BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF017J01

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF01745.1|  putative endomembrane protein EMP70 precusor isolog    191   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001182857.1|  uncharacterized protein LOC100501115 precursor     191   1e-56   
gb|KJB47459.1|  hypothetical protein B456_008G027700                    195   8e-56   Gossypium raimondii
gb|KJB79239.1|  hypothetical protein B456_013G038900                    196   1e-55   Gossypium raimondii
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    198   2e-55   Nicotiana tomentosiformis
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg                198   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg             198   2e-55   Prunus persica
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    198   2e-55   Nicotiana sylvestris
gb|KJB12212.1|  hypothetical protein B456_002G006200                    198   2e-55   Gossypium raimondii
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3    198   2e-55   Prunus mume [ume]
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    197   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...    197   3e-55   Sesamum indicum [beniseed]
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    197   3e-55   Pyrus x bretschneideri [bai li]
gb|AAL07091.2|  putative endomembrane protein EMP70 precusor isolog     195   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    197   3e-55   Malus domestica [apple tree]
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg             197   3e-55   Citrus clementina [clementine]
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    197   3e-55   
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...    197   3e-55   Citrus sinensis [apfelsine]
gb|KDP38816.1|  hypothetical protein JCGZ_04973                         197   3e-55   Jatropha curcas
emb|CDO97576.1|  unnamed protein product                                197   3e-55   Coffea canephora [robusta coffee]
ref|XP_002530674.1|  endomembrane protein emp70, putative               197   3e-55   Ricinus communis
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    197   4e-55   Fragaria vesca subsp. vesca
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3    198   4e-55   Cucumis melo [Oriental melon]
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...    197   4e-55   Nicotiana sylvestris
emb|CDX94774.1|  BnaC07g17830D                                          197   4e-55   
emb|CDY20974.1|  BnaA08g25510D                                          197   4e-55   Brassica napus [oilseed rape]
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3    197   4e-55   Eucalyptus grandis [rose gum]
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...    197   4e-55   
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             197   4e-55   Phaseolus vulgaris [French bean]
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    197   5e-55   Elaeis guineensis
gb|KJB77692.1|  hypothetical protein B456_012G151500                    197   5e-55   Gossypium raimondii
gb|AFX67030.1|  endomembrane protein emp70                              191   5e-55   Solanum tuberosum [potatoes]
emb|CDY19333.1|  BnaC05g08420D                                          197   5e-55   Brassica napus [oilseed rape]
emb|CDY20592.1|  BnaC08g14660D                                          197   5e-55   Brassica napus [oilseed rape]
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    197   5e-55   Glycine soja [wild soybean]
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    197   6e-55   Arabis alpina [alpine rockcress]
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...    197   6e-55   Brassica rapa
emb|CDX97924.1|  BnaA06g06750D                                          197   6e-55   
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    197   6e-55   Glycine max [soybeans]
gb|KJB79238.1|  hypothetical protein B456_013G038900                    197   6e-55   Gossypium raimondii
emb|CDY34861.1|  BnaA09g47870D                                          196   7e-55   Brassica napus [oilseed rape]
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    196   7e-55   Glycine max [soybeans]
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg             196   7e-55   Eutrema salsugineum [saltwater cress]
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    196   7e-55   Glycine soja [wild soybean]
gb|KGN57596.1|  hypothetical protein Csa_3G222780                       197   7e-55   
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                    196   7e-55   Gossypium arboreum [tree cotton]
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...    196   8e-55   Brassica rapa
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1    196   8e-55   Populus euphratica
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...    196   8e-55   Zea mays [maize]
ref|XP_007042269.1|  Transmembrane nine 1                               197   9e-55   
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    196   9e-55   Elaeis guineensis
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...    196   9e-55   
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    196   9e-55   Phoenix dactylifera
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47458.1|  hypothetical protein B456_008G027700                    196   1e-54   Gossypium raimondii
ref|XP_006384984.1|  endomembrane protein 70                            196   1e-54   
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-54   Solanum lycopersicum
ref|XP_006392091.1|  hypothetical protein EUTSA_v10023368mg             194   1e-54   
emb|CDY34667.1|  BnaC08g42260D                                          197   1e-54   Brassica napus [oilseed rape]
gb|KJB79240.1|  hypothetical protein B456_013G038900                    196   1e-54   Gossypium raimondii
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1    196   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_563881.1|  transmembrane nine 1                                  196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          196   1e-54   Sorghum bicolor [broomcorn]
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg             196   1e-54   Capsella rubella
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-54   
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-54   
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                    195   1e-54   Triticum urartu
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-54   Nicotiana tomentosiformis
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    196   1e-54   Solanum tuberosum [potatoes]
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...    196   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...    196   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    196   2e-54   Nicotiana sylvestris
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...    196   2e-54   Elaeis guineensis
gb|KHG27380.1|  Tm9sf3                                                  196   2e-54   Gossypium arboreum [tree cotton]
dbj|BAJ96423.1|  predicted protein                                      196   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...    195   2e-54   Solanum tuberosum [potatoes]
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233             196   2e-54   Arabidopsis lyrata subsp. lyrata
emb|CDY54577.1|  BnaCnng27330D                                          194   2e-54   Brassica napus [oilseed rape]
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...    195   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...    196   2e-54   Populus euphratica
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3    195   2e-54   Solanum lycopersicum
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    195   2e-54   Setaria italica
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    195   2e-54   Brachypodium distachyon [annual false brome]
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg                195   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    197   2e-54   
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    195   2e-54   Tarenaya hassleriana [spider flower]
ref|NP_001065897.1|  Os11g0181100                                       195   2e-54   
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...    195   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...    194   2e-54   Phoenix dactylifera
dbj|BAJ86318.1|  predicted protein                                      195   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001785033.1|  predicted protein                                  189   3e-54   
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    195   3e-54   Brachypodium distachyon [annual false brome]
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1    195   3e-54   Vitis vinifera
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    194   4e-54   Elaeis guineensis
emb|CDY12876.1|  BnaA09g13980D                                          194   4e-54   Brassica napus [oilseed rape]
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    194   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ87519.1|  predicted protein                                      194   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...    194   5e-54   
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg             194   5e-54   Eutrema salsugineum [saltwater cress]
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                    194   5e-54   
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3    194   5e-54   Nelumbo nucifera [Indian lotus]
emb|CDY03772.1|  BnaC01g28890D                                          194   6e-54   
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                    194   6e-54   Arabis alpina [alpine rockcress]
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...    194   7e-54   Oryza brachyantha
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g             194   7e-54   Phaseolus vulgaris [French bean]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...    194   7e-54   Glycine max [soybeans]
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...    194   7e-54   Brassica rapa
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...    194   7e-54   Setaria italica
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...    194   8e-54   Glycine max [soybeans]
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...    194   8e-54   Glycine max [soybeans]
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...    194   8e-54   Glycine max [soybeans]
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...    194   8e-54   Cicer arietinum [garbanzo]
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    194   8e-54   Phoenix dactylifera
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    193   8e-54   
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         194   8e-54   Medicago truncatula
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    194   9e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...    194   9e-54   Zea mays [maize]
emb|CDY54580.1|  BnaCnng27350D                                          193   9e-54   Brassica napus [oilseed rape]
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...    193   9e-54   Zea mays [maize]
ref|NP_001066292.1|  Os12g0175700                                       194   1e-53   
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...    193   1e-53   
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...    194   1e-53   
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...    193   1e-53   Setaria italica
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350          193   1e-53   Amborella trichopoda
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500          193   1e-53   Sorghum bicolor [broomcorn]
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...    193   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047104.1|  Os02g0552000                                       193   2e-53   
ref|XP_011092339.1|  PREDICTED: transmembrane 9 superfamily membe...    190   2e-53   
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...    192   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    192   2e-53   Solanum tuberosum [potatoes]
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              192   3e-53   
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    192   3e-53   
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...    192   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    192   4e-53   Solanum lycopersicum
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          192   4e-53   Sorghum bicolor [broomcorn]
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...    192   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...    191   1e-52   Sesamum indicum [beniseed]
ref|NP_001140443.1|  uncharacterized protein LOC100272502               178   1e-52   
emb|CDY33319.1|  BnaAnng04300D                                          189   2e-52   Brassica napus [oilseed rape]
gb|EPS65883.1|  hypothetical protein M569_08888                         189   2e-52   Genlisea aurea
emb|CDY44834.1|  BnaCnng11900D                                          189   3e-52   Brassica napus [oilseed rape]
emb|CDY46193.1|  BnaA01g23150D                                          189   3e-52   Brassica napus [oilseed rape]
ref|XP_003592977.1|  Transmembrane 9 superfamily protein member         186   4e-52   
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331             188   7e-52   
ref|XP_001785045.1|  predicted protein                                  188   7e-52   
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    188   9e-52   Cicer arietinum [garbanzo]
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    188   1e-51   Cicer arietinum [garbanzo]
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...    188   1e-51   Brachypodium distachyon [annual false brome]
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member         187   3e-51   Medicago truncatula
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520             183   6e-50   Selaginella moellendorffii
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...    182   1e-49   Sesamum indicum [beniseed]
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    181   4e-49   Tarenaya hassleriana [spider flower]
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991              178   6e-48   Coccomyxa subellipsoidea C-169
ref|XP_007509634.1|  predicted protein                                  172   6e-46   Bathycoccus prasinos
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...    170   4e-45   Nicotiana sylvestris
ref|XP_006385204.1|  hypothetical protein POPTR_0003s011002g            158   5e-45   
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3               168   2e-44   Auxenochlorella protothecoides
ref|XP_009631163.1|  PREDICTED: transmembrane 9 superfamily membe...    166   2e-44   
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...    166   6e-44   Solanum tuberosum [potatoes]
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...    166   1e-43   Nicotiana tomentosiformis
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511              165   2e-43   Chlorella variabilis
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...    164   4e-43   Solanum lycopersicum
gb|KDD76545.1|  endomembrane protein 70                                 161   4e-42   Helicosporidium sp. ATCC 50920
gb|KFO35950.1|  Phosphoinositide 3-kinase adapter protein 1             164   5e-42   Fukomys damarensis [Damara mole rat]
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231              160   7e-42   Volvox carteri f. nagariensis
emb|CAN77106.1|  hypothetical protein VITISV_037096                     159   2e-41   Vitis vinifera
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...    157   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009615816.1|  PREDICTED: transmembrane 9 superfamily membe...    148   4e-41   
ref|XP_009511961.1|  PREDICTED: transmembrane 9 superfamily member 3    150   7e-41   Phalacrocorax carbo [common cormorant]
gb|AAX96186.1|  Endomembrane protein 70                                 157   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3               155   6e-40   
ref|XP_009976834.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-40   Tauraco erythrolophus
dbj|BAG60075.1|  unnamed protein product                                149   9e-40   Homo sapiens [man]
ref|NP_001146830.1|  uncharacterized protein LOC100280437               143   2e-39   
gb|KJB47460.1|  hypothetical protein B456_008G027700                    153   2e-39   Gossypium raimondii
dbj|BAB55110.1|  unnamed protein product                                150   3e-39   Homo sapiens [man]
ref|XP_008057299.1|  PREDICTED: transmembrane 9 superfamily member 3    150   3e-39   Carlito syrichta
gb|KJB47461.1|  hypothetical protein B456_008G027700                    153   3e-39   Gossypium raimondii
gb|KHG20579.1|  Tm9sf3                                                  153   4e-39   Gossypium arboreum [tree cotton]
gb|KHG20578.1|  Tm9sf3                                                  153   5e-39   Gossypium arboreum [tree cotton]
ref|XP_009951614.1|  PREDICTED: transmembrane 9 superfamily member 3    150   9e-39   Leptosomus discolor
dbj|BAC11232.1|  unnamed protein product                                150   1e-38   Homo sapiens [man]
ref|XP_009478867.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-38   Pelecanus crispus
ref|XP_006756739.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-38   
ref|XP_003061693.1|  predicted protein                                  151   1e-38   Micromonas pusilla CCMP1545
ref|XP_008942019.1|  PREDICTED: transmembrane 9 superfamily member 3    149   2e-38   Merops nubicus
gb|KFU99061.1|  Transmembrane 9 superfamily member 3                    149   3e-38   Pterocles gutturalis
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...    150   3e-38   Neolamprologus brichardi [lyretail cichlid]
dbj|BAE91187.1|  unnamed protein product                                149   3e-38   Macaca fascicularis [crab eating macaque]
ref|NP_998554.1|  transmembrane 9 superfamily member 3 precursor        150   3e-38   Danio rerio [leopard danio]
ref|XP_007566966.1|  PREDICTED: transmembrane 9 superfamily member 3    150   3e-38   Poecilia formosa
ref|XP_007258750.1|  PREDICTED: transmembrane 9 superfamily membe...    150   3e-38   Astyanax mexicanus [blind cave fish]
gb|AAQ89178.1|  PATY245                                                 149   3e-38   Homo sapiens [man]
ref|XP_006263564.1|  PREDICTED: transmembrane 9 superfamily membe...    150   3e-38   
ref|XP_005795250.1|  PREDICTED: transmembrane 9 superfamily membe...    150   3e-38   Xiphophorus maculatus
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    150   3e-38   Stegastes partitus
ref|XP_008428273.1|  PREDICTED: transmembrane 9 superfamily membe...    150   4e-38   Poecilia reticulata
ref|XP_007615223.1|  PREDICTED: transmembrane 9 superfamily membe...    149   4e-38   
ref|XP_006630785.1|  PREDICTED: transmembrane 9 superfamily membe...    150   4e-38   Lepisosteus oculatus
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...    150   4e-38   Pundamilia nyererei
ref|XP_007902753.1|  PREDICTED: transmembrane 9 superfamily member 3    150   4e-38   Callorhinchus milii [Australian ghost shark]
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3    150   4e-38   Oreochromis niloticus
ref|XP_007441347.1|  PREDICTED: transmembrane 9 superfamily membe...    149   4e-38   
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...    150   4e-38   Maylandia zebra
ref|XP_003963762.1|  PREDICTED: transmembrane 9 superfamily membe...    150   4e-38   Takifugu rubripes [tiger puffer]
gb|AAH04799.2|  Tm9sf3 protein                                          149   4e-38   Mus musculus [mouse]
gb|AAH20959.2|  TM9SF3 protein                                          149   5e-38   Homo sapiens [man]
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Latimeria chalumnae
ref|XP_007080322.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   
ref|XP_002821075.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    150   5e-38   Pongo abelii [orang utan]
ref|XP_006157459.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   
ref|XP_004370030.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Trichechus manatus latirostris
ref|XP_003787418.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   
ref|XP_008428274.1|  PREDICTED: transmembrane 9 superfamily membe...    149   5e-38   Poecilia reticulata
ref|XP_008830212.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Nannospalax galili
emb|CDQ61092.1|  unnamed protein product                                150   5e-38   Oncorhynchus mykiss
ref|XP_008773120.1|  PREDICTED: transmembrane 9 superfamily membe...    150   5e-38   
gb|EHB07803.1|  Transmembrane 9 superfamily member 3                    149   5e-38   Heterocephalus glaber [naked mole rat]
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                    149   5e-38   Ophiophagus hannah
ref|XP_004409540.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Odobenus rosmarus divergens
ref|XP_010779545.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010712721.1|  PREDICTED: transmembrane 9 superfamily membe...    149   5e-38   Meleagris gallopavo [common turkey]
ref|XP_008932762.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   
ref|XP_010018436.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   Nestor notabilis
ref|XP_008948979.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    149   5e-38   Pan paniscus [bonobo]
ref|XP_003399780.1|  PREDICTED: transmembrane 9 superfamily membe...    150   5e-38   
ref|XP_004616433.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   Sorex araneus [Eurasian shrew]
ref|NP_064508.3|  transmembrane 9 superfamily member 3 precursor        150   5e-38   Homo sapiens [man]
ref|XP_011285801.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   
ref|XP_010712722.1|  PREDICTED: transmembrane 9 superfamily membe...    149   5e-38   Meleagris gallopavo [common turkey]
ref|XP_009916579.1|  PREDICTED: transmembrane 9 superfamily membe...    149   5e-38   Haliaeetus albicilla
ref|XP_006831254.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Chrysochloris asiatica
ref|XP_009705892.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   Cariama cristata
ref|XP_009470788.1|  PREDICTED: transmembrane 9 superfamily membe...    149   5e-38   Nipponia nippon
ref|XP_005153929.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   Melopsittacus undulatus
ref|XP_002509072.1|  predicted protein                                  150   5e-38   Micromonas commoda
gb|AAF98159.1|AF269150_1  transmembrane protein TM9SF3                  150   5e-38   Homo sapiens [man]
ref|XP_009669621.1|  PREDICTED: transmembrane 9 superfamily member 3    149   5e-38   Struthio camelus australis
ref|XP_005025241.1|  PREDICTED: transmembrane 9 superfamily membe...    149   5e-38   
ref|XP_001698971.1|  EMP/nonaspanin domain family protein               150   5e-38   Chlamydomonas reinhardtii
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3    150   5e-38   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006116276.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
gb|ELK35693.1|  Transmembrane 9 superfamily member 3                    149   6e-38   Myotis davidii
ref|NP_579930.1|  transmembrane 9 superfamily member 3 precursor        150   6e-38   Mus musculus [mouse]
gb|EPS62158.1|  hypothetical protein M569_12635                         149   6e-38   Genlisea aurea
gb|EDL41855.1|  mCG2375, isoform CRA_b                                  149   6e-38   Mus musculus [mouse]
ref|XP_010409948.1|  PREDICTED: transmembrane 9 superfamily membe...    149   6e-38   
ref|XP_009574595.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Fulmarus glacialis
ref|XP_007187499.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Balaenoptera acutorostrata scammoni
ref|XP_004427950.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_849773.1|  PREDICTED: transmembrane 9 superfamily member 3...    149   6e-38   Canis lupus familiaris [dogs]
ref|XP_004892237.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_005352330.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Microtus ochrogaster [prairie voles]
ref|XP_004580070.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Ochotona princeps [southern American pika]
gb|EPQ19715.1|  Transmembrane 9 superfamily member 3                    149   6e-38   Myotis brandtii
ref|XP_004680642.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Condylura cristata
gb|ELR54176.1|  Transmembrane 9 superfamily member 3                    149   6e-38   Bos mutus
ref|XP_007053441.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_002936010.2|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Xenopus tropicalis [western clawed frog]
ref|XP_007456252.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Lipotes vexillifer [baiji]
ref|XP_004268440.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Orcinus orca [Orca]
ref|XP_005407641.1|  PREDICTED: transmembrane 9 superfamily membe...    149   6e-38   
ref|XP_010896390.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Esox lucius
ref|XP_008641953.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_003255319.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|NP_001135200.1|  Transmembrane 9 superfamily member 3 precursor     149   6e-38   Salmo salar
ref|XP_005416571.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Geospiza fortis
ref|XP_005407639.1|  PREDICTED: transmembrane 9 superfamily membe...    149   6e-38   
gb|EMC79922.1|  Transmembrane 9 superfamily member 3                    149   6e-38   
ref|XP_005407638.1|  PREDICTED: transmembrane 9 superfamily membe...    149   6e-38   
ref|XP_006014905.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Alligator sinensis
ref|XP_004625742.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_008142341.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_004701094.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005637634.1|  PREDICTED: transmembrane 9 superfamily membe...    149   6e-38   
ref|XP_005984512.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_005520596.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_004020122.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
gb|KFP68674.1|  Transmembrane 9 superfamily member 3                    149   6e-38   Cariama cristata
ref|XP_005481354.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|XP_003479606.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
ref|NP_001180146.1|  transmembrane 9 superfamily member 3 precursor     149   6e-38   
ref|XP_008684538.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
gb|EHH19260.1|  hypothetical protein EGK_19936                          149   6e-38   
ref|XP_421629.4|  PREDICTED: transmembrane 9 superfamily member 3       149   6e-38   
ref|XP_010387883.1|  PREDICTED: transmembrane 9 superfamily member 3    149   6e-38   
gb|KFP32607.1|  Transmembrane 9 superfamily member 3                    149   6e-38   
ref|XP_007532693.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
ref|XP_007637675.1|  PREDICTED: transmembrane 9 superfamily membe...    149   7e-38   
ref|XP_004457032.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
ref|XP_004838634.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
ref|XP_001101439.1|  PREDICTED: transmembrane 9 superfamily membe...    149   7e-38   
ref|XP_006090050.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
ref|XP_005312131.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
gb|ERE79680.1|  transmembrane 9 superfamily member 3                    149   7e-38   
ref|XP_003223180.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
gb|AAF21983.1|  SM-11044 binding protein                                149   7e-38   
ref|XP_005407637.1|  PREDICTED: transmembrane 9 superfamily membe...    149   7e-38   
ref|XP_010969423.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
ref|XP_007654581.1|  PREDICTED: transmembrane 9 superfamily member 3    149   7e-38   
ref|XP_009966566.1|  PREDICTED: transmembrane 9 superfamily membe...    149   7e-38   
ref|XP_009470713.1|  PREDICTED: transmembrane 9 superfamily membe...    149   8e-38   
ref|XP_004077569.1|  PREDICTED: transmembrane 9 superfamily member 3    149   8e-38   
ref|XP_006992484.1|  PREDICTED: transmembrane 9 superfamily member 3    149   9e-38   
gb|KJB77693.1|  hypothetical protein B456_012G151500                    149   9e-38   
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3    149   9e-38   
gb|AAF67014.1|AF160213_1  endomembrane protein emp70 precursor is...    149   9e-38   
ref|XP_005025240.1|  PREDICTED: transmembrane 9 superfamily membe...    149   9e-38   
ref|XP_005885527.1|  PREDICTED: transmembrane 9 superfamily member 3    149   9e-38   
dbj|BAD90204.1|  mKIAA4036 protein                                      149   9e-38   
ref|XP_005048681.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_001917123.3|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    149   1e-37   
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
emb|CDQ58548.1|  unnamed protein product                                149   1e-37   
ref|XP_001662153.1|  AAEL012016-PA                                      149   1e-37   
ref|XP_011155183.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_001656277.1|  AAEL012833-PA                                      149   1e-37   
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_011303436.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...    149   1e-37   
ref|XP_011259429.1|  PREDICTED: transmembrane 9 superfamily member 3    149   1e-37   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3    148   1e-37   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...    149   1e-37   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...    149   1e-37   
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    149   1e-37   
gb|AIC62213.1|  TM9SF3                                                  147   1e-37   
ref|XP_002193887.2|  PREDICTED: transmembrane 9 superfamily member 3    149   2e-37   
ref|XP_008520069.1|  PREDICTED: transmembrane 9 superfamily member 3    149   3e-37   
ref|XP_008205311.1|  PREDICTED: transmembrane 9 superfamily membe...    147   3e-37   
dbj|BAA91362.1|  unnamed protein product                                147   3e-37   
ref|XP_004347030.2|  transmembrane protein TM9SF3                       147   3e-37   
ref|XP_009868517.1|  PREDICTED: transmembrane 9 superfamily member 3    147   3e-37   
gb|KFP89360.1|  Transmembrane 9 superfamily member 3                    147   3e-37   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3    147   4e-37   
ref|XP_001604363.1|  PREDICTED: transmembrane 9 superfamily membe...    147   4e-37   
ref|XP_008471864.1|  PREDICTED: transmembrane 9 superfamily membe...    146   5e-37   
ref|XP_011499824.1|  PREDICTED: transmembrane 9 superfamily member 3    147   5e-37   
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3    147   5e-37   
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    147   5e-37   
dbj|BAD12191.1|  SM-11044 binding protein                               145   6e-37   
ref|XP_004622652.1|  PREDICTED: transmembrane 9 superfamily membe...    139   6e-37   
ref|XP_008555159.1|  PREDICTED: transmembrane 9 superfamily member 3    146   9e-37   
ref|XP_009895972.1|  PREDICTED: transmembrane 9 superfamily member 3    146   1e-36   
ref|XP_008502202.1|  PREDICTED: transmembrane 9 superfamily member 3    145   1e-36   
ref|XP_004932208.1|  PREDICTED: transmembrane 9 superfamily membe...    146   1e-36   
ref|XP_001353740.2|  GA10420                                            145   1e-36   
ref|XP_002025369.1|  GL11985                                            145   1e-36   
ref|XP_001630700.1|  predicted protein                                  145   2e-36   
gb|ETN57960.1|  hypothetical protein AND_010453                         149   2e-36   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3    145   2e-36   
gb|EHJ69950.1|  putative endomembrane protein emp70                     145   3e-36   
ref|XP_004526831.1|  PREDICTED: transmembrane 9 superfamily membe...    145   3e-36   
ref|XP_011431162.1|  PREDICTED: transmembrane 9 superfamily membe...    144   4e-36   
gb|EFX85753.1|  hypothetical protein DAPPUDRAFT_313523                  144   4e-36   
ref|XP_008868877.1|  hypothetical protein H310_05822                    145   4e-36   
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative     144   6e-36   
gb|KFM73388.1|  Transmembrane 9 superfamily member 3                    144   6e-36   
gb|ETK76715.1|  hypothetical protein L915_16929                         144   6e-36   
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341             144   6e-36   
ref|XP_008895868.1|  hypothetical protein, variant 2                    144   6e-36   
ref|XP_008895867.1|  hypothetical protein PPTG_03848                    144   7e-36   
gb|ETK76717.1|  hypothetical protein, variant 2                         144   7e-36   
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515             144   7e-36   
gb|ETI36484.1|  hypothetical protein F443_17408                         144   7e-36   
gb|ETI36485.1|  hypothetical protein, variant 1                         144   7e-36   
ref|XP_002035457.1|  GM13907                                            143   8e-36   
emb|CBN79799.1|  conserved unknown protein                              138   8e-36   
ref|XP_002093812.1|  GE20545                                            143   9e-36   
ref|XP_002047393.1|  GJ11952                                            143   9e-36   
ref|NP_647979.1|  CG10590                                               143   1e-35   
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884              143   1e-35   
ref|XP_001984443.1|  GH15015                                            143   1e-35   
ref|XP_001957525.1|  GF10453                                            143   1e-35   
ref|XP_002062013.1|  GK16877                                            143   1e-35   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...    142   2e-35   
ref|XP_003737486.1|  PREDICTED: uncharacterized protein LOC100897570    145   2e-35   
ref|XP_002596465.1|  hypothetical protein BRAFLDRAFT_286243             142   2e-35   
ref|XP_004225719.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    142   2e-35   
emb|CDY14555.1|  BnaC03g49040D                                          142   2e-35   
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152              142   3e-35   
gb|ELU00390.1|  hypothetical protein CAPTEDRAFT_170344                  142   3e-35   
gb|EKC24508.1|  Transmembrane 9 superfamily member 3                    144   3e-35   
ref|XP_009009848.1|  hypothetical protein HELRODRAFT_184872             141   5e-35   
ref|XP_001972005.1|  GG14121                                            141   5e-35   
ref|XP_002007870.1|  GI13177                                            141   6e-35   
ref|XP_009827098.1|  hypothetical protein, variant                      141   7e-35   
ref|XP_002426886.1|  conserved hypothetical protein                     140   8e-35   
ref|XP_008614772.1|  hypothetical protein SDRG_10554                    140   1e-34   
gb|EEZ99577.1|  hypothetical protein TcasGA2_TC001563                   140   1e-34   
ref|XP_967117.1|  PREDICTED: transmembrane 9 superfamily member 3       140   1e-34   
gb|EWM22128.1|  transmembrane 9 superfamily member 3                    140   2e-34   
ref|XP_002156433.1|  PREDICTED: transmembrane 9 superfamily membe...    139   3e-34   
gb|KDO15767.1|  hypothetical protein SPRG_18692                         138   3e-34   
ref|XP_785201.2|  PREDICTED: transmembrane 9 superfamily member 3       139   3e-34   
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative         139   3e-34   
gb|KDR11018.1|  hypothetical protein L798_14383                         138   4e-34   
ref|XP_005768973.1|  hypothetical protein EMIHUDRAFT_60571              130   5e-34   
ref|XP_006819376.1|  PREDICTED: transmembrane 9 superfamily membe...    137   9e-34   
gb|ENN73181.1|  hypothetical protein YQE_10235                          137   1e-33   
gb|AEE63341.1|  unknown                                                 137   1e-33   
ref|XP_010732838.1|  PREDICTED: transmembrane 9 superfamily member 3    137   1e-33   
gb|KDO27371.1|  hypothetical protein SPRG_06957                         137   2e-33   
ref|XP_004990450.1|  endomembrane protein emp70                         137   2e-33   
gb|ELW49306.1|  Transmembrane 9 superfamily member 3                    136   3e-33   
emb|CCI39563.1|  unnamed protein product                                136   3e-33   
gb|EDL41854.1|  mCG2375, isoform CRA_a                                  135   4e-33   
emb|CCI39562.1|  unnamed protein product                                136   4e-33   
emb|CDW55076.1|  Transmembrane 9 superfamily                            135   4e-33   
emb|CCA19624.1|  endomembrane protein 70like protein putative           135   6e-33   
emb|CDS34226.1|  Transmembrane 9 superfamily                            134   3e-32   
dbj|GAA29282.2|  transmembrane 9 superfamily member 3                   133   3e-32   
ref|XP_009173090.1|  hypothetical protein T265_08898                    132   7e-32   
gb|EYB86903.1|  hypothetical protein Y032_0271g885                      129   8e-32   
emb|CEJ05344.1|  hypothetical protein RMCBS344292_19287                 130   1e-31   
ref|XP_001746206.1|  hypothetical protein                               134   1e-31   
gb|EYB86905.1|  hypothetical protein Y032_0271g885                      129   1e-31   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                    132   1e-31   
gb|EYB86904.1|  hypothetical protein Y032_0271g885                      129   1e-31   
emb|CDS07558.1|  hypothetical protein LRAMOSA01507                      132   1e-31   
gb|ERG85277.1|  transmembrane 9 superfamily member 3                    131   2e-31   
emb|CEG68095.1|  hypothetical protein RMATCC62417_04417                 129   2e-31   
emb|CEJ03838.1|  hypothetical protein RMCBS344292_17813                 129   2e-31   
emb|CDH93341.1|  Y41D4A.4, isoform c                                    129   7e-31   
gb|KFU99734.1|  Transmembrane 9 superfamily member 3                    122   1e-30   
emb|CEG80626.1|  hypothetical protein RMATCC62417_14930                 129   1e-30   
ref|NP_500130.1|  Protein Y41D4A.4                                      129   1e-30   
emb|CDH93340.1|  Y41D4A.4, isoform b                                    129   1e-30   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                      129   1e-30   
emb|CDQ00788.1|  Protein Bm6514, isoform c                              129   2e-30   
gb|EJW85205.1|  endomembrane protein emp70                              128   2e-30   
ref|XP_003094144.1|  hypothetical protein CRE_13729                     127   3e-30   
ref|XP_002634585.1|  Hypothetical protein CBG08396                      127   4e-30   
gb|EEE57172.1|  hypothetical protein OsJ_07106                          125   2e-29   
gb|EPB84661.1|  hypothetical protein HMPREF1544_08604                   126   2e-29   
ref|XP_003143038.1|  endomembrane protein emp70                         125   3e-29   
emb|CEP16327.1|  hypothetical protein                                   125   3e-29   
ref|XP_002679262.1|  predicted protein                                  125   3e-29   
emb|CDS23908.1|  Transmembrane 9 superfamily                            125   4e-29   
emb|CDI96724.1|  Transmembrane 9 superfamily                            125   4e-29   
gb|KFP99383.1|  Transmembrane 9 superfamily member 3                    122   8e-29   
gb|EUB64714.1|  Transmembrane 9 superfamily member                      124   1e-28   
gb|KFQ32916.1|  Transmembrane 9 superfamily member 3                    122   1e-28   
gb|EIE90684.1|  hypothetical protein RO3G_15395                         123   2e-28   
gb|KFQ54713.1|  Transmembrane 9 superfamily member 3                    122   2e-28   
dbj|BAE27875.1|  unnamed protein product                                122   2e-28   
gb|KFZ51498.1|  Transmembrane 9 superfamily member 3                    122   2e-28   
gb|KFV52836.1|  Transmembrane 9 superfamily member 3                    122   2e-28   
ref|XP_007122871.1|  PREDICTED: transmembrane 9 superfamily membe...    120   2e-28   
gb|KFQ90694.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFW76816.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
ref|XP_002290902.1|  endomembrane protein EMP70 precusor                122   3e-28   
gb|EFB24098.1|  hypothetical protein PANDA_005202                       122   3e-28   
gb|EMP41799.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFO94520.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFO54227.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFV79427.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFM06419.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFP38896.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
gb|KFV91617.1|  Transmembrane 9 superfamily member 3                    122   3e-28   
ref|XP_001950058.1|  PREDICTED: transmembrane 9 superfamily member 3    122   3e-28   
gb|EOA97287.1|  Transmembrane 9 superfamily member 3                    122   4e-28   
gb|ERE79681.1|  transmembrane 9 superfamily member 3                    122   5e-28   
ref|XP_006749965.1|  PREDICTED: transmembrane 9 superfamily member 3    119   8e-28   
ref|XP_002178644.1|  predicted protein                                  121   8e-28   
ref|XP_004320666.1|  PREDICTED: transmembrane 9 superfamily member 3    120   1e-27   
ref|XP_314301.3|  AGAP004882-PA                                         120   1e-27   
gb|KFV65167.1|  Transmembrane 9 superfamily member 3                    118   7e-27   
ref|XP_006679870.1|  hypothetical protein BATDEDRAFT_25752              116   2e-26   
gb|KFH64844.1|  hypothetical protein MVEG_09573                         117   4e-26   
gb|KHJ41501.1|  endomembrane protein 70                                 115   6e-26   
emb|CBY17963.1|  unnamed protein product                                115   8e-26   
gb|KFD51698.1|  hypothetical protein M513_07394                         113   6e-25   
gb|KFP08579.1|  Transmembrane 9 superfamily member 3                    111   2e-24   
emb|CEF59928.1|  Nonaspanin (TM9SF) family-containing protein           109   1e-23   
ref|XP_002784348.1|  conserved hypothetical protein                     107   5e-23   
emb|CBK24710.2|  unnamed protein product                                100   4e-21   
gb|ETK76718.1|  hypothetical protein, variant 3                         100   1e-20   
ref|XP_008895869.1|  hypothetical protein, variant 3                    100   1e-20   
gb|ETI36486.1|  hypothetical protein, variant 2                         100   2e-20   
ref|XP_002083749.1|  GD13184                                            100   2e-20   
gb|ADE75730.1|  unknown                                               91.7    3e-20   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    100   3e-20   
dbj|GAD95703.1|  multispanning membrane protein                       99.4    1e-19   
gb|ABR26036.1|  transmembrane 9 superfamily protein member 1 prec...  93.6    1e-19   
gb|KJB15314.1|  hypothetical protein B456_002G170500                  95.5    1e-19   
gb|KJB15315.1|  hypothetical protein B456_002G170500                  95.5    1e-19   
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...  97.1    2e-19   
dbj|BAH20237.1|  AT2G01970                                            95.1    2e-19   
gb|AFK34316.1|  unknown                                               95.5    2e-19   
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...  97.4    2e-19   
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...  97.4    2e-19   
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...  97.1    2e-19   
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like  96.7    4e-19   
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b       96.7    4e-19   
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg           96.3    4e-19   
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like  96.7    4e-19   
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b       96.7    4e-19   
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g           96.7    4e-19   



>dbj|BAF01745.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=136

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -2

Query  705  LASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHW  526
            L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHW
Sbjct  2    LLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHW  61

Query  525  QWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLG  346
            QWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LG
Sbjct  62   QWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLG  121

Query  345  SNLFVRRIYRNIKCD  301
            SNLFVRRIYRNIKCD
Sbjct  122  SNLFVRRIYRNIKCD  136



>ref|NP_001182857.1| uncharacterized protein LOC100501115 precursor [Zea mays]
 gb|ACR34922.1| unknown [Zea mays]
Length=195

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  59   GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  118

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  119  HWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  178

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  179  LGSTLFVRRIYRNIKCD  195



>gb|KJB47459.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=400

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  264  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  323

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY+YS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  324  HWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  383

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  384  LGSNLFVRRIYRNIKCD  400



>gb|KJB79239.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=461

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  325  GGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  384

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  385  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  444

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  445  LGSNLFVRRIYRNIKCD  461



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  572  LGSNLFVRRIYRNIKCD  588



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  507  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  572  LGSNLFVRRIYRNIKCD  588



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  456  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  515

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYS+YYY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+GF
Sbjct  516  HWQWTSFFSAASTAIYVYLYSVYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGF  575

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  576  LGSNLFVRRIYRNIKCD  592



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY+ KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYHAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  507  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>gb|AAL07091.2| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=461

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  325  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  384

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  385  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  444

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  445  LGSNLFVRRIYRNIKCD  461



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  460  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  519

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  520  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  579

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  580  LGSNLFVRRIYRNIKCD  596



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  466  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  525

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  526  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  585

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  586  LGSNLFVRRIYRNIKCD  602



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  462  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  521

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  522  HWQWTSFFSAASTAVYVYLYSVYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  581

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  582  LGSNLFVRRIYRNIKCD  598



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  496  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  555

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY YSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  556  HWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  615

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  616  LGSNLFVRRIYRNIKCD  632



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  446  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENY  505

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  506  HWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  565

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  566  LGSNLFVRRIYRNIKCD  582



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  569  LGSNLFVRRIYRNIKCD  585



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  569  LGSNLFVRRIYRNIKCD  585



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  569  LGSNLFVRRIYRNIKCD  585



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  457  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  516

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY YSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  517  HWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  576

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  577  LGSNLFVRRIYRNIKCD  593



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  494  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  553

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  554  HWQWTSFFSAASTAVYVYLYSVYYYFVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  613

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  614  LGSNLFVRRIYRNIKCD  630



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  570  LGSNLFVRRIYRNIKCD  586



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  456  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  515

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  516  HWQWTSFFSAASTAIYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  575

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  576  LGSNLFVRRIYRNIKCD  592



>gb|AFX67030.1| endomembrane protein emp70, partial [Solanum tuberosum]
Length=346

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  210  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  269

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSA STAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  270  HWQWTSFFSAFSTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  329

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LFVRRIYRNIKCD
Sbjct  330  LGSHLFVRRIYRNIKCD  346



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  569  LGSNLFVRRIYRNIKCD  585



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  507  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  514  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  574  LGSNLFVRRIYRNIKCD  590



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  514  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  574  LGSNLFVRRIYRNIKCD  590



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  509  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  569  LGSNLFVRRIYRNIKCD  585



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  457  GGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  516

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  517  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  576

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  577  LGSNLFVRRIYRNIKCD  593



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  510  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  570  LGSNLFVRRIYRNIKCD  586



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  448  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  507

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  508  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  567

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  568  LGSNLFVRRIYRNIKCD  584



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  510  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  570  LGSNLFVRRIYRNIKCD  586



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  448  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  507

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  508  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  567

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  568  LGSNLFVRRIYRNIKCD  584



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  528  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  587

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY YSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  588  HWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  647

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  648  LGSNLFVRRIYRNIKCD  664



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  569  LGSNLFVRRIYRNIKCD  585



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  514  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIY+NIKCD
Sbjct  574  LGSNLFVRRIYKNIKCD  590



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  570  LGSTLFVRRIYRNIKCD  586



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score =   197 bits (501),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  504  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  563

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  564  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  623

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  624  LGSNLFVRRIYRNIKCD  640



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSN+FVRRIYRNIKCD
Sbjct  570  LGSNMFVRRIYRNIKCD  586



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  570  LGSTLFVRRIYRNIKCD  586



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSN+FVRRIYRNIKCD
Sbjct  570  LGSNMFVRRIYRNIKCD  586



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  512  HWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  572  LGSTLFVRRIYRNIKCD  588



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY+YS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  514  HWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  574  LGSNLFVRRIYRNIKCD  590



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTAVYVYLYSIYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIY+NIKCD
Sbjct  570  LGSNLFVRRIYKNIKCD  586



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFSSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  572  LGSNLFVRRIYRNIKCD  588



>ref|XP_006392091.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29377.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=471

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  335  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  394

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  395  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  454

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  455  LGSNLFVRRIYRNIKCD  471



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  529  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  588

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  589  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  648

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  649  LGSNLFVRRIYRNIKCD  665



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  515  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  575  LGSNLFVRRIYRNIKCD  591



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKM+GFFQ+SFYFGYT+MFCLGLGILCGAVGF
Sbjct  514  HWQWTSFFSAASTAIYVYLYSIYYYHVKTKMTGFFQISFYFGYTMMFCLGLGILCGAVGF  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIY+NIKCD
Sbjct  574  LGSNLFVRRIYKNIKCD  590



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  514  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  574  LGSTLFVRRIYRNIKCD  590



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  445  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  504

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  505  HWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  564

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  565  LGSTLFVRRIYRNIKCD  581



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY++KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  507  HWQWTSFFSAASTALYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  567  LGSTLFVRRIYRNIKCD  583



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  435  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENY  494

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  495  HWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  554

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  555  LGSTLFVRRIYRNIKCD  571



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LFVRRIYRNIKCD
Sbjct  572  LGSHLFVRRIYRNIKCD  588



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFSSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  572  LGSNLFVRRIYRNIKCD  588



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LFVRRIYRNIKCD
Sbjct  572  LGSHLFVRRIYRNIKCD  588



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  571  LGSTLFVRRIYRNIKCD  587



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  478  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  537

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  538  HWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  597

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  598  LGSNLFVRRIYRNIKCD  614



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  509  HWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  569  LGSTLFVRRIYRNIKCD  585



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  446  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENY  505

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HW+WTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  506  HWRWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  565

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  566  LGSNLFVRRIYRNIKCD  582



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  512  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  572  LGSNLFVRRIYRNIKCD  588



>emb|CDY54577.1| BnaCnng27330D [Brassica napus]
Length=513

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  377  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENY  436

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  437  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  496

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  497  LGSNLFVRRIYRNIKCD  513



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  457  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  516

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  517  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  576

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIY+NIKCD
Sbjct  577  LGSNLFVRRIYKNIKCD  593



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  446  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENY  505

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HW+WTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  506  HWRWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  565

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  566  LGSNLFVRRIYRNIKCD  582



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  570  LGSTLFVRRIYRNIKCD  586



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  509  HWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  569  LGSTLFVRRIYRNIKCD  585



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAAST++YVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFC+GLGILCGAVG+
Sbjct  507  HWQWTSFFSAASTSLYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCMGLGILCGAVGY  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  613  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFMILMIVTVCVTIVGTYFLLNAENY  672

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA YVY YSIYYYY+KTKMSGFFQ SFYFGYTLM CLGLGILCGAVGF
Sbjct  673  HWQWTSFFSAASTAFYVYFYSIYYYYMKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGF  732

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  733  LGSNLFVRRIYRNIKCD  749



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  456  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  515

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  516  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  575

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSN+FVRRIYRNIKCD
Sbjct  576  LGSNMFVRRIYRNIKCD  592



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  457  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  516

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  517  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  576

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  577  LGSTLFVRRIYRNIKCD  593



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  422  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  481

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  482  HWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  541

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS +FVRRIYRNIKCD
Sbjct  542  LGSTMFVRRIYRNIKCD  558



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  509  HWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  569  LGSTLFVRRIYRNIKCD  585



>ref|XP_001785033.1| predicted protein [Physcomitrella patens]
 gb|EDQ50148.1| predicted protein, partial [Physcomitrella patens]
Length=325

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFW YKVYYVYGFMLLVF+IL IVTVCVTIVGTYFLLNAENY
Sbjct  189  GGLLPFGSIFIEMYFVFTSFWQYKVYYVYGFMLLVFIILTIVTVCVTIVGTYFLLNAENY  248

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA YVYLYS+YY+Y+KTKMSGFFQ+SFYFGYTLMFCLGLGI CGAVG+
Sbjct  249  HWQWTSFLSAASTAGYVYLYSVYYFYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGY  308

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS++FVRRIYRNIKCD
Sbjct  309  LGSSMFVRRIYRNIKCD  325



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  458  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  517

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  518  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  577

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  578  LGSTLFVRRIYRNIKCD  594



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  456  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  515

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  516  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  575

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  576  LGSTLFVRRIYRNIKCD  592



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  510  HWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS +FVRRIYRNIKCD
Sbjct  570  LGSTMFVRRIYRNIKCD  586



>emb|CDY12876.1| BnaA09g13980D [Brassica napus]
Length=564

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  428  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  487

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  488  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  547

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  548  LGSNLFVRRIYRNIKCD  564



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYV+LYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  511  HWQWTSFFSAASTAVYVFLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  571  LGSTLFVRRIYRNIKCD  587



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  459  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  518

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  519  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  578

Query  351  LGSNLFVRRIYRNIKCD  301
            +GS LFVRRIYRNIKCD
Sbjct  579  VGSTLFVRRIYRNIKCD  595



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  480  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  539

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  540  HWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  599

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS +FVRRIYRNIKCD
Sbjct  600  LGSTMFVRRIYRNIKCD  616



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  515  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  575  LGSNLFVRRIYRNIKCD  591



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  416  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  475

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  476  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  535

Query  351  LGSNLFVRRIYRNIKCD  301
            +GS LFVRRIYRNIKCD
Sbjct  536  VGSTLFVRRIYRNIKCD  552



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  515  HWQWTSFFSAASTAIYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  575  LGSTLFVRRIYRNIKCD  591



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  458  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  517

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  518  HWQWTSFFSAASTAIYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  577

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  578  LGSNLFVRRIYRNIKCD  594



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  459  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  518

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY+YSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  519  HWQWTSFFSAASTAVYVYIYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  578

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  579  LGSNLFVRRIYRNIKCD  595



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  444  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  503

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  504  HWQWTSFLSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  563

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  564  LGSTLFVRRIYRNIKCD  580



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAAST+VYVYLYSIYYYY+KTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  513  HWQWTSFFSAASTSVYVYLYSIYYYYMKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYY+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  514  HWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  574  LGSNLFVRRIYRNIKCD  590



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  458  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  517

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  518  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  577

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  578  LGSNLFVRRIYRNIKCD  594



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  461  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  520

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  521  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  580

Query  351  LGSNLFVRRIYRNIKCD  301
            +GS LFVRRIYRNIKCD
Sbjct  581  VGSTLFVRRIYRNIKCD  597



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYY+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYY+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  514  HWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  574  LGSNLFVRRIYRNIKCD  590



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYY+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  511  HWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  571  LGSNLFVRRIYRNIKCD  587



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAAST+VYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  515  HWQWTSFFSAASTSVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  575  LGSNLFVRRIYRNIKCD  591



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  515  HWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS  FVRRIYRNIKCD
Sbjct  575  LGSTFFVRRIYRNIKCD  591



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  434  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENY  493

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  494  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  553

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  554  LGSNLFVRRIYRNIKCD  570



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAAST+VYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGF
Sbjct  513  HWQWTSFFSAASTSVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGF  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  459  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  518

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+
Sbjct  519  HWQWTSFFSAASTAIYVYLYSIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGY  578

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  579  LGSKLFVRRIYRNIKCD  595



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  512  HWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  572  LGSTLFVRRIYRNIKCD  588



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  513  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  573  LGSNLFVRRIYRNIKCD  589



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  569  LGSTLFVRRIYRNIKCD  585



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  462  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  521

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  522  HWQWTSFLSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  581

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  582  LGSTLFVRRIYRNIKCD  598



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  432  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  491

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  492  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  551

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  552  LGSTLFVRRIYRNIKCD  568



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENY
Sbjct  491  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENY  550

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  551  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGF  610

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  611  LGSNLFVRRIYRNIKCD  627



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  569  LGSTLFVRRIYRNIKCD  585



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ  FYFGYTLMFCLGLGILCGAVG+
Sbjct  514  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTGFYFGYTLMFCLGLGILCGAVGY  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  574  LGSTLFVRRIYRNIKCD  590



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  449  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  509  HWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  569  LGSTLFVRRIYRNIKCD  585



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  515  HWQWTSFLSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  575  LGSTLFVRRIYRNIKCD  591



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  514  HWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  574  LGSTLFVRRIYRNIKCD  590



>ref|XP_011092339.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Sesamum 
indicum]
Length=460

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIV  YFLLNAENY
Sbjct  324  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVSIYFLLNAENY  383

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY YSIYYYYVKTKMSG FQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  384  HWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGY  443

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSN+FVRRIYRNIKCD
Sbjct  444  LGSNMFVRRIYRNIKCD  460



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVT+CVTIVG+YFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTICVTIVGSYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  515  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LF+RRIYRNIKCD
Sbjct  575  LGSSLFIRRIYRNIKCD  591



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSA STAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGF
Sbjct  512  HWQWTSFFSAFSTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LFVRRIYRNIKCD
Sbjct  572  LGSHLFVRRIYRNIKCD  588



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  456  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  515

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  516  HWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  575

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  576  LGSTLFVRRIYRNIKCD  592



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  460  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  519

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  520  HWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  579

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  580  LGSTLFVRRIYRNIKCD  596



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVG YFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTMCVTIVGAYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYY+KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  512  HWQWTSFFSAASTAVYVYLYSVYYYYMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS +FVRRIYRNIKCD
Sbjct  572  LGSTMFVRRIYRNIKCD  588



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSA STAVYVYLYS+YYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGF
Sbjct  512  HWQWTSFFSAFSTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGF  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LFVRRIYRNIKCD
Sbjct  572  LGSHLFVRRIYRNIKCD  588



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENY
Sbjct  458  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENY  517

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+
Sbjct  518  HWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGY  577

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  578  LGSTLFVRRIYRNIKCD  594



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVG YFLLNAENY
Sbjct  499  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTMCVTIVGAYFLLNAENY  558

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYS+YYYY+KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  559  HWQWTSFFSAASTAVYVYLYSVYYYYMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  618

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS +FVRRIYRNIKCD
Sbjct  619  LGSTMFVRRIYRNIKCD  635



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIV  YFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVSIYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVY YSIYYYYVKTKMSG FQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  512  HWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSN+FVRRIYRNIKCD
Sbjct  572  LGSNMFVRRIYRNIKCD  588



>ref|NP_001140443.1| uncharacterized protein LOC100272502 [Zea mays]
 gb|ACF83850.1| unknown [Zea mays]
Length=125

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -2

Query  675  MYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAAS  496
            MYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAAS
Sbjct  1    MYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAAS  60

Query  495  TAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYR  316
            TAVYVYLYSIYYY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYR
Sbjct  61   TAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYR  120

Query  315  NIKCD  301
            NIKCD
Sbjct  121  NIKCD  125



>emb|CDY33319.1| BnaAnng04300D [Brassica napus]
Length=544

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -2

Query  708  RLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYH  529
            R     +IFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYH
Sbjct  409  RPIPEKNIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYH  468

Query  528  WQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFL  349
            WQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFL
Sbjct  469  WQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFL  528

Query  348  GSNLFVRRIYRNIKCD  301
            GSNLFVRRIYRNIKCD
Sbjct  529  GSNLFVRRIYRNIKCD  544



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILI+VTVCVTIVGTYFLLNAENY
Sbjct  422  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIVVTVCVTIVGTYFLLNAENY  481

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YV  YS+YYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  482  HWQWTSFFSAASTALYVLFYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  541

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS+LFV+RIYRNIK D
Sbjct  542  LGSDLFVKRIYRNIKLD  558



>emb|CDY44834.1| BnaCnng11900D [Brassica napus]
Length=547

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -2

Query  708  RLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYH  529
            R     +IFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYH
Sbjct  412  RPIPEKNIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYH  471

Query  528  WQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFL  349
            WQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFL
Sbjct  472  WQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFL  531

Query  348  GSNLFVRRIYRNIKCD  301
            GSNLFVRRIYRNIKCD
Sbjct  532  GSNLFVRRIYRNIKCD  547



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -2

Query  708  RLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYH  529
            R     +IFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYH
Sbjct  440  RPIPEKNIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYH  499

Query  528  WQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFL  349
            WQWTSFFSAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFL
Sbjct  500  WQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFL  559

Query  348  GSNLFVRRIYRNIKCD  301
            GSNLFVRRIYRNIKCD
Sbjct  560  GSNLFVRRIYRNIKCD  575



>ref|XP_003592977.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=446

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  310  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  369

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            +WQWTSF SAAST VYVYLYSIYYYYVKTKMSGFFQ SFYFGYT MFCLGLGILCGAVG 
Sbjct  370  NWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGH  429

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  430  LGSNLFVRRIYRNIKCD  446



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA YVYLYS+YYY++KTKMSGFFQ SFYFGYTLM C+GLG LCGAVG+
Sbjct  511  HWQWTSFFSAASTAAYVYLYSVYYYFMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS++FVRRIYRNIKCD
Sbjct  571  LGSSVFVRRIYRNIKCD  587



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFW YKVYYVYGFMLLVF+IL IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWQYKVYYVYGFMLLVFIILTIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF SAASTA YVYLYS+YY+Y+KTKMSGFFQ+SFYFGYTLMFCLGLGI CGAVG+
Sbjct  514  HWQWTSFLSAASTAGYVYLYSVYYFYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGY  573

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS++FVRRIYRNIKCD
Sbjct  574  LGSSMFVRRIYRNIKCD  590



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            +WQWTSF SAAST VYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG 
Sbjct  507  NWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGH  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            +WQWTSF SAAST VYVYLYSIYYYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG 
Sbjct  507  NWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGH  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVT+CVTIVGTYFLLNAENY
Sbjct  452  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLIVTICVTIVGTYFLLNAENY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTAVYVYLYSIYYY VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+
Sbjct  512  HWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS LFVRRIYRNIKCD
Sbjct  572  LGSTLFVRRIYRNIKCD  588



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENY  506

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            +WQWTSF SAAST VYVYLYSIYYYYVKTKMSGFFQ SFYFGYT MFCLGLGILCGAVG 
Sbjct  507  NWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGH  566

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  567  LGSNLFVRRIYRNIKCD  583



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  450  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLIVTVCVTIVGTYFLLNAENY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA YVYLYS+YYY++KTKMSGFFQ SFYFGYTLM C+GLG LCGAVG+
Sbjct  510  HWQWTSFFSAASTAAYVYLYSVYYYFMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS++FVRRIYRNIKCD
Sbjct  570  LGSSVFVRRIYRNIKCD  586



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 126/137 (92%), Gaps = 5/137 (4%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGT     AENY
Sbjct  447  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGT-----AENY  501

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSFFSAASTA+YVY YSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+
Sbjct  502  HWQWTSFFSAASTALYVYFYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGY  561

Query  351  LGSNLFVRRIYRNIKCD  301
            LGSNLFVRRIYRNIKCD
Sbjct  562  LGSNLFVRRIYRNIKCD  578



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 130/143 (91%), Gaps = 6/143 (4%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYF------L  550
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYF      L
Sbjct  456  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFAXXXXXL  515

Query  549  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGIL  370
            LNAENY+WQWTSF SAASTAVYVYLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGIL
Sbjct  516  LNAENYNWQWTSFLSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  575

Query  369  CGAVGFLGSNLFVRRIYRNIKCD  301
            CGAVG++GSNLFVRRIYRNIKCD
Sbjct  576  CGAVGYMGSNLFVRRIYRNIKCD  598



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLIL I+TVCVTIVGTYFLLNAENY
Sbjct  474  GGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILAIMTVCVTIVGTYFLLNAENY  533

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWTSF +AASTA+YV+LY+++Y++VKTKM+GFFQ  FYFGYTLMFCLGL I+ GA+G+
Sbjct  534  HWQWTSFCAAASTALYVFLYAVHYFFVKTKMTGFFQTCFYFGYTLMFCLGLSIMTGALGY  593

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS +FVRRIYRNIKCD
Sbjct  594  LGSAIFVRRIYRNIKCD  610



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIE YFVFTS WNYKVYYVYGF LLVF+IL+IVT+CVT+VGTYFLLNAENY
Sbjct  493  GGLLPFGSIFIETYFVFTSIWNYKVYYVYGFFLLVFMILMIVTLCVTVVGTYFLLNAENY  552

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HW WTSF SAASTA YVY+YSIYY+  KTKM+GFFQ  FYFGYT MFCLGLG++CGAVG+
Sbjct  553  HWHWTSFISAASTAFYVYVYSIYYFIFKTKMTGFFQTCFYFGYTAMFCLGLGLMCGAVGY  612

Query  351  LGSNLFVRRIYRNIKCD  301
             G+N FVRRIYRNIKCD
Sbjct  613  FGANAFVRRIYRNIKCD  629



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYY-VYGFMllvfliliivtvcvtiVGTYFLLNAEN  535
            G L   GSIFIEMYF+F+SFW Y VYY VYGFMLLVF+ILIIVTVCVTIV TYFLLNAEN
Sbjct  446  GGLLPFGSIFIEMYFIFSSFWTYMVYYHVYGFMLLVFIILIIVTVCVTIVATYFLLNAEN  505

Query  534  YHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVG  355
            YHWQWTSFFSAASTA YVYLYSIYYYY KT+M G FQ S YFGYTLMFCLGLG LCGAVG
Sbjct  506  YHWQWTSFFSAASTAFYVYLYSIYYYYAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVG  565

Query  354  FLGSNLFVRRIYRNIKCD  301
            ++GSNLFVRRI+ NIKCD
Sbjct  566  YIGSNLFVRRIFSNIKCD  583



>ref|XP_006385204.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
 gb|ERP63001.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
Length=113

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -2

Query  639  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  460
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  1    VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  60

Query  459  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  301
            +YVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  61   FYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  113



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGF LLVFLILIIVT+CVTIV +YFLLNAENY
Sbjct  455  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFFLLVFLILIIVTICVTIVASYFLLNAENY  514

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HW WTSF + AST++YV+LYS++Y++ KTKM+GFFQ +FYFGYTLMFC+GL ++CGAVG 
Sbjct  515  HWHWTSFGAGASTSLYVFLYSVHYFFWKTKMTGFFQTAFYFGYTLMFCVGLSVMCGAVGH  574

Query  351  LGSNLFVRRIYRNIKCD  301
            LG+ +FVRRIYRNIKCD
Sbjct  575  LGAGVFVRRIYRNIKCD  591



>ref|XP_009631163.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=468

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYY-VYGFMllvfliliivtvcvtiVGTYFLLNAEN  535
            G L   GSIFIEMYF+F+SFW Y VYY VYGFMLLVF+ILIIVTVCVTIV TYFLL+AEN
Sbjct  331  GGLLPFGSIFIEMYFIFSSFWTYMVYYHVYGFMLLVFIILIIVTVCVTIVATYFLLSAEN  390

Query  534  YHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVG  355
            YHWQWTSF+SAASTA YVYLYSIYYYY KT+M G FQ S YFGYTLMFCLGLG LCGAVG
Sbjct  391  YHWQWTSFYSAASTACYVYLYSIYYYYAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVG  450

Query  354  FLGSNLFVRRIYRNIKCD  301
            ++GSNLFVRRI+ NIKCD
Sbjct  451  YIGSNLFVRRIFSNIKCD  468



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKV-YYVYGFMllvfliliivtvcvtiVGTYFLLNAEN  535
            G L    SIFIEMY +F SFW Y V YYVYGF+LLVF++LIIVTVCVTIVGTY+LLNAEN
Sbjct  447  GGLLPFASIFIEMYCIFASFWTYMVHYYVYGFLLLVFIVLIIVTVCVTIVGTYYLLNAEN  506

Query  534  YHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVG  355
            YHWQWTSFFSAASTA+YVYLY+IYYY+ KT MSG  Q SFYFGYTLMFCLG+GILCGAVG
Sbjct  507  YHWQWTSFFSAASTALYVYLYAIYYYHAKTSMSGLLQTSFYFGYTLMFCLGVGILCGAVG  566

Query  354  FLGSNLFVRRIYRNIKCD  301
            +LGSNLF+RRI+ NIKCD
Sbjct  567  YLGSNLFIRRIFGNIKCD  584



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYY-VYGFMllvfliliivtvcvtiVGTYFLLNAEN  535
            G L   GSIFIEMYF+F+SFW Y VYY VYGFMLLVF+ILIIVTVCVTIV TYFLL+AEN
Sbjct  446  GGLLPFGSIFIEMYFIFSSFWTYMVYYHVYGFMLLVFIILIIVTVCVTIVATYFLLSAEN  505

Query  534  YHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVG  355
            YHWQWTSF+SAASTA YVYLYSIYYYY KT+M G FQ S YFGYTLMFCLGLG LCGAVG
Sbjct  506  YHWQWTSFYSAASTACYVYLYSIYYYYAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVG  565

Query  354  FLGSNLFVRRIYRNIKCD  301
            ++GSNLFVRRI+ NIKCD
Sbjct  566  YIGSNLFVRRIFSNIKCD  583



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYF+FTSFWNYKVYYVYGF LLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  453  GGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFFLLVFLILLIVTVCVTIVGTYFLLNAENY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HW WT+F + AST++YV LYS++Y+ +KTKM+GFFQ +FYFGYTLMFCLGL I+CGA+G+
Sbjct  513  HWHWTAFSAGASTSLYVMLYSVHYFVMKTKMTGFFQTAFYFGYTLMFCLGLSIMCGAIGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            LGS  FVRRI+RN+K D
Sbjct  573  LGSLAFVRRIFRNVKVD  589



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKV-YYVYGFMllvfliliivtvcvtiVGTYFLLNAEN  535
            G L    SIF EMY++F SFW Y + YYVYGF+LLVF++LIIVT+CVTIVGTY+LLNAEN
Sbjct  447  GGLLPFASIFTEMYYIFASFWTYMLHYYVYGFLLLVFIVLIIVTICVTIVGTYYLLNAEN  506

Query  534  YHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVG  355
            Y+WQWTSFFSAASTA+YVYLY+IYYY+ KTKMSG  Q SFYFGYTLMFCLG+GILCGAVG
Sbjct  507  YNWQWTSFFSAASTALYVYLYAIYYYHSKTKMSGLLQTSFYFGYTLMFCLGVGILCGAVG  566

Query  354  FLGSNLFVRRIYRNIKCD  301
            +LGSNLF+RRI+ NIKCD
Sbjct  567  YLGSNLFIRRIFGNIKCD  584



>gb|KDD76545.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=572

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYFVFTSFWNYKVYYVYGF LLVF+IL++VT+CVT+V TYFLLNAENY
Sbjct  436  GGVLPFGSIFIEMYFVFTSFWNYKVYYVYGFFLLVFIILLVVTLCVTVVATYFLLNAENY  495

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HW W SF + AST++YV+LYS++Y++VKTKM+GFFQ +FYFGYTLMFC+GL ++CG+VG+
Sbjct  496  HWHWASFGAGASTSIYVWLYSVHYFFVKTKMTGFFQTTFYFGYTLMFCIGLSVMCGSVGY  555

Query  351  LGSNLFVRRIYRNIKCD  301
            LG++ FVRRIY+NIKCD
Sbjct  556  LGASAFVRRIYKNIKCD  572



>gb|KFO35950.1| Phosphoinositide 3-kinase adapter protein 1 [Fukomys damarensis]
Length=1303

 Score =   164 bits (416),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711   GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
             G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  1167  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  1226

Query  531   HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
              WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  1227  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  1286

Query  351   LGSNLFVRRIYRNIKCD  301
             +G++ FVR+IY N+K D
Sbjct  1287  MGTSAFVRKIYTNVKID  1303



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYY+YGF+LLV LIL++VTVCVTIVGTYFLLNAENY
Sbjct  460  GGLLPFGSIFIEMYFVFTSFWNYKVYYIYGFLLLVVLILLVVTVCVTIVGTYFLLNAENY  519

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWT+F  +AST+ YV+LYS++Y+  KTKM+G FQ  FYFGYT MFCLGL +LCGAVG+
Sbjct  520  HWQWTAFGMSASTSFYVFLYSVHYFLFKTKMTGLFQTCFYFGYTSMFCLGLALLCGAVGY  579

Query  351  LGSNLFVRRIYRNIKCD  301
            + +  FVR IYRN+KCD
Sbjct  580  MAAAAFVRTIYRNVKCD  596



>emb|CAN77106.1| hypothetical protein VITISV_037096 [Vitis vinifera]
Length=600

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  642  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  463
            +VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVY YSIY
Sbjct  487  EVYYVYGFMLLVFMILMIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAFYVYFYSIY  546

Query  462  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  301
            YYY+KTKMSGFFQ SFYFGYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  547  YYYMKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  600



>ref|XP_010272575.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nelumbo 
nucifera]
Length=466

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -2

Query  642  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  463
            +VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  353  QVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIY  412

Query  462  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  301
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  413  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  466



>ref|XP_009615816.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=106

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = -2

Query  564  GTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCL  385
            GTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYT+MFCL
Sbjct  19   GTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCL  78

Query  384  GLGILCGAVGFLGSNLFVRRIYRNIKCD  301
            GLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  79   GLGILCGAVGYLGSNLFVRRIYRNIKCD  106



>ref|XP_009511961.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phalacrocorax 
carbo]
 ref|XP_009806564.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Gavia stellata]
 ref|XP_010146260.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Eurypyga helias]
Length=194

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  58   GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  117

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  118  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  177

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  178  MGTSAFVRKIYTNVKID  194



>gb|AAX96186.1| Endomembrane protein 70 [Oryza sativa Japonica Group]
Length=570

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENY
Sbjct  451  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAV  358
            HWQWTSFFSAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCG V
Sbjct  511  HWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGTV  568



>ref|XP_010101151.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
 gb|EXB87369.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
Length=609

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 111/116 (96%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY
Sbjct  446  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENY  505

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  364
            HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG
Sbjct  506  HWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCG  561



>ref|XP_009976834.1| PREDICTED: transmembrane 9 superfamily member 3 [Tauraco erythrolophus]
Length=266

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  130  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  189

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  190  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  249

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  250  MGTSAFVRKIYTNVKID  266



>dbj|BAG60075.1| unnamed protein product [Homo sapiens]
Length=254

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  118  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  177

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  178  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  237

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  238  MGTSAFVRKIYTNVKID  254



>ref|NP_001146830.1| uncharacterized protein LOC100280437 [Zea mays]
 gb|ACL54836.1| unknown [Zea mays]
Length=106

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -2

Query  564  GTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCL  385
            GTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCL
Sbjct  19   GTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCL  78

Query  384  GLGILCGAVGFLGSNLFVRRIYRNIKCD  301
            GLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  79   GLGILCGAIGYLGSTLFVRRIYRNIKCD  106



>gb|KJB47460.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=571

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  364
            HWQWTSFFSAASTAVYVY+YS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG
Sbjct  514  HWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCG  569



>dbj|BAB55110.1| unnamed protein product [Homo sapiens]
 dbj|BAC11397.1| unnamed protein product [Homo sapiens]
Length=329

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  193  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  252

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  253  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  312

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  313  MGTSAFVRKIYTNVKID  329



>ref|XP_008057299.1| PREDICTED: transmembrane 9 superfamily member 3 [Tarsius syrichta]
Length=359

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  223  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  282

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  283  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  342

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  343  MGTSAFVRKIYTNVKID  359



>gb|KJB47461.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=576

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENY
Sbjct  454  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENY  513

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  364
            HWQWTSFFSAASTAVYVY+YS+YYYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG
Sbjct  514  HWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCG  569



>gb|KHG20579.1| Tm9sf3 [Gossypium arboreum]
Length=626

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  480  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  539

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILC  367
            HWQWTSFFSAASTA+YVYLYS+YYY VKTKMSGFFQ SFYFGYTLMFCLGLGILC
Sbjct  540  HWQWTSFFSAASTAIYVYLYSVYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGILC  594



>gb|KHG20578.1| Tm9sf3 [Gossypium arboreum]
Length=639

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENY
Sbjct  480  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENY  539

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILC  367
            HWQWTSFFSAASTA+YVYLYS+YYY VKTKMSGFFQ SFYFGYTLMFCLGLGILC
Sbjct  540  HWQWTSFFSAASTAIYVYLYSVYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGILC  594



>ref|XP_009951614.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Leptosomus 
discolor]
 ref|XP_010281856.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phaethon 
lepturus]
Length=395

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  259  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  318

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  319  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  378

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  379  MGTSAFVRKIYTNVKID  395



>dbj|BAC11232.1| unnamed protein product [Homo sapiens]
Length=399

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  263  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  322

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  323  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  382

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  383  MGTSAFVRKIYTNVKID  399



>ref|XP_009478867.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pelecanus 
crispus]
Length=383

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  247  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  306

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  307  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  366

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  367  MGTSAFVRKIYTNVKID  383



>ref|XP_006756739.1| PREDICTED: transmembrane 9 superfamily member 3 [Myotis davidii]
Length=401

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  265  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  324

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  325  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  384

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  385  MGTSAFVRKIYTNVKID  401



>ref|XP_003061693.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54323.1| predicted protein [Micromonas pusilla CCMP1545]
Length=623

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIE YFVFTS WNYKVYYVYGF LLVF IL+IVT CVT+V TYFLLNAEN+
Sbjct  487  GGVLPFGSIFIETYFVFTSMWNYKVYYVYGFFLLVFAILLIVTACVTVVATYFLLNAENW  546

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             W WT+F +AAS ++YVY YS+YY+  KTKM+GFFQ  FYFGYT MFCL L ++CGA G+
Sbjct  547  RWHWTAFNAAASVSLYVYAYSVYYFVFKTKMTGFFQTCFYFGYTAMFCLVLALVCGATGY  606

Query  351  LGSNLFVRRIYRNIKCD  301
            + +N FVRRIYRNIKCD
Sbjct  607  VAANAFVRRIYRNIKCD  623



>ref|XP_008942019.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Merops 
nubicus]
 ref|XP_010161341.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Caprimulgus 
carolinensis]
 ref|XP_010075805.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pterocles 
gutturalis]
Length=448

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  312  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  371

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  372  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  431

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  432  MGTSAFVRKIYTNVKID  448



>gb|KFU99061.1| Transmembrane 9 superfamily member 3, partial [Pterocles gutturalis]
Length=449

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  313  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  372

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  373  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  432

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  433  MGTSAFVRKIYTNVKID  449



>ref|XP_006799085.1| PREDICTED: transmembrane 9 superfamily member 3-like [Neolamprologus 
brichardi]
Length=624

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  488  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  547

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  548  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  607

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  608  MGTSAFVRKIYTNVKID  624



>dbj|BAE91187.1| unnamed protein product [Macaca fascicularis]
Length=487

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  351  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  410

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  411  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  470

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  471  MGTSAFVRKIYTNVKID  487



>ref|NP_998554.1| transmembrane 9 superfamily member 3 precursor [Danio rerio]
 gb|AAH46021.1| Transmembrane 9 superfamily member 3 [Danio rerio]
Length=586

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_007566966.1| PREDICTED: transmembrane 9 superfamily member 3 [Poecilia formosa]
Length=586

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_007258750.1| PREDICTED: transmembrane 9 superfamily member 3-like [Astyanax 
mexicanus]
Length=587

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  511  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>gb|AAQ89178.1| PATY245 [Homo sapiens]
Length=487

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  351  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  410

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  411  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  470

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  471  MGTSAFVRKIYTNVKID  487



>ref|XP_006263564.1| PREDICTED: transmembrane 9 superfamily member 3-like [Alligator 
mississippiensis]
Length=511

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  375  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  434

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  435  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  494

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  495  MGTSAFVRKIYTNVKID  511



>ref|XP_005795250.1| PREDICTED: transmembrane 9 superfamily member 3-like [Xiphophorus 
maculatus]
Length=586

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_008282853.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Stegastes partitus]
Length=624

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  488  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  547

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  548  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  607

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  608  MGTSAFVRKIYTNVKID  624



>ref|XP_008428273.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Poecilia 
reticulata]
Length=586

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_007615223.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Cricetulus 
griseus]
Length=487

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  351  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  410

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  411  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  470

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  471  MGTSAFVRKIYTNVKID  487



>ref|XP_006630785.1| PREDICTED: transmembrane 9 superfamily member 3-like [Lepisosteus 
oculatus]
Length=586

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_005735123.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pundamilia 
nyererei]
 ref|XP_005927107.1| PREDICTED: transmembrane 9 superfamily member 3-like [Haplochromis 
burtoni]
Length=586

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_007902753.1| PREDICTED: transmembrane 9 superfamily member 3 [Callorhinchus 
milii]
Length=585

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  449  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  509  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  569  MGTSAFVRKIYTNVKID  585



>ref|XP_003441118.1| PREDICTED: transmembrane 9 superfamily member 3 [Oreochromis 
niloticus]
Length=586

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_007441347.1| PREDICTED: transmembrane 9 superfamily member 3-like [Python 
bivittatus]
Length=487

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  351  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  410

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  411  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  470

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  471  MGTSAFVRKIYTNVKID  487



>ref|XP_004559661.1| PREDICTED: transmembrane 9 superfamily member 3-like [Maylandia 
zebra]
Length=624

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  488  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  547

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  548  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  607

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  608  MGTSAFVRKIYTNVKID  624



>ref|XP_003963762.1| PREDICTED: transmembrane 9 superfamily member 3-like [Takifugu 
rubripes]
Length=586

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>gb|AAH04799.2| Tm9sf3 protein, partial [Mus musculus]
Length=513

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  377  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  436

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  437  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  496

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  497  MGTSAFVRKIYTNVKID  513



>gb|AAH20959.2| TM9SF3 protein, partial [Homo sapiens]
Length=521

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  385  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  444

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  445  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  504

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  505  MGTSAFVRKIYTNVKID  521



>ref|XP_005997314.1| PREDICTED: transmembrane 9 superfamily member 3 [Latimeria chalumnae]
Length=587

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  511  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>ref|XP_007080322.1| PREDICTED: transmembrane 9 superfamily member 3 [Panthera tigris 
altaica]
Length=608

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  472  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  531

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  532  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  591

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  592  MGTSAFVRKIYTNVKID  608



>ref|XP_002821075.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Pongo abelii]
Length=588

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  452  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  511

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  512  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  571

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  572  MGTSAFVRKIYTNVKID  588



>ref|XP_006157459.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Tupaia 
chinensis]
Length=577

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  441  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  500

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  501  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  560

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  561  MGTSAFVRKIYTNVKID  577



>ref|XP_004370030.1| PREDICTED: transmembrane 9 superfamily member 3 [Trichechus manatus 
latirostris]
 ref|XP_007938194.1| PREDICTED: transmembrane 9 superfamily member 3 [Orycteropus 
afer afer]
Length=587

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  511  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>ref|XP_003787418.1| PREDICTED: transmembrane 9 superfamily member 3 [Otolemur garnettii]
Length=541

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  405  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  464

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  465  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  524

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  525  MGTSAFVRKIYTNVKID  541



>ref|XP_008428274.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Poecilia 
reticulata]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  469  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_008830212.1| PREDICTED: transmembrane 9 superfamily member 3 [Nannospalax 
galili]
Length=587

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  511  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>emb|CDQ61092.1| unnamed protein product [Oncorhynchus mykiss]
Length=640

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  504  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  563

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  564  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGY  623

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  624  VGTSAFVRKIYTNVKID  640



>ref|XP_008773120.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Rattus 
norvegicus]
Length=598

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  462  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  521

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  522  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  581

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  582  MGTSAFVRKIYTNVKID  598



>gb|EHB07803.1| Transmembrane 9 superfamily member 3, partial [Heterocephalus 
glaber]
 gb|EHH64915.1| hypothetical protein EGM_18247, partial [Macaca fascicularis]
Length=555

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  419  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  478

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  479  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  538

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  539  MGTSAFVRKIYTNVKID  555



>gb|ETE67718.1| Transmembrane 9 superfamily member 3 [Ophiophagus hannah]
Length=555

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  419  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  478

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  479  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  538

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  539  MGTSAFVRKIYTNVKID  555



>ref|XP_004409540.1| PREDICTED: transmembrane 9 superfamily member 3 [Odobenus rosmarus 
divergens]
Length=587

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  511  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>ref|XP_010779545.1| PREDICTED: transmembrane 9 superfamily member 3 [Notothenia coriiceps]
Length=586

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  450  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  509

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  510  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGY  569

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  570  MGTSAFVRKIYTNVKID  586



>ref|XP_010712721.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Meleagris 
gallopavo]
Length=561

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  425  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  484

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  485  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  544

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  545  MGTSAFVRKIYTNVKID  561



>ref|XP_008932762.1| PREDICTED: transmembrane 9 superfamily member 3 [Manacus vitellinus]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_010018436.1| PREDICTED: transmembrane 9 superfamily member 3 [Nestor notabilis]
Length=520

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  384  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  443

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  444  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  503

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  504  MGTSAFVRKIYTNVKID  520



>ref|XP_008948979.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Pan paniscus]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_003399780.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus 
terrestris]
 ref|XP_003493708.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus 
impatiens]
Length=584

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLLNAE+Y
Sbjct  448  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLLNAEDY  507

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA YVY+YS YY++ KTKM G FQ +FYFGY  +F L LGI+CG VG+
Sbjct  508  RWQWTSFLSAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMCGTVGY  567

Query  351  LGSNLFVRRIYRNIKCD  301
            +G+N FVR+IY  +K D
Sbjct  568  VGTNAFVRKIYSTVKID  584



>ref|XP_004616433.1| PREDICTED: transmembrane 9 superfamily member 3 [Sorex araneus]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|NP_064508.3| transmembrane 9 superfamily member 3 precursor [Homo sapiens]
 ref|XP_009457308.1| PREDICTED: transmembrane 9 superfamily member 3 [Pan troglodytes]
 sp|Q9HD45.2|TM9S3_HUMAN RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=EP70-P-iso; AltName: Full=SM-11044-binding protein; Flags: 
Precursor [Homo sapiens]
 gb|EAW49972.1| SM-11044 binding protein, isoform CRA_a [Homo sapiens]
 gb|EAW49974.1| SM-11044 binding protein, isoform CRA_a [Homo sapiens]
 gb|AAI36790.1| Transmembrane 9 superfamily member 3 [Homo sapiens]
 gb|AAI36789.1| Transmembrane 9 superfamily member 3 [Homo sapiens]
 tpg|DAA64544.1| TPA_exp: dinucleotide oxidase disulfide thiol exchanger 3 superfamily 
member 3 [Homo sapiens]
Length=589

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  453  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  513  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  573  MGTSAFVRKIYTNVKID  589



>ref|XP_011285801.1| PREDICTED: transmembrane 9 superfamily member 3 [Felis catus]
Length=561

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  425  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  484

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  485  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  544

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  545  MGTSAFVRKIYTNVKID  561



>ref|XP_010712722.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Meleagris 
gallopavo]
Length=556

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  420  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  479

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  480  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  539

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  540  MGTSAFVRKIYTNVKID  556



>ref|XP_009916579.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_010566033.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Haliaeetus 
leucocephalus]
Length=519

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  383  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  442

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  443  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  502

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  503  MGTSAFVRKIYTNVKID  519



>ref|XP_006831254.1| PREDICTED: transmembrane 9 superfamily member 3 [Chrysochloris 
asiatica]
Length=587

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  511  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>ref|XP_009705892.1| PREDICTED: transmembrane 9 superfamily member 3 [Cariama cristata]
 ref|XP_010127919.1| PREDICTED: transmembrane 9 superfamily member 3 [Chlamydotis 
macqueenii]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_009470788.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Nipponia 
nippon]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_005153929.1| PREDICTED: transmembrane 9 superfamily member 3 [Melopsittacus 
undulatus]
 ref|XP_009887052.1| PREDICTED: transmembrane 9 superfamily member 3 [Charadrius vociferus]
 ref|XP_010142086.1| PREDICTED: transmembrane 9 superfamily member 3 [Buceros rhinoceros 
silvestris]
 ref|XP_010189169.1| PREDICTED: transmembrane 9 superfamily member 3 [Mesitornis unicolor]
 ref|XP_010202388.1| PREDICTED: transmembrane 9 superfamily member 3 [Colius striatus]
 ref|XP_010218523.1| PREDICTED: transmembrane 9 superfamily member 3 [Tinamus guttatus]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_002509072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70330.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIE YFVFTS W+YKVYYVYGF LLVF IL+IVT+C+TIVGTYFLLNAEN+
Sbjct  477  GGLLPFGSIFIETYFVFTSIWSYKVYYVYGFFLLVFCILVIVTLCITIVGTYFLLNAENH  536

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWT+F SAAS A YVYLYSIYY+  KTKM+GFFQ  FYFGYT MFCL LGI  GA+G+
Sbjct  537  KWQWTAFNSAASVAGYVYLYSIYYFAFKTKMTGFFQTCFYFGYTAMFCLALGITTGAIGY  596

Query  351  LGSNLFVRRIYRNIKCD  301
             G++ FVR+IYRNIK D
Sbjct  597  CGASAFVRKIYRNIKVD  613



>gb|AAF98159.1|AF269150_1 transmembrane protein TM9SF3 [Homo sapiens]
Length=589

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  453  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  512

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  513  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  572

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  573  MGTSAFVRKIYTNVKID  589



>ref|XP_009669621.1| PREDICTED: transmembrane 9 superfamily member 3 [Struthio camelus 
australis]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYTYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_005025241.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Anas 
platyrhynchos]
 ref|XP_005234638.1| PREDICTED: transmembrane 9 superfamily member 3 [Falco peregrinus]
 ref|XP_005441661.1| PREDICTED: transmembrane 9 superfamily member 3 [Falco cherrug]
 ref|XP_005500101.1| PREDICTED: transmembrane 9 superfamily member 3 [Columba livia]
 ref|XP_009075359.1| PREDICTED: transmembrane 9 superfamily member 3 [Acanthisitta 
chloris]
 ref|XP_009275969.1| PREDICTED: transmembrane 9 superfamily member 3 [Aptenodytes 
forsteri]
 ref|XP_009320681.1| PREDICTED: transmembrane 9 superfamily member 3 [Pygoscelis adeliae]
 ref|XP_009569010.1| PREDICTED: transmembrane 9 superfamily member 3 [Cuculus canorus]
 ref|XP_009640318.1| PREDICTED: transmembrane 9 superfamily member 3 [Egretta garzetta]
 ref|XP_009916578.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_009937749.1| PREDICTED: transmembrane 9 superfamily member 3 [Opisthocomus 
hoazin]
 ref|XP_009966565.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Tyto 
alba]
 ref|XP_009999091.1| PREDICTED: transmembrane 9 superfamily member 3 [Chaetura pelagica]
 ref|XP_010311939.1| PREDICTED: transmembrane 9 superfamily member 3 [Balearica regulorum 
gibbericeps]
 ref|XP_010566032.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Haliaeetus 
leucocephalus]
Length=545

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_001698971.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO99025.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=598

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYY+YGF+LLV LIL +VTVCVTIVGTYFLLNAENY
Sbjct  462  GGLLPFGSIFIEMYFVFTSFWNYKVYYIYGFLLLVVLILCVVTVCVTIVGTYFLLNAENY  521

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
            HWQWT+F  +AST+ YV+LYS++Y+ +KTKM+GFFQ  FYFGYT MFCLGL +LCGA+G+
Sbjct  522  HWQWTAFGMSASTSFYVFLYSVHYFLLKTKMTGFFQTCFYFGYTSMFCLGLALLCGAMGY  581

Query  351  LGSNLFVRRIYRNIKCD  301
            + +  FVR IYRN+KCD
Sbjct  582  MAAAAFVRTIYRNVKCD  598



>ref|XP_008320400.1| PREDICTED: transmembrane 9 superfamily member 3 [Cynoglossus 
semilaevis]
Length=585

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  449  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  508

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTAVYVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG+
Sbjct  509  RWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGY  568

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  569  VGTSAFVRKIYTNVKID  585



>ref|XP_006116276.1| PREDICTED: transmembrane 9 superfamily member 3 [Pelodiscus sinensis]
Length=545

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>gb|ELK35693.1| Transmembrane 9 superfamily member 3 [Myotis davidii]
Length=513

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  377  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  436

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  437  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  496

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  497  MGTSAFVRKIYTNVKID  513



>ref|NP_579930.1| transmembrane 9 superfamily member 3 precursor [Mus musculus]
 ref|XP_005063661.1| PREDICTED: transmembrane 9 superfamily member 3 [Mesocricetus 
auratus]
 ref|XP_006231475.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Rattus 
norvegicus]
 sp|Q9ET30.1|TM9S3_MOUSE RecName: Full=Transmembrane 9 superfamily member 3; Flags: Precursor 
[Mus musculus]
 gb|AAF98160.1|AF269151_1 transmembrane protein TM9SF3 [Mus musculus]
Length=587

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  451  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  510

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  511  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  570

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  571  MGTSAFVRKIYTNVKID  587



>gb|EPS62158.1| hypothetical protein M569_12635, partial [Genlisea aurea]
Length=537

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G L   GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILI+VT+CVTIVGTYFLLNAENY
Sbjct  422  GGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIVVTICVTIVGTYFLLNAENY  481

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  364
            HWQWTSFFSAASTA+YV+LYSIYYY++KT+MSGFFQ +FYFGYT MFCLGLGILCG
Sbjct  482  HWQWTSFFSAASTALYVFLYSIYYYHLKTRMSGFFQTTFYFGYTSMFCLGLGILCG  537



>gb|EDL41855.1| mCG2375, isoform CRA_b [Mus musculus]
Length=556

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  420  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  479

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  480  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  539

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  540  MGTSAFVRKIYTNVKID  556



>ref|XP_010409948.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Corvus 
cornix cornix]
Length=575

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  439  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  498

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  499  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  558

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  559  MGTSAFVRKIYTNVKID  575



>ref|XP_009574595.1| PREDICTED: transmembrane 9 superfamily member 3 [Fulmarus glacialis]
Length=545

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_007187499.1| PREDICTED: transmembrane 9 superfamily member 3 [Balaenoptera 
acutorostrata scammoni]
Length=545

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



>ref|XP_004427950.1| PREDICTED: transmembrane 9 superfamily member 3 [Ceratotherium 
simum simum]
Length=545

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  711  GRLASIGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENY  532
            G +   GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y
Sbjct  409  GGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDY  468

Query  531  HWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGF  352
             WQWTSF SAASTA+YVY+YS YYY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G+
Sbjct  469  RWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGY  528

Query  351  LGSNLFVRRIYRNIKCD  301
            +G++ FVR+IY N+K D
Sbjct  529  MGTSAFVRKIYTNVKID  545



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050