKKK L+SLPK T+  +    +++ + E   +CA
Sbjct  48   ARCAWIRRLAGVNSSAVGESPPPNKGLKKKALQSLPKSTFTAADSPSSSSGKGESSTECA  107

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICL E+ +G+EIR+LP CRH FHV CID WL S SSCPSCR+ILV  +C +CG
Sbjct  108  ICLMEFSDGEEIRILPLCRHAFHVACIDKWLTSRSSCPSCRRILVPVKCDRCG  160



>ref|XP_006298646.1| hypothetical protein CARUB_v10014735mg [Capsella rubella]
 gb|EOA31544.1| hypothetical protein CARUB_v10014735mg [Capsella rubella]
Length=187

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPAD---CAI  541
            RCAWLRR      GG S   S NKGLKKK L+SLP+ T+  + +A+   E   D   CAI
Sbjct  50   RCAWLRRF---TGGGDSSSPSPNKGLKKKALQSLPRSTFTAAESASGGAEDGGDTTECAI  106

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CLTE+ EG+EIRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG
Sbjct  107  CLTEFAEGEEIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPVRCDRCG  158



>ref|XP_009401006.1| PREDICTED: RING-H2 finger protein ATL45 [Musa acuminata subsp. 
malaccensis]
Length=171

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LK+  LR LPK +YG     AA  E PA C ICL E+EEG+++RVLPQC HGFH  C+D 
Sbjct  65   LKRTALRQLPKVSYG----GAAGGEEPAVCPICLAEFEEGEQLRVLPQCGHGFHAGCVDA  120

Query  456  WLGSHSSCPSCRQILVVA  403
            WLGSHSSCPSCR++LVVA
Sbjct  121  WLGSHSSCPSCRRVLVVA  138



>ref|XP_010911522.1| PREDICTED: RING-H2 finger protein ATL44-like [Elaeis guineensis]
Length=183

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 76/114 (67%), Gaps = 10/114 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP--ADCAI  541
            ARCAWLRR     +  ++      KGLKKK LRSLP  ++  S A+AA       A+C I
Sbjct  50   ARCAWLRR-----SSPSAQPLPPTKGLKKKALRSLPTLSFDGSTASAAAAAGGKLAECPI  104

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV---ARCRKC  388
            CL E+  GDEIR+LP C HGFHV C+DTWL SHSSCPSCRQILVV   +RC +C
Sbjct  105  CLAEFAAGDEIRILPHCGHGFHVACVDTWLASHSSCPSCRQILVVPTPSRCPRC  158



>ref|XP_010446920.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=199

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 75/122 (61%), Gaps = 17/122 (14%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG-LKKKVLRSLPKFTYGPSFAAAAEKEIP------  556
            ARCAWLRR+   ++             LKKK L++LPK TY      A+ +++P      
Sbjct  49   ARCAWLRRLTGVSSAATGESPPPPNKGLKKKALQALPKSTY-----TASTEDLPCSSGGD  103

Query  555  -----ADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRK  391
                  +CAIC+TE+ EG+EIR+LP C+H FHV CID WL S SSCPSCR+ILV  +C +
Sbjct  104  GDDSSTECAICITEFAEGEEIRILPLCKHAFHVACIDKWLTSRSSCPSCRRILVPVKCDR  163

Query  390  CG  385
            CG
Sbjct  164  CG  165



>ref|XP_002886113.1| ring-H2 finger A3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62372.1| ring-H2 finger A3A [Arabidopsis lyrata subsp. lyrata]
Length=185

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 73/112 (65%), Gaps = 8/112 (7%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYG---PSFAAAAEKEIPADCAI  541
            RCAWLRR             S NKGLKKK L+SLP+ T+     +  AAA+     +CAI
Sbjct  50   RCAWLRRF-----TAGGDSPSPNKGLKKKALQSLPRSTFTTAESTSGAAADDGDSTECAI  104

Query  540  CLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CLT++ +G+EIRVLP C H FHV+CID WL S SSCPSCR+IL   RC +CG
Sbjct  105  CLTDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCRRILTPVRCDRCG  156



>ref|XP_009109289.1| PREDICTED: RING-H2 finger protein ATL45-like [Brassica rapa]
 emb|CDY24813.1| BnaA08g14970D [Brassica napus]
Length=193

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 3/113 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPS---FAAAAEKEIPADCA  544
            ARCAW+RR+    +         NKGLKKK L+SLPK T+  +    +++ E E  ++CA
Sbjct  48   ARCAWIRRLAGVNSSAVGESPPPNKGLKKKALQSLPKSTFTAADSPSSSSGEGESTSECA  107

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICL E+ +G+EIR+LP CRH FHV CID WL S SSCPSCR+ILV  +C +CG
Sbjct  108  ICLMEFSDGEEIRILPLCRHAFHVACIDKWLTSRSSCPSCRRILVPVKCDRCG  160



>ref|XP_010515011.1| PREDICTED: RING-H2 finger protein ATL44 [Camelina sativa]
Length=194

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPK--FTYGPSFAAAAEKEIPADCAIC  538
            RCAWLRR      GG     S NKGLKKK L+SLP+  FT   S +   +     +CAIC
Sbjct  50   RCAWLRRF---TGGGGDSSPSPNKGLKKKALQSLPRSTFTAAESTSGGGDDGDTTECAIC  106

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            LTE+ +G+EIRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG       S 
Sbjct  107  LTEFADGEEIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPLRCDRCG-----HAST  161

Query  357  AGAGEQSQ  334
            AG  +Q+ 
Sbjct  162  AGVKDQAH  169



>ref|XP_010467517.1| PREDICTED: RING-H2 finger protein ATL44-like [Camelina sativa]
Length=190

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPK--FTYGPSFAAAAEKEIPADCAIC  538
            RCAWLRR      GG +   S NKGLKKK L+SLP+  FT   S +   +     +CAIC
Sbjct  50   RCAWLRRF---TGGGGNSSPSPNKGLKKKALQSLPRSTFTAAESNSGGGDDGDTTECAIC  106

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            LTE+ +G+EIRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG       S 
Sbjct  107  LTEFADGEEIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPLRCDRCG-----HAST  161

Query  357  AGAGEQSQ  334
            AG  +Q+ 
Sbjct  162  AGVKDQAH  169



>ref|XP_008237931.1| PREDICTED: RING-H2 finger protein ATL80-like [Prunus mume]
Length=168

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 73/114 (64%), Gaps = 9/114 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss---nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARC WLRR+   A         +   NKGLKKK+LRSLPK TY     +        +CA
Sbjct  54   ARCVWLRRLTTAATPPPPPPLPTPPPNKGLKKKILRSLPKLTYTADCTSKF-----TECA  108

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVA-RCRKCG  385
            ICLTE+  GDEIR LPQC H FHV CID WL SHSSCPSCRQI VV+ +C KCG
Sbjct  109  ICLTEFAAGDEIRELPQCGHRFHVACIDVWLRSHSSCPSCRQIPVVSNKCHKCG  162



>ref|NP_001130972.1| uncharacterized LOC100192077 [Zea mays]
 gb|ACF79382.1| unknown [Zea mays]
 tpg|DAA43120.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=188

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 15/115 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAA---EKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQC  466
            L+KK LR+LP   Y  + AA A     E+ A+CAICL+E+   +E+RVLPQC H FHV C
Sbjct  71   LRKKALRALPSLAYEDAVAARAGDGAAEVLAECAICLSEFAPREEVRVLPQCGHAFHVAC  130

Query  465  IDTWLGSHSSCPSCRQILVVA-----------RCRKC-GCKEIPSVSPAGAGEQS  337
            IDTWL +HSSCPSCR++LVV            RCRKC    + PS S   AG+ +
Sbjct  131  IDTWLAAHSSCPSCRRVLVVGDAASKRPPQPKRCRKCEAAMDEPSSSSGSAGDTA  185



>ref|XP_009382752.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKKVLR+L   ++  S A A   ++  DCAICL E+ +GDE+RVLPQC HGFH +C+DT
Sbjct  73   LKKKVLRALSTLSFDSSAAVAGCVQL-VDCAICLAEFADGDEVRVLPQCGHGFHAECVDT  131

Query  456  WLGSHSSCPSCRQILVV-ARCRKCGCKEIPSV  364
            WL SHSSCPSCR++LVV A   +CG     +V
Sbjct  132  WLLSHSSCPSCRRVLVVPAPPSRCGANSSDTV  163



>ref|XP_006412098.1| hypothetical protein EUTSA_v10027339mg [Eutrema salsugineum]
 gb|ESQ53551.1| hypothetical protein EUTSA_v10027339mg [Eutrema salsugineum]
Length=197

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 72/117 (62%), Gaps = 7/117 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEK-------EIP  556
            ARCAW+RR+    +         NKGLKKK L+SLPK T+    +A           +  
Sbjct  48   ARCAWIRRLAGVNSSAVGESPPPNKGLKKKALQSLPKSTFTAVTSAVDSPCSSSGDGDSS  107

Query  555  ADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             +CAICLTE+ +G+EIR+LP C H FHV CID WL S SSCPSCR+IL   +C +CG
Sbjct  108  TECAICLTEFADGEEIRILPLCSHAFHVACIDKWLTSRSSCPSCRRILAPVKCDRCG  164



>ref|XP_009383554.1| PREDICTED: RING-H2 finger protein ATL45-like [Musa acuminata 
subsp. malaccensis]
Length=174

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 79/137 (58%), Gaps = 23/137 (17%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPA------  553
            ARCAW RR         S     NKGLK+K +++LP  ++  S +  A     A      
Sbjct  47   ARCAWHRR---------SATAPPNKGLKRKAVQALPTLSFDSSSSNTAASPDAATGGVKL  97

Query  552  -DCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV----ARCRKC  388
             DCAICL E+ +GD +RVLPQC HGFH  CIDTWL SHSSCPSCR+ILVV    +RC+ C
Sbjct  98   VDCAICLAEFADGDVVRVLPQCGHGFHTGCIDTWLRSHSSCPSCRRILVVTTSPSRCQSC  157

Query  387  GCKEIPSVSPAGAGEQS  337
            G       +P G  E +
Sbjct  158  GATH---KAPYGGAEST  171



>ref|XP_004953481.1| PREDICTED: RING-H2 finger protein ATL8-like [Setaria italica]
Length=183

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KK+VLRSLP  TY P  + AA  E   +CAICL E+E+G  +RVLPQC H FH  C+DT
Sbjct  70   VKKEVLRSLPTVTYVPDGSKAAAGEGADECAICLAEFEDGQAMRVLPQCGHAFHAACVDT  129

Query  456  WLGSHSSCPSCRQILVV-----ARCRKCG  385
            WL  HSSCPSCR++L        RCR+CG
Sbjct  130  WLRGHSSCPSCRRVLAAELPAGERCRRCG  158



>ref|XP_007209706.1| hypothetical protein PRUPE_ppa012461mg [Prunus persica]
 gb|EMJ10905.1| hypothetical protein PRUPE_ppa012461mg [Prunus persica]
Length=168

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 76/122 (62%), Gaps = 11/122 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss---nkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCA  544
            ARC WLRR+   A         +   NKGLKKK+LRSLPK TY     +        +CA
Sbjct  54   ARCVWLRRLATAATPPPPPPLPTPPPNKGLKKKILRSLPKLTYTADCTSKF-----TECA  108

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQI-LVVARCRKCGCKEIPS  367
            ICLTE+  GDEIR LPQC H FHV CID WL SHSSCPSCRQI  V ++C KCG    PS
Sbjct  109  ICLTEFAAGDEIRELPQCGHRFHVACIDVWLRSHSSCPSCRQIPEVSSKCHKCG--GFPS  166

Query  366  VS  361
            +S
Sbjct  167  LS  168



>ref|XP_002867072.1| ring-H2 finger A3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43331.1| ring-H2 finger A3B [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 75/121 (62%), Gaps = 11/121 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSF-----------AAAAE  568
            ARCAWLRR+    +         NKGLKKK L++LPK TY  S            ++  +
Sbjct  47   ARCAWLRRLTGVNSAAVGESPPPNKGLKKKALQALPKSTYTASASTATAADDLPCSSGGD  106

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             +   +CAIC+TE+ +GDEIR+LP C H FHV CID WL S SSCPSCR+ILV  +C +C
Sbjct  107  GDSSTECAICITEFSDGDEIRILPLCSHAFHVACIDKWLTSRSSCPSCRRILVPVKCDRC  166

Query  387  G  385
            G
Sbjct  167  G  167



>ref|XP_006285317.1| hypothetical protein CARUB_v10006700mg [Capsella rubella]
 gb|EOA18215.1| hypothetical protein CARUB_v10006700mg [Capsella rubella]
Length=199

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIP-------  556
            ARCAWLRR+    +         NKGLKKKV+ +LPK TY  S +A+A            
Sbjct  47   ARCAWLRRLTGVNSAAIRESPPPNKGLKKKVIEALPKSTYTASPSASASASTAAAAEDSS  106

Query  555  ADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
             +CAIC+ E+ EG+EIR+LP C H FHV CID WL S SSCPSCR++LV  +C +CG
Sbjct  107  TECAICIAEFAEGEEIRILPVCSHAFHVACIDKWLTSRSSCPSCRRVLVPVKCDRCG  163



>ref|XP_010489373.1| PREDICTED: RING-H2 finger protein ATL44-like [Camelina sativa]
Length=193

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 77/128 (60%), Gaps = 11/128 (9%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPK--FTYGPSFAAAAEKEIPADCAIC  538
            RCAWLRR      GG     S NKGLKKK L+SLP+  FT   S +   +     +CAIC
Sbjct  50   RCAWLRRF----TGGGDSSPSPNKGLKKKALQSLPRSTFTVAESTSGGGDDGDTTECAIC  105

Query  537  LTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            LTE+ +G+ IRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG       S 
Sbjct  106  LTEFADGEVIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPLRCDRCG-----HAST  160

Query  357  AGAGEQSQ  334
            AG  +Q+ 
Sbjct  161  AGVKDQAH  168



>ref|XP_010437466.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=202

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 72/120 (60%), Gaps = 10/120 (8%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxss--nkGLKKKVLRSLPKFTYGPS--------FAAAAEK  565
            ARCAWLRR+    +           NKGLKKK L++LPK TY  S               
Sbjct  49   ARCAWLRRLTGVNSAATGESPPPPPNKGLKKKALQALPKSTYTASTEDSPCSSSGGGDGD  108

Query  564  EIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            +   +CAIC+TE+ EG+EIR+LP C H FHV CID WL S SSCPSCR+ILV  +C +CG
Sbjct  109  DSSTECAICITEFAEGEEIRILPLCNHAFHVACIDKWLTSRSSCPSCRRILVPVKCDRCG  168



>ref|NP_195273.1| putative RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 sp|Q9ZT49.1|ATL45_ARATH RecName: Full=RING-H2 finger protein ATL45; AltName: Full=RING-H2 
zinc finger protein RHA3b [Arabidopsis thaliana]
 gb|AAC68674.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 emb|CAB54876.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 emb|CAB80264.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 gb|AAM64643.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 gb|AAY57612.1| RING finger family protein [Arabidopsis thaliana]
 gb|ABR46213.1| At4g35480 [Arabidopsis thaliana]
 gb|AEE86520.1| putative RING-H2 finger protein RHA3b [Arabidopsis thaliana]
Length=200

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSF-----------AAAAE  568
            ARCAWLRR+              NKGLKKK L++LPK TY  S            ++  +
Sbjct  47   ARCAWLRRLTGVNPAAVGEAPPPNKGLKKKALQALPKSTYTASASTAAAADDLPCSSVGD  106

Query  567  KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKC  388
             +   +CAIC+TE+ EG+EIR+LP C H FHV CID WL S SSCPSCR+ILV  +C +C
Sbjct  107  GDSSTECAICITEFSEGEEIRILPLCSHAFHVACIDKWLTSRSSCPSCRRILVPVKCDRC  166

Query  387  G  385
            G
Sbjct  167  G  167



>ref|XP_009150790.1| PREDICTED: RING-H2 finger protein ATL44-like [Brassica rapa]
 emb|CDY66407.1| BnaA06g39270D [Brassica napus]
Length=187

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 73/113 (65%), Gaps = 9/113 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTY----GPSFAAAAEKEIPADCA  544
            RCAWLRR             S+NKGLKKK L+SLP+ T+      S  AA +     +CA
Sbjct  50   RCAWLRRF-----TTGENSPSANKGLKKKALQSLPRSTFTAAESTSGTAAEDGGDSTECA  104

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICL+++ +G+EIRVLP C H FHV+CID WL S SSCPSCR+IL   RC +CG
Sbjct  105  ICLSDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCRRILRPVRCDRCG  157



>ref|XP_009138362.1| PREDICTED: RING-H2 finger protein ATL45-like [Brassica rapa]
 emb|CDY40631.1| BnaA03g53320D [Brassica napus]
Length=190

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 4/114 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkG-LKKKVLRSLPKFTYGPSFAAAAEKEIP---ADC  547
            ARCAWLRR+    +             LKKK L+SLPK T+  + + ++         +C
Sbjct  48   ARCAWLRRLTGVNSAAVGESPPPPSKGLKKKALQSLPKSTFAAADSPSSSAGDGDSSTEC  107

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            AICLTE+ +G+EIR+LP C H FHV CID WL S SSCPSCR++LV  +C +CG
Sbjct  108  AICLTEFSDGEEIRILPLCSHAFHVACIDKWLTSRSSCPSCRRVLVPMKCDRCG  161



>gb|KCW68133.1| hypothetical protein EUGRSUZ_F01804 [Eucalyptus grandis]
Length=126

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 59/82 (72%), Gaps = 7/82 (9%)
 Frame = -3

Query  624  VLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGS  445
            VLRSLPK T  P    AA++   +DC ICL E+ +GDEIRVLP C H FHV CID WLGS
Sbjct  14   VLRSLPKLTVTPD---AADRY--SDCTICLLEFADGDEIRVLPHCGHAFHVSCIDPWLGS  68

Query  444  HSSCPSCRQILV--VARCRKCG  385
            HSSCPSCR+ILV   A C KCG
Sbjct  69   HSSCPSCRRILVAAAAACDKCG  90



>ref|XP_002465936.1| hypothetical protein SORBIDRAFT_01g048530 [Sorghum bicolor]
 gb|EER92934.1| hypothetical protein SORBIDRAFT_01g048530 [Sorghum bicolor]
Length=188

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 14/94 (15%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK LR+LP   Y     A AE ++  +CAICL+E+   +E+RVLPQC H FHV CIDT
Sbjct  76   LKKKALRALPSLAYED---AVAEAKVLTECAICLSEFAPREEVRVLPQCGHAFHVACIDT  132

Query  456  WLGSHSSCPSCRQILVVA-----------RCRKC  388
            WL +HSSCPSCR++LVV            RCRKC
Sbjct  133  WLAAHSSCPSCRRVLVVGDAADKRPPQPKRCRKC  166



>ref|XP_010530985.1| PREDICTED: RING-H2 finger protein ATL44-like [Tarenaya hassleriana]
Length=182

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 73/110 (66%), Gaps = 10/110 (9%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARC W+RR       G S      KGLKKK L S+P+FT+     ++AE +   DCAICL
Sbjct  48   ARCVWIRRF-----TGNSPPPPPKKGLKKKALESIPRFTF-----SSAEPQPATDCAICL  97

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            T++ +G+EIRVLP C H FHV CID WL S SSCPSCR+ILV  RC +CG
Sbjct  98   TDFADGEEIRVLPLCGHAFHVSCIDRWLASRSSCPSCRRILVPLRCDRCG  147



>emb|CDY69366.1| BnaAnng30200D [Brassica napus]
Length=187

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 9/113 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTY----GPSFAAAAEKEIPADCA  544
            RCAWLR+             S+NKGLKKK L+SLP+ T+      S  AA +     +CA
Sbjct  50   RCAWLRQF-----TTGENSPSANKGLKKKALQSLPRSTFTAAESTSGTAAEDGGDSTECA  104

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICL+++ +G+EIRVLP C H FHV+CID WL S SSCPSCR+IL   RC +CG
Sbjct  105  ICLSDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCRRILRPVRCDRCG  157



>ref|XP_002520866.1| RING-H2 finger protein ATL3C, putative [Ricinus communis]
 gb|EEF41575.1| RING-H2 finger protein ATL3C, putative [Ricinus communis]
Length=208

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG    AA  + I  DCAICL E+ +G+++RVLP+C HGFHV+CIDT
Sbjct  91   LKKSALRQIPVVIYG----AAGIQIIATDCAICLGEFSDGEKVRVLPKCNHGFHVRCIDT  146

Query  456  WLGSHSSCPSCRQILV  409
            WLGSHSSCP+CRQ L+
Sbjct  147  WLGSHSSCPTCRQSLL  162



>emb|CDX69143.1| BnaC01g03100D [Brassica napus]
Length=194

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 4/114 (4%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAA----AEKEIPADC  547
            ARCA LRR+    +         NKGLKKK L+SLPK T+  +  +      +     +C
Sbjct  48   ARCACLRRLVGVNSSAVGESPPPNKGLKKKALQSLPKSTFTAAADSPSSSAGDGHSSTEC  107

Query  546  AICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            AICLTE+ +G+EIR+LP C H FH+ CID WL S SSCPSCR+IL   +C +CG
Sbjct  108  AICLTEFTDGEEIRILPLCNHAFHLACIDKWLTSRSSCPSCRRILAPVKCDRCG  161



>gb|KFK40135.1| hypothetical protein AALP_AA3G335200 [Arabis alpina]
Length=194

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 7/113 (6%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPK--FTYGPSFAAAAEKE--IPADCA  544
            RCA LRR      GG     S NKGLKKK L+SLP+  FT G S + AA ++    ++CA
Sbjct  51   RCACLRRF---TTGGGESSPSPNKGLKKKALQSLPRSTFTAGESTSGAAAEDGGDSSECA  107

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLT++ +G+EIRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG
Sbjct  108  ICLTDFADGEEIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPVRCDRCG  160



>ref|XP_009400319.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=144

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 67/104 (64%), Gaps = 15/104 (14%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCA LRR         S    SNKGL+K+ LR+LP  +Y        E      C ICL
Sbjct  51   ARCACLRR---------SPVLPSNKGLEKEALRALPTISYSAGGGGLVE------CPICL  95

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVA  403
             E+EEGDE+RVLPQC HGFHV C+D WL SHSSCPSCR++LVVA
Sbjct  96   AEFEEGDELRVLPQCGHGFHVGCVDAWLHSHSSCPSCRRVLVVA  139



>emb|CDX75506.1| BnaA01g01960D [Brassica napus]
Length=193

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFA---AAAEKEIPADCA  544
            ARCA LRR+    +         NKGLKKK L+SLPK T+  + +   +A + +   +CA
Sbjct  48   ARCACLRRLVGVNSSAVGESPPPNKGLKKKALQSLPKSTFTAADSPSSSAGDGDSSTECA  107

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLTE+ +G+EIR+LP C H FH+ CID WL S SSCPSCR+IL   +C +CG
Sbjct  108  ICLTEFTDGEEIRILPLCNHAFHLACIDKWLTSRSSCPSCRRILAPVKCDRCG  160



>emb|CDY49431.1| BnaC07g06500D [Brassica napus]
Length=188

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 70/113 (62%), Gaps = 9/113 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTY----GPSFAAAAEKEIPADCA  544
            RCA LRR             S NKGLKKK L+SLP+ T+      S  AA +     +CA
Sbjct  51   RCACLRRF-----TAGGNSPSQNKGLKKKALQSLPRSTFTAAESTSGGAAEDGGDSTECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLTE+ +G+EIRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG
Sbjct  106  ICLTEFADGEEIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPVRCGRCG  158



>ref|XP_009384604.1| PREDICTED: RING-H2 finger protein ATL44-like [Musa acuminata 
subsp. malaccensis]
Length=192

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 18/122 (15%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICL  535
            ARCAW+RR         +     +KGLKKK LR+LPK +Y  + A        ADC ICL
Sbjct  51   ARCAWIRR------SAGAPPAPKSKGLKKKALRALPKVSYDAAAAGGGGL---ADCPICL  101

Query  534  TEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVV---------ARCRKCGC  382
             ++ EGDEIR+LPQC HGFHV C+DTWL S SSCP CR+ LV          +RC+ CG 
Sbjct  102  ADFVEGDEIRILPQCGHGFHVGCVDTWLVSRSSCPFCRRELVFAAAAAASQPSRCQTCGA  161

Query  381  KE  376
            + 
Sbjct  162  RS  163



>ref|XP_004985867.1| PREDICTED: RING-H2 finger protein ATL8-like [Setaria italica]
Length=224

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 70/105 (67%), Gaps = 22/105 (21%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAA------------EKEIPADCAICLTEYEEGDEIRVLPQ  493
            L+KK LR+LP+  Y  + AAAA            E+EI A+CAICL+E+   +EIRVLPQ
Sbjct  80   LRKKALRALPRLAYEDAVAAAAAARGGSAAVAGKEEEILAECAICLSEFAPREEIRVLPQ  139

Query  492  CRHGFHVQCIDTWLGSHSSCPSCRQILVV----------ARCRKC  388
            C HGFHV C+DTWLG+HSSCPSCR++LVV           RCRKC
Sbjct  140  CGHGFHVACVDTWLGAHSSCPSCRRVLVVDDPPKRPPDPKRCRKC  184



>ref|XP_010103646.1| RING-H2 finger protein ATL73 [Morus notabilis]
 gb|EXB96529.1| RING-H2 finger protein ATL73 [Morus notabilis]
Length=220

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG   +A+  K +  DC ICL E+EEGD++RVLP+C HGFHV+CID 
Sbjct  104  LKKSALRKIPVTAYG---SASGIKTLDTDCTICLGEFEEGDKVRVLPKCSHGFHVRCIDP  160

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ LV
Sbjct  161  WLVSHSSCPTCRQSLV  176



>ref|XP_009101519.1| PREDICTED: RING-H2 finger protein ATL45 [Brassica rapa]
Length=237

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = -3

Query  714  ARCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPS---FAAAAEKEIPADCA  544
            ARCA LRR+    +         NKGLKKK L+SLPK T+  +    ++A + +   +CA
Sbjct  92   ARCACLRRLVGVNSSAVGESPPPNKGLKKKALQSLPKSTFTAADSPSSSAGDGDSSTECA  151

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLTE+ +G+EIR+LP C H FH+ CID WL S SSCPSCR+IL   +C +CG
Sbjct  152  ICLTEFTDGEEIRILPLCNHAFHLACIDKWLTSRSSCPSCRRILAPVKCDRCG  204



>emb|CDY24337.1| BnaA07g02620D [Brassica napus]
Length=188

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 70/113 (62%), Gaps = 9/113 (8%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTY----GPSFAAAAEKEIPADCA  544
            RC+ LRR             S NKGLKKK L+SLP+ T+      S  AA +     +CA
Sbjct  51   RCSCLRRF-----TAGGNSPSQNKGLKKKALQSLPRSTFTAAESTSGGAAEDGGDSTECA  105

Query  543  ICLTEYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRKCG  385
            ICLTE+ +G+EIRVLP C H FHV CID WL S SSCPSCR+IL   RC +CG
Sbjct  106  ICLTEFADGEEIRVLPLCGHSFHVACIDKWLVSRSSCPSCRRILTPVRCGRCG  158



>ref|XP_002452741.1| hypothetical protein SORBIDRAFT_04g031560 [Sorghum bicolor]
 gb|EES05717.1| hypothetical protein SORBIDRAFT_04g031560 [Sorghum bicolor]
Length=194

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 63/95 (66%), Gaps = 9/95 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA---DCAICLTEYEEGDEIRVLPQCRHGFHVQC  466
            +KK+VLRSLP  TY      A ++E      +CAICL E+EEG  +RVLPQC H FH  C
Sbjct  73   VKKEVLRSLPTVTYVSDSCKAGDEEEGGGADECAICLAEFEEGQAMRVLPQCGHAFHAAC  132

Query  465  IDTWLGSHSSCPSCRQILVV------ARCRKCGCK  379
            +DTWL +HSSCPSCR++L V       RCR+CG +
Sbjct  133  VDTWLRAHSSCPSCRRVLAVDLLPPGERCRRCGAR  167



>gb|ABK25761.1| unknown [Picea sitchensis]
Length=222

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 7/84 (8%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            +K+K LR+LP   YG     AA  ++P  DC ICL E+ EGDE+R+LP+C HGFH++CID
Sbjct  109  MKRKALRALPTAVYG-----AAGSKLPCTDCPICLAEFLEGDEVRILPKCNHGFHMRCID  163

Query  459  TWLGSHSSCPSCRQ-ILVVARCRK  391
            TWL SHSSCP+CRQ +L ++R  K
Sbjct  164  TWLASHSSCPTCRQNLLELSRSNK  187



>gb|ABK22591.1| unknown [Picea sitchensis]
Length=204

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 65/90 (72%), Gaps = 7/90 (8%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            +K+K LR+LP   YG     AAE ++P+ DC ICL E+  G+E+R+LP+C HGFH++CID
Sbjct  100  MKRKALRALPTAVYG-----AAESKLPSTDCPICLAEFVVGEEVRILPKCNHGFHMRCID  154

Query  459  TWLGSHSSCPSCRQ-ILVVARCRKCGCKEI  373
            TWL +HSSCP+CRQ +L ++R  K    ++
Sbjct  155  TWLAAHSSCPTCRQNLLELSRSNKKNNNDV  184



>ref|XP_006649211.1| PREDICTED: RING-H2 finger protein ATL80-like [Oryza brachyantha]
Length=218

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 62/88 (70%), Gaps = 9/88 (10%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK + ++P  ++     AA +++  A+CAICL E+  G+E+RVLP C HGFHV CIDT
Sbjct  114  LKKKAIDAIPTVSF-----AAGKQQQTAECAICLAEFGAGEELRVLPHCGHGFHVACIDT  168

Query  456  WLGSHSSCPSCR----QILVVARCRKCG  385
            WLG+H++CPSCR     + V  RCR+CG
Sbjct  169  WLGTHATCPSCRATVATLFVPGRCRRCG  196



>ref|NP_001147382.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|ACF84092.1| unknown [Zea mays]
 gb|ACG27216.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|AFW63433.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=186

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 59/93 (63%), Gaps = 7/93 (8%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KK+VLRSLP  TY P    A       +CAICL E+EEG  +RVLPQC H FH  C+DT
Sbjct  72   VKKEVLRSLPTVTYVPDSGKAKAAAGADECAICLAEFEEGQAMRVLPQCGHAFHAACVDT  131

Query  456  WLGSHSSCPSCRQILVVAR-------CRKCGCK  379
            WL +HSSCPSCR++L           CR+CG +
Sbjct  132  WLRAHSSCPSCRRVLAAPADLPPGEPCRRCGAR  164



>ref|NP_001168249.1| uncharacterized LOC100382012 [Zea mays]
 gb|ACN27589.1| unknown [Zea mays]
 gb|AFW72840.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=185

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPAD-CAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            +KK+VLRSLP  TY    + + + E  AD CAICL E+E G  +RVLPQC H FH  C+D
Sbjct  71   VKKEVLRSLPTVTY---VSDSGKAEGGADECAICLAEFEGGQAVRVLPQCGHAFHAACVD  127

Query  459  TWLGSHSSCPSCRQILVV-----ARCRKCGCK  379
            TWL +HSSCPSCR++L V      RCR+CG +
Sbjct  128  TWLRAHSSCPSCRRVLAVDLPPAERCRRCGAR  159



>ref|XP_009121114.1| PREDICTED: RING-H2 finger protein ATL44 [Brassica rapa]
Length=226

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTY----GPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQ  469
            LKKK L+SLP+ T+      S  AA +     +CAICLTE+ +G+EIRVLP C H FHV 
Sbjct  109  LKKKALQSLPRSTFTAAESTSGGAAEDGGDSTECAICLTEFADGEEIRVLPLCGHSFHVA  168

Query  468  CIDTWLGSHSSCPSCRQILVVARCRKCG  385
            CID WL S SSCPSCR+IL   RC +CG
Sbjct  169  CIDKWLVSRSSCPSCRRILTPVRCGRCG  196



>ref|NP_001047768.1| Os02g0686100 [Oryza sativa Japonica Group]
 dbj|BAD07573.1| putative ring finger protein [Oryza sativa Japonica Group]
 dbj|BAF09682.1| Os02g0686100 [Oryza sativa Japonica Group]
Length=189

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 10/92 (11%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KK+VLRSLP  TY  S     E E   +CAICL E+E+G  +RVLPQC H FH  CIDT
Sbjct  75   VKKEVLRSLPTVTY-VSDGGGGEAE---ECAICLVEFEDGQAVRVLPQCDHRFHAACIDT  130

Query  456  WLGSHSSCPSCRQILVVA------RCRKCGCK  379
            WL +HSSCPSCR++LV A      RC +CG +
Sbjct  131  WLRAHSSCPSCRRVLVAAEMPPGERCGRCGAR  162



>ref|XP_002271473.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
Length=195

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 64/107 (60%), Gaps = 7/107 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR +P   YGP        EIPA +C ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  89   LKKRALRQIPVAVYGPGV------EIPATECPICLGEFVQGEKVRVLPKCNHGFHVRCID  142

Query  459  TWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAGAGEQSQSAINI  319
            TWL SHSSCP+CR  L+          E+    P   G   Q +I I
Sbjct  143  TWLVSHSSCPNCRHSLLERPTTSDAAGEVAPEQPQPNGSTHQGSIVI  189



>ref|XP_010931361.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
Length=182

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR +P   YGP      E  IPA DC ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  81   LKKRALRRIPVAVYGP------EANIPATDCPICLGEFADGEKVRVLPKCHHGFHVRCID  134

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  135  TWLASHSSCPTCRHSLL  151



>ref|XP_010690732.1| PREDICTED: RING-H2 finger protein ATL80-like [Beta vulgaris subsp. 
vulgaris]
Length=192

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            L KK L  LP   Y      A       DCAICLTE+ +GD +R+LP+C H FHV CIDT
Sbjct  77   LDKKALNLLPTTNY---VCEAGGSNKQTDCAICLTEFADGDIMRILPRCNHVFHVTCIDT  133

Query  456  WLGSHSSCPSCRQ-ILVVARCRKCG  385
            WLGSHSSCPSCRQ +L+  +C  CG
Sbjct  134  WLGSHSSCPSCRQLVLIGGQCLHCG  158



>gb|KDP21651.1| hypothetical protein JCGZ_03322 [Jatropha curcas]
Length=226

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG   A    + I  DCAICL E+ +G++IRVLP+C HGFHV+CIDT
Sbjct  94   LKKSALRQIPVVIYGS--AGDGIQIIATDCAICLGEFMDGEKIRVLPKCSHGFHVRCIDT  151

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  152  WLVSHSSCPTCRQSLI  167



>ref|XP_010922739.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
 ref|XP_010922740.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
Length=184

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR LP   YGP         IPA DC ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  85   LKKRALRRLPVAVYGPG------TNIPATDCPICLGEFADGEKVRVLPKCHHGFHVRCID  138

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  139  TWLASHSSCPTCRHSLL  155



>ref|XP_010252063.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
 ref|XP_010252064.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
 ref|XP_010252065.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
Length=198

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 5/108 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK LR +P   YG   +  A      DC ICL E+ +G+++RVLP+C HGFHV+CID 
Sbjct  92   LKKKALRQIPVAVYGSGVSIQA-----TDCPICLGEFMDGEKVRVLPKCNHGFHVKCIDI  146

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAGAGEQSQSAINILL  313
            WL SHSSCP+CR  L+              V P G+G   Q  I +++
Sbjct  147  WLLSHSSCPTCRHSLLDRPTTSDPTDANAGVGPPGSGSDRQGGIVVVV  194



>ref|XP_010237950.1| PREDICTED: RING-H2 finger protein ATL74-like [Brachypodium distachyon]
Length=201

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAE-KEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LK+K LR +P   YG S    AE +   A+CAICL E+  G+++RVLP+CRHGFHV+CID
Sbjct  106  LKRKALRRIPVEVYGASNGVTAEGRAAAAECAICLGEFAGGEKVRVLPRCRHGFHVRCID  165

Query  459  TWLGSHSSCPSCRQILVV  406
             WL +HSSCP+CR  L+V
Sbjct  166  AWLAAHSSCPNCRASLLV  183



>ref|XP_008792228.1| PREDICTED: RING-H2 finger protein ATL74-like [Phoenix dactylifera]
Length=182

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR +P   YGP         IPA DC ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  81   LKKRALRRIPVAVYGPGV------NIPATDCPICLGEFADGEKVRVLPKCHHGFHVRCID  134

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  135  TWLASHSSCPTCRHSLL  151



>ref|XP_003533659.1| PREDICTED: RING-H2 finger protein ATL74-like [Glycine max]
Length=185

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LK++ L  +P   YG   AA  E  IPA +C ICL E+E+GD++R+LP+C HGFHV+CID
Sbjct  87   LKRRELSRIPVAVYG---AAGGENTIPATECPICLGEFEKGDKVRMLPKCNHGFHVRCID  143

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  144  TWLLSHSSCPNCRHSLL  160



>ref|XP_008809453.1| PREDICTED: RING-H2 finger protein ATL74-like isoform X2 [Phoenix 
dactylifera]
Length=181

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR +P   YGP         IPA DC ICL E+ +G+++RVLP+C HGFHV CID
Sbjct  85   LKKRALRRIPVAVYGPG------TNIPATDCPICLGEFADGEKVRVLPRCHHGFHVSCID  138

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  139  TWLASHSSCPTCRHSLL  155



>ref|NP_001150572.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|ACG39610.1| RING-H2 finger protein ATL1R [Zea mays]
Length=177

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 7/95 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAA--AAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCI  463
            +KK VLR +P   Y  S AA    E +   +CAICL E+EEG+  RVLPQC H FH  C+
Sbjct  63   VKKSVLRRIPTVPYAASAAACSQGEGDDADECAICLAEFEEGEPTRVLPQCGHAFHAACV  122

Query  462  DTWLGSHSSCPSCRQILVVA-----RCRKCGCKEI  373
            D WL +HSSCPSCR+IL +      RCR+CG + +
Sbjct  123  DRWLRAHSSCPSCRRILSLQLPPGERCRRCGARPL  157



>ref|NP_001150083.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|ACG37737.1| RING-H2 finger protein ATL1R [Zea mays]
Length=187

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 7/99 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTY--GPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCI  463
            +KK+VLRSLP  TY      AAAA +    +CAICL E+E G  +RVLPQC H FH  C+
Sbjct  71   VKKEVLRSLPTVTYVSDSGKAAAAAEGGADECAICLAEFEGGQAVRVLPQCGHAFHAACV  130

Query  462  DTWLGSHSSCPSCRQILVV-----ARCRKCGCKEIPSVS  361
            DTWL +HSSCPSCR++L V      RCR+CG +    +S
Sbjct  131  DTWLRAHSSCPSCRRVLAVDLPPAERCRRCGARPGAGIS  169



>ref|XP_003552318.1| PREDICTED: RING-H2 finger protein ATL74-like [Glycine max]
Length=180

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 67/102 (66%), Gaps = 16/102 (16%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LK++ L  +P   YG    AA E  IPA +C ICL E+E+GD +R+LP+C HGFHV+CID
Sbjct  83   LKRRELSRIPVAVYG----AAGENTIPATECPICLGEFEKGDRVRMLPKCNHGFHVRCID  138

Query  459  TWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP-AGAGEQS  337
            TWL SHSSCP+CR  L+          E P+ +P +G+G +S
Sbjct  139  TWLLSHSSCPNCRHSLL----------EKPAAAPESGSGRRS  170



>ref|NP_001145674.1| uncharacterized protein LOC100279177 [Zea mays]
 gb|ACG49239.1| hypothetical protein [Zea mays]
Length=196

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 61/104 (59%), Gaps = 21/104 (20%)
 Frame = -3

Query  636  LKKKVLRSLPKFTY---------GPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRH  484
            L+KK LR+LP   Y             A     E+ A+CAICL+E+   +E+RVLPQC H
Sbjct  72   LRKKALRALPSLAYEDAVAARAGAGDGAGDGAAEVLAECAICLSEFAPREEVRVLPQCGH  131

Query  483  GFHVQCIDTWLGSHSSCPSCRQILVVA------------RCRKC  388
             FHV CIDTWL +HSSCPSCR++LVV             RCRKC
Sbjct  132  AFHVACIDTWLAAHSSCPSCRRVLVVGDDASKRPPHQPKRCRKC  175



>ref|XP_008809452.1| PREDICTED: RING-H2 finger protein ATL74-like isoform X1 [Phoenix 
dactylifera]
Length=220

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR +P   YGP         IPA DC ICL E+ +G+++RVLP+C HGFHV CID
Sbjct  124  LKKRALRRIPVAVYGPG------TNIPATDCPICLGEFADGEKVRVLPRCHHGFHVSCID  177

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  178  TWLASHSSCPTCRHSLL  194



>ref|XP_010658180.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
 emb|CAN70348.1| hypothetical protein VITISV_012580 [Vitis vinifera]
 emb|CBI25365.3| unnamed protein product [Vitis vinifera]
Length=197

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG      +   IPA DC ICL E+E+GD++RVLP+C HGFH++CID
Sbjct  89   LKKSALRQIPVAVYG------SGTNIPATDCPICLGEFEQGDKVRVLPKCHHGFHMKCID  142

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  143  TWLVSHSSCPTCRHSLL  159



>ref|XP_009395164.1| PREDICTED: RING-H2 finger protein ATL74-like [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            L+K+ LR +P   YG         +IPA DC ICLTE+ +G+++RVLP+C HGFHV+CID
Sbjct  85   LEKRALRRIPVAVYGSG------ADIPATDCPICLTEFADGEKVRVLPRCHHGFHVRCID  138

Query  459  TWLGSHSSCPSCRQILV  409
             WL SHSSCP+CRQ L+
Sbjct  139  KWLASHSSCPTCRQSLL  155



>ref|XP_008662433.1| PREDICTED: RING-H2 finger protein ATL74-like [Zea mays]
 gb|AFW55963.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=207

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -3

Query  636  LKKKVLRSLPKFTY----GPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQ  469
            LKK+ LR +P   Y     PS ++  + +   DCAICL E+++G+E+R+LP C HGFHVQ
Sbjct  108  LKKRELRRIPVVLYEANKQPSASSGTDDD--DDCAICLGEFDDGEELRLLPGCHHGFHVQ  165

Query  468  CIDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAG  352
            CID WL  H+SCP+CR  L+V + R  G  +  + + AG
Sbjct  166  CIDVWLVMHASCPTCRNSLLVHQDRHAGAGDGEAATVAG  204



>ref|XP_007205967.1| hypothetical protein PRUPE_ppa012052mg [Prunus persica]
 gb|EMJ07166.1| hypothetical protein PRUPE_ppa012052mg [Prunus persica]
Length=185

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 8/101 (8%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG         EIPA +C ICL E+E+G+++RVLP+C HGFHV+CID
Sbjct  61   LKKSHLRQIPIAVYGSGV------EIPATECPICLGEFEDGEKVRVLPECNHGFHVRCID  114

Query  459  TWLGSHSSCPSCRQ-ILVVARCRKCGCKEIPSVSPAGAGEQ  340
            TWL SHSSCP+CR  +L +   +K      PS + A   ++
Sbjct  115  TWLLSHSSCPNCRHSLLELHHPKKSTRTNSPSTADASQNQE  155



>gb|KDO42949.1| hypothetical protein CISIN_1g029206mg [Citrus sinensis]
Length=197

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG    AA  K    DCAICL ++ +G+++RVLP+C HGFHV+CIDT
Sbjct  89   LKKSALRQIPVAVYG----AAGVKIKATDCAICLVDFMDGEKVRVLPKCNHGFHVRCIDT  144

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CR+ L+
Sbjct  145  WLMSHSSCPTCRRSLL  160



>gb|EAZ25203.1| hypothetical protein OsJ_09003 [Oryza sativa Japonica Group]
Length=161

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 13/99 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK + +LP  ++     A  +++  A+CAICL E+  G+E+R+LP C H FHV CIDT
Sbjct  52   LKKKAIDALPTVSF-----ALKQQQQQAECAICLAEFAGGEELRLLPHCGHAFHVSCIDT  106

Query  456  WLGSHSSCPSCRQIL--------VVARCRKCGCKEIPSV  364
            WLG+H++CPSCR  +        +  RCR+CG  ++P++
Sbjct  107  WLGTHATCPSCRATVGTSTLFLPLPGRCRRCGEVDLPTL  145



>ref|XP_002325483.2| hypothetical protein POPTR_0019s08600g [Populus trichocarpa]
 gb|EEE99864.2| hypothetical protein POPTR_0019s08600g [Populus trichocarpa]
Length=192

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG     A    I  DCAICL E+  G+++RVLP C HGFHV+CIDT
Sbjct  90   LKKSALRRIPVIIYG----VAGIHLIATDCAICLGEFIGGEKVRVLPNCNHGFHVRCIDT  145

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  146  WLVSHSSCPTCRQSLL  161



>dbj|BAD23012.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
Length=184

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 13/99 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK + +LP  ++     A  +++  A+CAICL E+  G+E+R+LP C H FHV CIDT
Sbjct  75   LKKKAIDALPTVSF-----ALKQQQQQAECAICLAEFAGGEELRLLPHCGHAFHVSCIDT  129

Query  456  WLGSHSSCPSCRQIL--------VVARCRKCGCKEIPSV  364
            WLG+H++CPSCR  +        +  RCR+CG  ++P++
Sbjct  130  WLGTHATCPSCRATVGTSTLFLPLPGRCRRCGEVDLPTL  168



>ref|XP_010031086.1| PREDICTED: RING-H2 finger protein ATL72 isoform X2 [Eucalyptus 
grandis]
 gb|KCW50351.1| hypothetical protein EUGRSUZ_J00118 [Eucalyptus grandis]
Length=205

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG      A   IPA DC ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  98   LKKSALRQIPVAVYG------AGINIPATDCPICLAEFMDGEKVRVLPKCHHGFHVRCID  151

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CRQ L+
Sbjct  152  TWLVSHSSCPTCRQSLL  168



>gb|KCW50353.1| hypothetical protein EUGRSUZ_J00118 [Eucalyptus grandis]
Length=201

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG      A   IPA DC ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  98   LKKSALRQIPVAVYG------AGINIPATDCPICLAEFMDGEKVRVLPKCHHGFHVRCID  151

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CRQ L+
Sbjct  152  TWLVSHSSCPTCRQSLL  168



>ref|XP_011001401.1| PREDICTED: RING-H2 finger protein ATL74 [Populus euphratica]
 ref|XP_011001402.1| PREDICTED: RING-H2 finger protein ATL74 [Populus euphratica]
Length=192

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG     A    I  DCAICL E+  G+++RVLP C HGFHV+CIDT
Sbjct  90   LKKSALRRIPVIIYG----VAGIHLIATDCAICLGEFIGGEKVRVLPNCNHGFHVRCIDT  145

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  146  WLVSHSSCPTCRQSLL  161



>ref|XP_010031085.1| PREDICTED: RING-H2 finger protein ATL72 isoform X1 [Eucalyptus 
grandis]
 gb|KCW50352.1| hypothetical protein EUGRSUZ_J00118 [Eucalyptus grandis]
Length=206

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG      A   IPA DC ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  98   LKKSALRQIPVAVYG------AGINIPATDCPICLAEFMDGEKVRVLPKCHHGFHVRCID  151

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CRQ L+
Sbjct  152  TWLVSHSSCPTCRQSLL  168



>ref|XP_003623617.1| RING-H2 finger protein ATL5H [Medicago truncatula]
 gb|AES79835.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=179

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIP-ADCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ L  +P   YG      A ++IP  +C ICL E+E+GD++R+LP+C HGFHV+CID
Sbjct  82   LKKRELSQIPVTVYG-----GAGEDIPVTECPICLGEFEKGDKVRMLPKCNHGFHVRCID  136

Query  459  TWLGSHSSCPSCRQILVVARCRKCG  385
            TWL SHSSCP+CR  L+V    K G
Sbjct  137  TWLVSHSSCPNCRNSLLVEGESKDG  161



>ref|XP_004502903.1| PREDICTED: RING-H2 finger protein ATL78-like [Cicer arietinum]
Length=225

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = -3

Query  711  RCAWLRRIRaganggasgqxssnkGLKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLT  532
            RC+ L  + +      +   + N G+KKK L+S    +Y P    ++   + ++C ICL+
Sbjct  87   RCSNLVMMSSDHLENNTAVRAKNTGIKKKALKSFTTISYSPELNLSS---LDSECVICLS  143

Query  531  EYEEGDEIRVLPQCRHGFHVQCIDTWLGSHSSCPSCRQILVVARCRK  391
            E+  GD++R+LP+C HGFHV+CID WL SHSSCP CRQ L +  C+K
Sbjct  144  EFSNGDKVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRQCL-IETCKK  189



>gb|EAY88139.1| hypothetical protein OsI_09574 [Oryza sativa Indica Group]
Length=156

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 14/99 (14%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK + +LP  ++      A +++  A+CAICL E+  G+E+R+LP C H FHV CIDT
Sbjct  52   LKKKAIDALPTVSF------ALKQQQQAECAICLAEFAGGEELRLLPHCGHAFHVSCIDT  105

Query  456  WLGSHSSCPSCRQIL--------VVARCRKCGCKEIPSV  364
            WLG+H++CPSCR  +        +  RCR+CG  ++P++
Sbjct  106  WLGTHATCPSCRATVGTSTLFLPLPGRCRRCGEVDLPTL  144



>gb|EMT16971.1| RING-H2 finger protein ATL1B [Aegilops tauschii]
Length=170

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIP--ADCAICLTEYEEGDEIRVLPQCRHGFHVQCI  463
            +KKK L++LP  ++ P  +  A++E    A+CAICL E+  GDE+RVLP C HGFH  C+
Sbjct  59   IKKKALQALPTVSWRPQQSTEADEEEGERAECAICLAEFAPGDEVRVLPTCGHGFHAACV  118

Query  462  DTWLGSHSSCPSCRQILVVARCRKCGCKEIP  370
            D WL S+S+CPSCR+ LVVA  +     E P
Sbjct  119  DVWLLSNSTCPSCRRALVVAAAQLPAVTESP  149



>ref|XP_011013335.1| PREDICTED: RING-H2 finger protein ATL74-like [Populus euphratica]
Length=198

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            L +  LR +P   YG S        I  DCAICL E+ +G+++RVLP+C HGFHV+CIDT
Sbjct  90   LTRSALRQIPVIIYGVS----GMHIIATDCAICLVEFTDGEKVRVLPKCSHGFHVRCIDT  145

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  146  WLVSHSSCPTCRQSLL  161



>ref|NP_001173220.1| Os02g0832150 [Oryza sativa Japonica Group]
 dbj|BAH91949.1| Os02g0832150 [Oryza sativa Japonica Group]
Length=217

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 13/99 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKKK + +LP  ++     A  +++  A+CAICL E+  G+E+R+LP C H FHV CIDT
Sbjct  108  LKKKAIDALPTVSF-----ALKQQQQQAECAICLAEFAGGEELRLLPHCGHAFHVSCIDT  162

Query  456  WLGSHSSCPSCRQIL--------VVARCRKCGCKEIPSV  364
            WLG+H++CPSCR  +        +  RCR+CG  ++P++
Sbjct  163  WLGTHATCPSCRATVGTSTLFLPLPGRCRRCGEVDLPTL  201



>ref|NP_001235294.1| uncharacterized protein LOC100527126 [Glycine max]
 gb|ACU16173.1| unknown [Glycine max]
Length=232

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 10/97 (10%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA---DCAICLTEYEEGDEIRVLPQCRHGFHVQC  466
            +KKK L++ P  +Y      + E ++P    +C ICL+E+  GD++R+LP+C HGFHV+C
Sbjct  118  IKKKALKTFPTVSY------STEMKLPGLDTECVICLSEFANGDKVRILPKCNHGFHVRC  171

Query  465  IDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            ID WL SHSSCP CRQ L +  C+K    +I  V P 
Sbjct  172  IDKWLSSHSSCPKCRQCL-IETCKKIVGSQIQPVPPV  207



>ref|XP_002319337.2| hypothetical protein POPTR_0013s09370g, partial [Populus trichocarpa]
 gb|EEE95260.2| hypothetical protein POPTR_0013s09370g, partial [Populus trichocarpa]
Length=220

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG S        I  DCAICL E+ +G+++RVLP+C HGFHV+CIDT
Sbjct  90   LKKSALRQIPVIIYGVS----GIHTIATDCAICLGEFIDGEKVRVLPKCNHGFHVRCIDT  145

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CR  L+
Sbjct  146  WLVSHSSCPTCRHSLL  161



>ref|XP_009346909.1| PREDICTED: RING-H2 finger protein ATL74-like [Pyrus x bretschneideri]
Length=198

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKKK LR +P   YG          IPA +C ICL E+E+G+++RVLP+C HGFHV+CID
Sbjct  83   LKKKHLRQIPIAVYGSGV------NIPATECPICLAEFEDGEKVRVLPKCHHGFHVRCID  136

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  137  TWLLSHSSCPNCRHSLL  153



>gb|KHN29152.1| RING-H2 finger protein ATL78 [Glycine soja]
Length=221

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 10/97 (10%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA---DCAICLTEYEEGDEIRVLPQCRHGFHVQC  466
            +KKK L++ P  +Y      + E ++P    +C ICL+E+  GD++R+LP+C HGFHV+C
Sbjct  108  IKKKALKTFPTVSY------STEMKLPGLDTECVICLSEFANGDKVRILPKCNHGFHVRC  161

Query  465  IDTWLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPA  355
            ID WL SHSSCP CRQ L +  C+K    +I  V P 
Sbjct  162  IDKWLSSHSSCPKCRQCL-IETCKKIVGSQIQPVPPV  197



>ref|XP_006577152.1| PREDICTED: RING-H2 finger protein ATL5-like [Glycine max]
Length=210

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 7/102 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            L   V++SLP FT    F+AA  + +  DCA+CL+E+ +GDE RVLP C+H FH  CIDT
Sbjct  70   LDPSVIKSLPTFT----FSAATHRSL-QDCAVCLSEFADGDEGRVLPNCKHAFHAHCIDT  124

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAGAGEQSQS  331
            W GSHS CP CR  ++ A        E  SVS AG G  S S
Sbjct  125  WFGSHSKCPLCRTPVLPA--TGSADTEPGSVSEAGEGCSSSS  164



>ref|XP_011466420.1| PREDICTED: RING-H2 finger protein ATL74 [Fragaria vesca subsp. 
vesca]
Length=201

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR LP   YG          IPA +C ICL E+EEG+++RVLP+C HGFHV+CID
Sbjct  82   LKKSHLRQLPVAVYGEG------THIPATECPICLGEFEEGEKVRVLPKCNHGFHVRCID  135

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  136  TWLVSHSSCPNCRHSLL  152



>ref|XP_008244900.1| PREDICTED: RING-H2 finger protein ATL74-like [Prunus mume]
Length=206

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG         EIPA +C ICL E+E+G+++RVLP+C HGFHV+CID
Sbjct  82   LKKSHLRQIPVAVYGSGV------EIPATECPICLGEFEDGEKVRVLPECNHGFHVRCID  135

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  136  TWLLSHSSCPNCRHSLL  152



>ref|XP_009372015.1| PREDICTED: RING-H2 finger protein ATL74-like [Pyrus x bretschneideri]
Length=202

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG          IPA +C ICLTE+E+G+++RVLP+C HGFHV+CID
Sbjct  84   LKKSHLRQIPIAVYGSGV------NIPATECPICLTEFEDGEKVRVLPKCNHGFHVRCID  137

Query  459  TWLGSHSSCPSCRQILV  409
            TW  SHSSCP+CR  L+
Sbjct  138  TWFLSHSSCPNCRHSLL  154



>ref|XP_003528016.1| PREDICTED: RING-H2 finger protein ATL72-like [Glycine max]
 gb|KHN25810.1| RING-H2 finger protein ATL72 [Glycine soja]
Length=198

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  L  +P   YG   A+ A      DC ICL E+ +G+++RVLP+C HGFHV+CIDT
Sbjct  87   LKKSALHQIPIVVYGSGSASIAAT----DCPICLGEFVDGEKVRVLPKCNHGFHVRCIDT  142

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  143  WLLSHSSCPNCRQSLL  158



>ref|NP_001151707.1| RING-H2 finger protein ATL5A [Zea mays]
 gb|ACG44065.1| RING-H2 finger protein ATL5A [Zea mays]
Length=181

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 14/103 (14%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            L+K+VLRS+P   YG     AA   +   CAICL E+ +G+++RVLP+C HGFHV+C+DT
Sbjct  83   LEKRVLRSMPVEVYG-----AAAVTVADVCAICLGEFADGEKVRVLPRCAHGFHVRCVDT  137

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAGAGEQSQSA  328
            WL SH SCP+CR  ++       G K   + +PAG G + Q +
Sbjct  138  WLLSHDSCPTCRASVLD------GAK---AATPAGGGSRRQGS  171



>ref|XP_008370258.1| PREDICTED: RING-H2 finger protein ATL74 [Malus domestica]
 ref|XP_008345571.1| PREDICTED: RING-H2 finger protein ATL74-like [Malus domestica]
Length=205

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK+ LR +P   YG          IPA +C ICL E+E+G+++RVLP+C HGFHV+CID
Sbjct  84   LKKRHLRQIPIAVYGSGV------NIPATECPICLAEFEDGEKVRVLPKCHHGFHVRCID  137

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  138  TWLLSHSSCPNCRHSLL  154



>ref|XP_006435916.1| hypothetical protein CICLE_v10032803mg [Citrus clementina]
 ref|XP_006486170.1| PREDICTED: RING-H2 finger protein ATL72-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486171.1| PREDICTED: RING-H2 finger protein ATL72-like isoform X2 [Citrus 
sinensis]
 gb|ESR49156.1| hypothetical protein CICLE_v10032803mg [Citrus clementina]
Length=197

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG     A  K    DCAICL ++ +G+++RVLP+C HGFHV+CIDT
Sbjct  89   LKKSALRQIPVAVYG----TAGVKIKATDCAICLVDFMDGEKVRVLPKCNHGFHVRCIDT  144

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CR+ L+
Sbjct  145  WLMSHSSCPTCRRSLL  160



>emb|CDY34972.1| BnaA01g27620D [Brassica napus]
Length=273

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            L   VL+SLP FT    F+ AA  E P +CA+CL+E+EEG+  RVLP C+H FHV+CID 
Sbjct  81   LDPDVLKSLPVFT----FSDAATHEDPIECAVCLSEFEEGESGRVLPGCKHAFHVECIDM  136

Query  456  WLGSHSSCPSCRQILV  409
            W  SHS+CP CR ++V
Sbjct  137  WFHSHSTCPLCRSLVV  152



>emb|CDP13909.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 5/76 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK +LR +P   YG      A      DC ICL E+E+G+++RVLP+C HGFHV+CID 
Sbjct  88   LKKSMLRRIPVAEYGTGVVLPA-----TDCPICLGEFEDGEKVRVLPRCHHGFHVRCIDI  142

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  143  WLASHSSCPTCRQSLL  158



>gb|EMS62914.1| RING-H2 finger protein ATL44 [Triticum urartu]
Length=186

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 67/114 (59%), Gaps = 15/114 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPS------FAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFH  475
            +KK VLR++P   Y  +         A E     +CAICL E+E+G+ +RVLPQC H FH
Sbjct  68   VKKSVLRAIPTVAYVSTDAGKGKGKEAEEAAAAPECAICLAEFEDGEAMRVLPQCGHAFH  127

Query  474  VQCIDTWLGSHSSCPSCRQILVV-----ARCRKCGCKEIPSVS----PAGAGEQ  340
              C+D WL  HSSCPSCR+IL V      RC++CG +  P+V+    PA  GE 
Sbjct  128  AACVDKWLRGHSSCPSCRRILAVQLPAAQRCQRCGARPDPAVATWKPPAQYGEM  181



>ref|XP_009114556.1| PREDICTED: RING-H2 finger protein ATL2-like [Brassica rapa]
Length=272

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 4/76 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            L   VL+SLP FT    F+ AA  E P +CA+CL+E+EEG+  RVLP C+H FHV+CID 
Sbjct  81   LDPDVLKSLPVFT----FSDAATHEDPIECAVCLSEFEEGESGRVLPGCKHAFHVECIDM  136

Query  456  WLGSHSSCPSCRQILV  409
            W  SHS+CP CR ++V
Sbjct  137  WFHSHSTCPLCRSLVV  152



>gb|KEH35547.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=177

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  LR +P   YG     ++      +C ICL E+ +G+++R+LP+C HGFHV+CIDT
Sbjct  92   LKKSALRKIPVAVYGS--GGSSTSFAATECPICLGEFMDGEKVRILPKCNHGFHVKCIDT  149

Query  456  WLGSHSSCPSCRQILV  409
            WL SHSSCP+CRQ L+
Sbjct  150  WLLSHSSCPTCRQTLI  165



>ref|XP_008388346.1| PREDICTED: RING-H2 finger protein ATL74-like [Malus domestica]
Length=200

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  LR +P   YG          IPA +C ICLTE+E+G+++RVLP+C HGFHV+CID
Sbjct  84   LKKSHLRQIPIAVYGSGV------NIPATECPICLTEFEDGEKVRVLPKCNHGFHVRCID  137

Query  459  TWLGSHSSCPSCRQILV  409
            TW  SHSSCP+CR  L+
Sbjct  138  TWFLSHSSCPNCRHSLL  154



>gb|EYU20094.1| hypothetical protein MIMGU_mgv1a014454mg [Erythranthe guttata]
Length=189

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK VLR +P   Y     A+ E     DC ICL ++ +G++IRVLP+C H FHV C+D 
Sbjct  90   LKKAVLRRIPVAVY-----ASGEGGFYTDCPICLGDFLDGEKIRVLPKCNHCFHVNCVDV  144

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEIPSVSP  358
            WL SHSSCP+CR+ L   R    G + +  V+P
Sbjct  145  WLASHSSCPTCRRSLAAERAESGGGETVGMVTP  177



>ref|XP_007137692.1| hypothetical protein PHAVU_009G147700g [Phaseolus vulgaris]
 gb|ESW09686.1| hypothetical protein PHAVU_009G147700g [Phaseolus vulgaris]
Length=226

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 9/88 (10%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA---DCAICLTEYEEGDEIRVLPQCRHGFHVQC  466
            +KKK L++ P  +Y      +AE  +P+   +C ICL+E+  GD++R+LP+C HGFHV+C
Sbjct  107  VKKKALKTFPTVSY------SAELNLPSLDSECVICLSEFSNGDKVRILPKCNHGFHVRC  160

Query  465  IDTWLGSHSSCPSCRQILVVARCRKCGC  382
            ID WL SHSSCP CRQ L+    +  GC
Sbjct  161  IDMWLSSHSSCPKCRQCLIETCQKIVGC  188



>ref|XP_006842471.1| hypothetical protein AMTR_s00077p00074350 [Amborella trichopoda]
 gb|ERN04146.1| hypothetical protein AMTR_s00077p00074350 [Amborella trichopoda]
Length=182

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 5/76 (7%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK+ LR +P   YG            +DCAICL E+ EG+++R+LP CRHGFHV+CIDT
Sbjct  83   LKKRALRQIPVSIYGHGGDTPG-----SDCAICLGEFAEGEKVRILPACRHGFHVRCIDT  137

Query  456  WLGSHSSCPSCRQILV  409
            WL SH+SCP+CR  +V
Sbjct  138  WLASHASCPTCRGSVV  153



>ref|XP_010423485.1| PREDICTED: RING-H2 finger protein ATL73 [Camelina sativa]
Length=173

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 12/95 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KK+ L+ +P  +Y P     A      +C ICL E+ EG+ +RVLP+C HGFHV+CIDT
Sbjct  91   IKKRALKLIPVDSYSPELKMKA-----TECLICLGEFLEGETVRVLPKCNHGFHVKCIDT  145

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAG  352
            WL SHSSCP+CRQ L+  +    G       SPAG
Sbjct  146  WLLSHSSCPTCRQSLLELQTPSNG-------SPAG  173



>gb|ACN27203.1| unknown [Zea mays]
 tpg|DAA36295.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=173

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 7/93 (8%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KK VLR +P   Y  +  +  E +   +CAICL E+EEG+  RVLPQC H FH  C+D 
Sbjct  63   VKKSVLRRIPTVPY--AACSQGEGDDADECAICLAEFEEGEPTRVLPQCGHAFHAACVDR  120

Query  456  WLGSHSSCPSCRQILVVA-----RCRKCGCKEI  373
            WL +HSSCPSCR+IL +      RCR+CG + +
Sbjct  121  WLRAHSSCPSCRRILSLQLPPGERCRRCGARPL  153



>gb|AFK40012.1| unknown [Lotus japonicus]
Length=206

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKK  L  +P   YG   + +A   I A DCAICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  88   LKKSALNQIPVVVYG---SGSASTSIAATDCAICLGEFVDGEKVRVLPKCNHGFHVKCID  144

Query  459  TWLGSHSSCPSCRQILV  409
             WL SHSSCP+CRQ L+
Sbjct  145  KWLLSHSSCPNCRQSLL  161



>ref|XP_003630203.1| Ring finger protein [Medicago truncatula]
 gb|AET04679.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=225

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KKK L++ P  +Y       +   + A+C ICL+E+ +G+++R+LP+C HGFHV+CID 
Sbjct  113  IKKKALKAFPTVSYSTDLKLPS---LDAECMICLSEFTKGEKVRILPKCNHGFHVRCIDK  169

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEI-PSVSPA  355
            WL  HSSCP CRQ L +  CRK G  ++ P V P 
Sbjct  170  WLKEHSSCPKCRQCL-LETCRKIGGSQVQPIVLPV  203



>ref|XP_010452430.1| PREDICTED: RING-H2 finger protein ATL73-like [Camelina sativa]
Length=174

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 12/95 (13%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            +KK+ L+ +P  +Y P     A      +C ICL E+ EG+ +RVLP+C HGFHV+CIDT
Sbjct  92   IKKRALKLIPVDSYSPELKMKA-----TECLICLGEFLEGETVRVLPKCNHGFHVKCIDT  146

Query  456  WLGSHSSCPSCRQILVVARCRKCGCKEIPSVSPAG  352
            WL SHSSCP+CRQ L+  +    G       SPAG
Sbjct  147  WLLSHSSCPTCRQSLLELQTPANG-------SPAG  174



>ref|XP_010036001.1| PREDICTED: RING-H2 finger protein ATL74 [Eucalyptus grandis]
Length=179

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 5/77 (6%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LK++ LR +P   YG    +AA  +IPA +C ICL E+ +G+++RVLP+C HGFHV+CID
Sbjct  93   LKRRDLRQIPVAVYG----SAAAAKIPATECPICLGEFVDGEKVRVLPKCNHGFHVRCID  148

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  149  TWLLSHSSCPNCRHSLL  165



>ref|XP_002442771.1| hypothetical protein SORBIDRAFT_08g002625 [Sorghum bicolor]
 gb|EES16609.1| hypothetical protein SORBIDRAFT_08g002625 [Sorghum bicolor]
Length=114

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 12/76 (16%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK VLR +P   YG            A+CAICL E+ +GD +R+LP+CRHGFHV CIDT
Sbjct  50   LKKSVLRKMPVAVYG------------AECAICLGEFADGDAVRLLPRCRHGFHVHCIDT  97

Query  456  WLGSHSSCPSCRQILV  409
            WL +HSSCP CR  L+
Sbjct  98   WLSAHSSCPICRDSLL  113



>ref|XP_004954531.1| PREDICTED: RING-H2 finger protein ATL80-like [Setaria italica]
Length=192

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPADCAICLTEYEEGDEIRVLPQCRHGFHVQCIDT  457
            LKK  + +LP      S +         +CAICL  + EGDE+RVLP C HGFH  CIDT
Sbjct  96   LKKAAIEALPTM----SMSLEGRDGERGECAICLGLFAEGDELRVLPHCAHGFHAPCIDT  151

Query  456  WLGSHSSCPSCRQILVVARCRKCG  385
            WL +H+SCPSCR  + V  CR+CG
Sbjct  152  WLAAHASCPSCRAAVAVGTCRRCG  175



>emb|CDP12783.1| unnamed protein product [Coffea canephora]
Length=238

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 9/90 (10%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA---DCAICLTEYEEGDEIRVLPQCRHGFHVQC  466
            +KKK L++ P   Y      + E ++PA   +CAICL+E+  G+ +RVLP+C HGFHV+C
Sbjct  116  IKKKALKTFPTINY------STELKLPALDTECAICLSEFATGERVRVLPKCNHGFHVRC  169

Query  465  IDTWLGSHSSCPSCRQILVVARCRKCGCKE  376
            ID WL SHSSCP+CR  L+    +  GC +
Sbjct  170  IDKWLNSHSSCPTCRHCLIETCQKIVGCSQ  199



>ref|XP_010253089.1| PREDICTED: RING-H2 finger protein ATL74-like [Nelumbo nucifera]
Length=197

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 5/77 (6%)
 Frame = -3

Query  636  LKKKVLRSLPKFTYGPSFAAAAEKEIPA-DCAICLTEYEEGDEIRVLPQCRHGFHVQCID  460
            LKKK LR +P   YG    + + K I A +C ICL ++ +GD+IRVLP+C HGFHV+CID
Sbjct  91   LKKKALRQIPVAVYG----SGSGKSIQATECPICLGDFVDGDKIRVLPECSHGFHVKCID  146

Query  459  TWLGSHSSCPSCRQILV  409
            TWL SHSSCP+CR  L+
Sbjct  147  TWLVSHSSCPTCRHSLL  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395