BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF017H13

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002510995.1|  receptor protein kinase, putative                  273   3e-85   
ref|XP_009588521.1|  PREDICTED: U-box domain-containing protein 3...    280   2e-84   Nicotiana tomentosiformis
ref|XP_009771774.1|  PREDICTED: U-box domain-containing protein 3...    278   4e-84   Nicotiana sylvestris
ref|XP_006358228.1|  PREDICTED: U-box domain-containing protein 3...    275   1e-82   Solanum tuberosum [potatoes]
gb|KJB07883.1|  hypothetical protein B456_001G050300                    272   2e-82   Gossypium raimondii
gb|KDP22458.1|  hypothetical protein JCGZ_26289                         273   3e-82   Jatropha curcas
emb|CAN78862.1|  hypothetical protein VITISV_021538                     272   7e-82   Vitis vinifera
gb|KHG01292.1|  U-box domain-containing 35 -like protein                272   1e-81   Gossypium arboreum [tree cotton]
ref|XP_006421585.1|  hypothetical protein CICLE_v10004338mg             271   2e-81   
ref|XP_006355617.1|  PREDICTED: U-box domain-containing protein 3...    272   2e-81   Solanum tuberosum [potatoes]
gb|KJB07882.1|  hypothetical protein B456_001G050300                    271   2e-81   Gossypium raimondii
gb|KJB07880.1|  hypothetical protein B456_001G050300                    271   2e-81   Gossypium raimondii
gb|KDO45275.1|  hypothetical protein CISIN_1g003576mg                   270   2e-81   Citrus sinensis [apfelsine]
ref|XP_009768170.1|  PREDICTED: U-box domain-containing protein 3...    272   3e-81   Nicotiana sylvestris
ref|XP_010662271.1|  PREDICTED: U-box domain-containing protein 3...    269   3e-81   Vitis vinifera
ref|XP_009607007.1|  PREDICTED: U-box domain-containing protein 3...    271   3e-81   
gb|KDO45272.1|  hypothetical protein CISIN_1g003576mg                   270   4e-81   Citrus sinensis [apfelsine]
ref|XP_009607006.1|  PREDICTED: U-box domain-containing protein 3...    271   4e-81   Nicotiana tomentosiformis
ref|XP_006421586.1|  hypothetical protein CICLE_v10004338mg             270   4e-81   Citrus clementina [clementine]
ref|XP_007038300.1|  U-box domain-containing protein kinase famil...    270   5e-81   
gb|KDO45273.1|  hypothetical protein CISIN_1g003576mg                   270   6e-81   Citrus sinensis [apfelsine]
ref|XP_007038299.1|  U-box domain-containing protein kinase famil...    270   6e-81   
emb|CBI38656.3|  unnamed protein product                                269   7e-81   Vitis vinifera
ref|XP_002266973.2|  PREDICTED: U-box domain-containing protein 3...    269   1e-80   Vitis vinifera
ref|XP_004307786.2|  PREDICTED: U-box domain-containing protein 3...    269   2e-80   Fragaria vesca subsp. vesca
ref|XP_010321478.1|  PREDICTED: U-box domain-containing protein 3...    268   3e-80   
ref|XP_010318173.1|  PREDICTED: U-box domain-containing protein 3...    268   4e-80   Solanum lycopersicum
ref|XP_004143742.1|  PREDICTED: U-box domain-containing protein 3...    268   5e-80   
ref|XP_006490171.1|  PREDICTED: U-box domain-containing protein 3...    268   5e-80   Citrus sinensis [apfelsine]
ref|XP_008437017.1|  PREDICTED: U-box domain-containing protein 3...    268   5e-80   Cucumis melo [Oriental melon]
ref|XP_010321477.1|  PREDICTED: U-box domain-containing protein 3...    268   6e-80   
ref|XP_008437015.1|  PREDICTED: U-box domain-containing protein 3...    267   7e-80   
ref|XP_006490170.1|  PREDICTED: U-box domain-containing protein 3...    267   7e-80   Citrus sinensis [apfelsine]
gb|KHN42779.1|  U-box domain-containing protein 35                      266   2e-79   Glycine soja [wild soybean]
gb|KGN50313.1|  hypothetical protein Csa_5G167050                       266   4e-79   
ref|XP_007148721.1|  hypothetical protein PHAVU_005G0089000g            264   4e-79   Phaseolus vulgaris [French bean]
ref|XP_011076521.1|  PREDICTED: U-box domain-containing protein 52      265   5e-79   
ref|XP_004158155.1|  PREDICTED: U-box domain-containing protein 3...    268   6e-79   
ref|XP_003522847.2|  PREDICTED: U-box domain-containing protein 3...    265   6e-79   Glycine max [soybeans]
gb|KHN32504.1|  U-box domain-containing protein 35                      265   7e-79   Glycine soja [wild soybean]
ref|XP_006578363.1|  PREDICTED: U-box domain-containing protein 3...    265   7e-79   Glycine max [soybeans]
emb|CDP05368.1|  unnamed protein product                                265   8e-79   Coffea canephora [robusta coffee]
ref|XP_010275384.1|  PREDICTED: U-box domain-containing protein 3...    264   9e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009372840.1|  PREDICTED: U-box domain-containing protein 3...    263   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_006385122.1|  hypothetical protein POPTR_0004s24130g             262   6e-78   Populus trichocarpa [western balsam poplar]
ref|XP_004499632.1|  PREDICTED: U-box domain-containing protein 3...    258   2e-77   
ref|XP_004499631.1|  PREDICTED: U-box domain-containing protein 3...    258   5e-77   Cicer arietinum [garbanzo]
ref|XP_010062525.1|  PREDICTED: U-box domain-containing protein 3...    259   6e-77   Eucalyptus grandis [rose gum]
ref|XP_008351452.1|  PREDICTED: U-box domain-containing protein 5...    249   6e-77   
ref|XP_010258804.1|  PREDICTED: U-box domain-containing protein 3...    259   9e-77   
ref|XP_009362703.1|  PREDICTED: U-box domain-containing protein 35      258   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_004499628.1|  PREDICTED: U-box domain-containing protein 3...    258   2e-76   
ref|XP_003598187.1|  U-box domain-containing protein                    257   3e-76   Medicago truncatula
ref|XP_004499634.1|  PREDICTED: U-box domain-containing protein 3...    256   9e-76   Cicer arietinum [garbanzo]
ref|XP_010109120.1|  U-box domain-containing protein 35                 256   9e-76   
ref|XP_004499633.1|  PREDICTED: U-box domain-containing protein 3...    256   1e-75   Cicer arietinum [garbanzo]
gb|EYU20190.1|  hypothetical protein MIMGU_mgv1a001539mg                256   1e-75   Erythranthe guttata [common monkey flower]
ref|XP_008376381.1|  PREDICTED: U-box domain-containing protein 3...    255   2e-75   Malus domestica [apple tree]
ref|XP_008376383.1|  PREDICTED: U-box domain-containing protein 3...    254   2e-75   Malus domestica [apple tree]
ref|XP_011028464.1|  PREDICTED: U-box domain-containing protein 3...    255   3e-75   Populus euphratica
ref|XP_011028465.1|  PREDICTED: U-box domain-containing protein 3...    255   3e-75   Populus euphratica
ref|XP_008391798.1|  PREDICTED: U-box domain-containing protein 3...    253   1e-74   
ref|XP_008234435.1|  PREDICTED: U-box domain-containing protein 3...    253   1e-74   Prunus mume [ume]
ref|XP_008234434.1|  PREDICTED: U-box domain-containing protein 3...    253   1e-74   Prunus mume [ume]
ref|XP_007218920.1|  hypothetical protein PRUPE_ppa001518mg             252   3e-74   Prunus persica
gb|KEH32844.1|  U-box kinase family protein                             251   5e-74   Medicago truncatula
ref|XP_003598188.1|  U-box domain-containing protein                    251   6e-74   Medicago truncatula
ref|NP_199940.1|  U-box domain-containing protein 53                    248   7e-73   
ref|XP_010671630.1|  PREDICTED: U-box domain-containing protein 3...    247   1e-72   
ref|XP_010038414.1|  PREDICTED: U-box domain-containing protein 3...    246   2e-72   Eucalyptus grandis [rose gum]
ref|XP_002865849.1|  predicted protein                                  247   3e-72   
ref|XP_009401652.1|  PREDICTED: U-box domain-containing protein 3...    246   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864738.1|  kinase family protein                              246   5e-72   
ref|XP_002862537.1|  kinase family protein                              246   6e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_006655773.1|  PREDICTED: U-box domain-containing protein 3...    245   9e-72   Oryza brachyantha
ref|XP_010693732.1|  PREDICTED: U-box domain-containing protein 3...    245   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010934652.1|  PREDICTED: U-box domain-containing protein 5...    244   2e-71   Elaeis guineensis
ref|XP_010555606.1|  PREDICTED: U-box domain-containing protein 3...    244   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_010555605.1|  PREDICTED: U-box domain-containing protein 3...    245   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_010448470.1|  PREDICTED: U-box domain-containing protein 3...    244   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010438919.1|  PREDICTED: U-box domain-containing protein 3...    244   5e-71   Camelina sativa [gold-of-pleasure]
gb|AAO72614.1|  putative serine/threonine protein kinase                235   7e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002865850.1|  kinase family protein                              243   9e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_002437797.1|  hypothetical protein SORBIDRAFT_10g002760          242   9e-71   
ref|XP_008809460.1|  PREDICTED: U-box domain-containing protein 3...    241   2e-70   
ref|NP_200963.1|  U-box domain-containing protein 52                    242   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803845.1|  PREDICTED: U-box domain-containing protein 52      241   2e-70   
ref|NP_001190588.1|  U-box domain-containing protein 52                 242   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010919905.1|  PREDICTED: U-box domain-containing protein 35      241   3e-70   Elaeis guineensis
ref|XP_009401649.1|  PREDICTED: U-box domain-containing protein 3...    241   3e-70   
ref|XP_006413335.1|  hypothetical protein EUTSA_v10024396mg             241   4e-70   Eutrema salsugineum [saltwater cress]
ref|XP_008809455.1|  PREDICTED: U-box domain-containing protein 5...    241   4e-70   Phoenix dactylifera
gb|KFK27907.1|  kinase family protein                                   241   5e-70   Arabis alpina [alpine rockcress]
ref|XP_009127317.1|  PREDICTED: putative U-box domain-containing ...    240   5e-70   Brassica rapa
emb|CDY16329.1|  BnaA02g11330D                                          240   5e-70   Brassica napus [oilseed rape]
ref|XP_010433680.1|  PREDICTED: U-box domain-containing protein 3...    239   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009130169.1|  PREDICTED: U-box domain-containing protein 52      240   1e-69   Brassica rapa
ref|XP_006283114.1|  hypothetical protein CARUB_v10004133mg             239   1e-69   Capsella rubella
ref|XP_006281721.1|  hypothetical protein CARUB_v10027877mg             239   2e-69   Capsella rubella
ref|XP_004964500.1|  PREDICTED: U-box domain-containing protein 3...    239   2e-69   Setaria italica
ref|XP_006279824.1|  hypothetical protein CARUB_v10028126mg             239   2e-69   Capsella rubella
gb|KFK29004.1|  hypothetical protein AALP_AA7G076800                    239   2e-69   Arabis alpina [alpine rockcress]
ref|XP_011076423.1|  PREDICTED: U-box domain-containing protein 35      239   2e-69   Sesamum indicum [beniseed]
ref|XP_009370502.1|  PREDICTED: U-box domain-containing protein 3...    238   2e-69   Pyrus x bretschneideri [bai li]
emb|CDX91574.1|  BnaC02g15860D                                          238   3e-69   
ref|XP_010482460.1|  PREDICTED: LOW QUALITY PROTEIN: putative U-b...    238   3e-69   
ref|XP_006394493.1|  hypothetical protein EUTSA_v10005349mg             239   4e-69   
ref|XP_010433679.1|  PREDICTED: U-box domain-containing protein 3...    238   4e-69   
emb|CDX87220.1|  BnaC09g05350D                                          238   5e-69   
ref|NP_194246.2|  U-box domain-containing protein kinase family p...    238   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457459.1|  PREDICTED: U-box domain-containing protein 5...    238   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010442610.1|  PREDICTED: putative U-box domain-containing ...    238   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002867622.1|  kinase family protein                              238   6e-69   
gb|AFW85931.1|  putative U-box domain protein kinase family             228   6e-69   
emb|CDY12184.1|  BnaC04g12140D                                          232   8e-69   Brassica napus [oilseed rape]
emb|CAB36758.1|  putative Ser/Thr protein kinase                        237   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056754.1|  Os06g0140800                                       237   1e-68   
ref|XP_009138907.1|  PREDICTED: U-box domain-containing protein 35      237   2e-68   Brassica rapa
emb|CDY34347.1|  BnaA01g14500D                                          237   2e-68   Brassica napus [oilseed rape]
ref|XP_010548832.1|  PREDICTED: U-box domain-containing protein 5...    236   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_010483826.1|  PREDICTED: U-box domain-containing protein 52      236   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006837329.1|  hypothetical protein AMTR_s00111p00076670          235   4e-68   
ref|XP_010690148.1|  PREDICTED: U-box domain-containing protein 3...    235   9e-68   
emb|CDY00462.1|  BnaA10g08110D                                          231   1e-67   
emb|CDY03375.1|  BnaC01g17070D                                          237   2e-67   
ref|XP_009112093.1|  PREDICTED: U-box domain-containing protein 5...    229   4e-67   Brassica rapa
ref|XP_009137072.1|  PREDICTED: U-box domain-containing protein 52      233   5e-67   Brassica rapa
ref|XP_010482459.1|  PREDICTED: putative U-box domain-containing ...    232   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006401994.1|  hypothetical protein EUTSA_v10012716mg             232   6e-67   Eutrema salsugineum [saltwater cress]
emb|CDY02135.1|  BnaA03g40320D                                          233   7e-67   
emb|CDY23059.1|  BnaC07g31280D                                          232   7e-67   Brassica napus [oilseed rape]
emb|CDY16813.1|  BnaA09g05690D                                          232   9e-67   Brassica napus [oilseed rape]
ref|XP_010443973.1|  PREDICTED: U-box domain-containing protein 5...    232   9e-67   Camelina sativa [gold-of-pleasure]
emb|CDX92680.1|  BnaC07g39380D                                          231   9e-67   
emb|CDY00464.1|  BnaA10g08090D                                          231   1e-66   
ref|XP_008660730.1|  PREDICTED: U-box domain-containing protein 3...    229   2e-66   
ref|XP_010546140.1|  PREDICTED: U-box domain-containing protein 5...    230   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_010546142.1|  PREDICTED: U-box domain-containing protein 5...    230   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_010546141.1|  PREDICTED: U-box domain-containing protein 5...    230   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_010546139.1|  PREDICTED: U-box domain-containing protein 5...    230   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_009385227.1|  PREDICTED: U-box domain-containing protein 3...    229   7e-66   
ref|XP_009119427.1|  PREDICTED: putative U-box domain-containing ...    229   8e-66   Brassica rapa
emb|CDY00461.1|  BnaA10g08120D                                          229   9e-66   
emb|CDY11059.1|  BnaA03g47180D                                          229   1e-65   Brassica napus [oilseed rape]
ref|XP_009137501.1|  PREDICTED: U-box domain-containing protein 3...    229   1e-65   
emb|CDX99935.1|  BnaC09g27700D                                          223   6e-64   
ref|XP_010546147.1|  PREDICTED: U-box domain-containing protein 52      224   7e-64   Tarenaya hassleriana [spider flower]
ref|XP_003557213.1|  PREDICTED: U-box domain-containing protein 3...    223   2e-63   Brachypodium distachyon [annual false brome]
gb|EYU20191.1|  hypothetical protein MIMGU_mgv1a004066mg                218   2e-63   Erythranthe guttata [common monkey flower]
dbj|BAJ89872.1|  predicted protein                                      221   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010523202.1|  PREDICTED: U-box domain-containing protein 5...    218   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010523201.1|  PREDICTED: U-box domain-containing protein 5...    218   3e-62   Tarenaya hassleriana [spider flower]
gb|ABL85042.1|  serine threonine kinase                                 219   3e-62   Brachypodium sylvaticum
gb|EYU20192.1|  hypothetical protein MIMGU_mgv1a026292mg                219   4e-62   Erythranthe guttata [common monkey flower]
gb|EMT31075.1|  U-box domain-containing protein 35                      219   4e-62   
gb|EMS55617.1|  U-box domain-containing protein 35                      219   5e-62   Triticum urartu
dbj|BAF00647.1|  hypothetical protein                                   213   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280030.1|  hypothetical protein CARUB_v10025907mg             216   6e-61   Capsella rubella
ref|XP_010443975.1|  PREDICTED: U-box domain-containing protein 5...    213   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010457479.1|  PREDICTED: U-box domain-containing protein 5...    212   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010483834.1|  PREDICTED: U-box domain-containing protein 51      211   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002864740.1|  kinase family protein                              211   2e-59   
ref|XP_006394492.1|  hypothetical protein EUTSA_v10003692mg             210   4e-59   
dbj|BAB09000.1|  unnamed protein product                                209   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200964.2|  U-box domain-containing protein 51                    209   9e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02134.1|  BnaA03g40330D                                          209   1e-58   
ref|NP_001190589.1|  U-box domain-containing protein 51                 209   1e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42870.1|  BnaAnng06950D                                          208   2e-58   Brassica napus [oilseed rape]
ref|XP_009130168.1|  PREDICTED: U-box domain-containing protein 51      207   6e-58   
ref|XP_009136489.1|  PREDICTED: U-box domain-containing protein 51      206   9e-58   Brassica rapa
emb|CDY68766.1|  BnaCnng60400D                                          206   1e-57   Brassica napus [oilseed rape]
ref|XP_002460191.1|  hypothetical protein SORBIDRAFT_02g024310          206   1e-57   
emb|CDY23058.1|  BnaC07g31290D                                          205   3e-57   Brassica napus [oilseed rape]
ref|XP_008652694.1|  PREDICTED: U-box domain-containing protein 5...    204   6e-57   
tpg|DAA61370.1|  TPA: putative U-box domain protein kinase family       203   6e-57   
ref|XP_008652693.1|  PREDICTED: U-box domain-containing protein 3...    204   7e-57   
ref|XP_008652691.1|  PREDICTED: U-box domain-containing protein 3...    204   1e-56   Zea mays [maize]
ref|XP_004986806.1|  PREDICTED: U-box domain-containing protein 3...    203   1e-56   
ref|XP_010229355.1|  PREDICTED: U-box domain-containing protein 5...    201   1e-55   Brachypodium distachyon [annual false brome]
gb|ACF22762.1|  protein kinase                                          201   1e-55   Brachypodium distachyon [annual false brome]
emb|CDY61455.1|  BnaC09g53040D                                          199   3e-55   Brassica napus [oilseed rape]
ref|NP_001065387.1|  Os10g0561500                                       199   3e-55   
gb|EAY79520.1|  hypothetical protein OsI_34648                          198   7e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_010229351.1|  PREDICTED: U-box domain-containing protein 3...    196   7e-54   
ref|XP_010229349.1|  PREDICTED: U-box domain-containing protein 3...    196   7e-54   Brachypodium distachyon [annual false brome]
emb|CDY16812.1|  BnaA09g05700D                                          190   6e-52   Brassica napus [oilseed rape]
ref|XP_007154626.1|  hypothetical protein PHAVU_003G134500g             187   4e-51   Phaseolus vulgaris [French bean]
gb|ABF93478.1|  U-box domain containing protein, expressed              185   8e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010468808.1|  PREDICTED: U-box domain-containing protein 3...    176   1e-50   Camelina sativa [gold-of-pleasure]
gb|ABF93477.1|  U-box domain containing protein, expressed              185   3e-50   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048651.1|  Os03g0101200                                       185   3e-50   
gb|KEH32488.1|  U-box kinase family protein                             183   4e-50   Medicago truncatula
ref|XP_003550626.1|  PREDICTED: U-box domain-containing protein 3...    184   6e-50   Glycine max [soybeans]
gb|KHN17687.1|  U-box domain-containing protein 34                      184   7e-50   Glycine soja [wild soybean]
gb|KEH32487.1|  U-box kinase family protein                             184   1e-49   Medicago truncatula
ref|XP_004507961.1|  PREDICTED: U-box domain-containing protein 3...    183   1e-49   Cicer arietinum [garbanzo]
ref|XP_009102157.1|  PREDICTED: U-box domain-containing protein 34      182   4e-49   Brassica rapa
emb|CDY39152.1|  BnaA07g01480D                                          182   4e-49   Brassica napus [oilseed rape]
ref|XP_002883993.1|  kinase family protein                              182   4e-49   
gb|EMT03132.1|  U-box domain-containing protein 52                      180   1e-48   
ref|XP_006451528.1|  hypothetical protein CICLE_v10007527mg             181   1e-48   Citrus clementina [clementine]
ref|XP_006475494.1|  PREDICTED: U-box domain-containing protein 3...    181   1e-48   Citrus sinensis [apfelsine]
ref|XP_002991386.1|  ubiquitin-protein ligase, PUB52                    176   1e-48   
gb|EMS53909.1|  U-box domain-containing protein 52                      180   2e-48   Triticum urartu
ref|NP_179531.1|  U-box domain-containing protein 34                    180   2e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42871.1|  BnaAnng06960D                                          180   3e-48   Brassica napus [oilseed rape]
ref|XP_010526382.1|  PREDICTED: U-box domain-containing protein 3...    180   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_010047530.1|  PREDICTED: U-box domain-containing protein 3...    180   3e-48   Eucalyptus grandis [rose gum]
ref|XP_010656166.1|  PREDICTED: U-box domain-containing protein 34      179   3e-48   Vitis vinifera
ref|XP_010526384.1|  PREDICTED: U-box domain-containing protein 3...    179   4e-48   
ref|XP_002864494.1|  kinase family protein                              179   4e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_006409059.1|  hypothetical protein EUTSA_v10022572mg             179   4e-48   
ref|XP_010443372.1|  PREDICTED: U-box domain-containing protein 3...    179   5e-48   Camelina sativa [gold-of-pleasure]
emb|CDY12864.1|  BnaC07g15690D                                          179   6e-48   Brassica napus [oilseed rape]
emb|CDY01401.1|  BnaA07g11740D                                          179   7e-48   
ref|XP_007012759.1|  U-box domain-containing protein kinase famil...    178   7e-48   Theobroma cacao [chocolate]
ref|XP_009361646.1|  PREDICTED: U-box domain-containing protein 34      178   8e-48   Pyrus x bretschneideri [bai li]
gb|EMT03130.1|  hypothetical protein F775_44103                         176   8e-48   
ref|XP_006401251.1|  hypothetical protein EUTSA_v10012732mg             178   8e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010451758.1|  PREDICTED: U-box domain-containing protein 3...    178   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010489483.1|  PREDICTED: U-box domain-containing protein 3...    179   9e-48   
ref|XP_010483198.1|  PREDICTED: U-box domain-containing protein 3...    178   1e-47   Camelina sativa [gold-of-pleasure]
ref|NP_680448.2|  U-box domain-containing protein kinase family p...    177   2e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82677.1|  BnaC07g01890D                                          177   3e-47   
ref|XP_010415320.1|  PREDICTED: U-box domain-containing protein 3...    177   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010696545.1|  PREDICTED: U-box domain-containing protein 3...    176   4e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010467886.1|  PREDICTED: U-box domain-containing protein 3...    177   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010696543.1|  PREDICTED: U-box domain-containing protein 3...    176   5e-47   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX82676.1|  BnaC07g01900D                                          177   5e-47   
ref|XP_010696544.1|  PREDICTED: U-box domain-containing protein 3...    176   5e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT16103.1|  U-box domain-containing protein 35                      177   6e-47   
ref|XP_006280021.1|  hypothetical protein CARUB_v10025897mg             176   7e-47   
ref|XP_009132151.1|  PREDICTED: U-box domain-containing protein 3...    176   8e-47   Brassica rapa
ref|XP_010540161.1|  PREDICTED: U-box domain-containing protein 34      175   9e-47   Tarenaya hassleriana [spider flower]
ref|XP_004141173.1|  PREDICTED: U-box domain-containing protein 3...    174   2e-46   
ref|XP_010090090.1|  U-box domain-containing protein 34                 174   2e-46   Morus notabilis
ref|XP_004157961.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    174   2e-46   
ref|XP_008459500.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    174   2e-46   Cucumis melo [Oriental melon]
ref|XP_006843201.1|  hypothetical protein AMTR_s00146p00101260          171   3e-46   
emb|CDX88604.1|  BnaA03g10450D                                          174   3e-46   
emb|CDY11888.1|  BnaC03g13140D                                          174   4e-46   Brassica napus [oilseed rape]
ref|XP_010247373.1|  PREDICTED: U-box domain-containing protein 34      166   5e-46   
ref|XP_002514100.1|  ATP binding protein, putative                      173   7e-46   
ref|XP_002309208.2|  hypothetical protein POPTR_0006s14900g             172   7e-46   Populus trichocarpa [western balsam poplar]
emb|CDY38258.1|  BnaA10g11060D                                          173   7e-46   Brassica napus [oilseed rape]
gb|KFK40304.1|  hypothetical protein AALP_AA3G357700                    175   8e-46   Arabis alpina [alpine rockcress]
emb|CDP03134.1|  unnamed protein product                                172   9e-46   Coffea canephora [robusta coffee]
ref|XP_002983700.1|  hypothetical protein SELMODRAFT_33560              167   1e-45   
ref|XP_011460377.1|  PREDICTED: U-box domain-containing protein 3...    172   1e-45   Fragaria vesca subsp. vesca
ref|XP_002989031.1|  hypothetical protein SELMODRAFT_23109              167   1e-45   
ref|XP_008242172.1|  PREDICTED: U-box domain-containing protein 3...    172   1e-45   Prunus mume [ume]
ref|XP_004287584.1|  PREDICTED: U-box domain-containing protein 3...    172   1e-45   Fragaria vesca subsp. vesca
ref|XP_011003352.1|  PREDICTED: U-box domain-containing protein 3...    170   3e-45   Populus euphratica
gb|KDP33866.1|  hypothetical protein JCGZ_07437                         171   4e-45   Jatropha curcas
ref|XP_011003351.1|  PREDICTED: U-box domain-containing protein 3...    170   4e-45   Populus euphratica
emb|CDY54384.1|  BnaC09g53680D                                          171   5e-45   Brassica napus [oilseed rape]
ref|NP_001056893.1|  Os06g0163000                                       171   6e-45   
ref|XP_006299930.1|  hypothetical protein CARUB_v10016139mg             171   7e-45   
gb|EEC80073.1|  hypothetical protein OsI_21792                          170   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_008242171.1|  PREDICTED: U-box domain-containing protein 3...    169   2e-44   Prunus mume [ume]
ref|XP_007204644.1|  hypothetical protein PRUPE_ppa001685mg             169   2e-44   
gb|ABK95716.1|  unknown                                                 166   7e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002511867.1|  receptor protein kinase, putative                  161   7e-44   
gb|AID16050.1|  putative universal stress protein                       167   7e-44   Catharanthus roseus [chatas]
ref|XP_011023325.1|  PREDICTED: U-box domain-containing protein 3...    168   8e-44   Populus euphratica
ref|XP_001692915.1|  predicted protein                                  162   1e-43   Chlamydomonas reinhardtii
gb|KFK27262.1|  hypothetical protein AALP_AA8G359100                    166   2e-43   Arabis alpina [alpine rockcress]
ref|XP_008354447.1|  PREDICTED: U-box domain-containing protein 3...    166   2e-43   
ref|XP_008362979.1|  PREDICTED: U-box domain-containing protein 3...    166   2e-43   
gb|EMS60877.1|  U-box domain-containing protein 34                      160   2e-43   Triticum urartu
ref|XP_010467887.1|  PREDICTED: U-box domain-containing protein 3...    166   2e-43   
ref|XP_010227577.1|  PREDICTED: U-box domain-containing protein 3...    166   3e-43   
ref|XP_010227578.1|  PREDICTED: U-box domain-containing protein 3...    165   3e-43   Brachypodium distachyon [annual false brome]
ref|XP_006353585.1|  PREDICTED: U-box domain-containing protein 3...    165   6e-43   
ref|XP_003560635.2|  PREDICTED: U-box domain-containing protein 3...    164   6e-43   Brachypodium distachyon [annual false brome]
ref|XP_002320134.2|  U-box domain-containing family protein             165   7e-43   
ref|XP_002301358.2|  U-box domain-containing family protein             165   8e-43   
ref|XP_007051793.1|  U-box domain-containing protein kinase famil...    166   8e-43   Theobroma cacao [chocolate]
gb|EYU28374.1|  hypothetical protein MIMGU_mgv1a005889mg                162   8e-43   Erythranthe guttata [common monkey flower]
ref|XP_011036393.1|  PREDICTED: U-box domain-containing protein 3...    165   9e-43   
gb|EMT09216.1|  hypothetical protein F775_52521                         164   1e-42   
gb|EAZ37432.1|  hypothetical protein OsJ_21768                          163   1e-42   
ref|XP_008352700.1|  PREDICTED: U-box domain-containing protein 3...    158   1e-42   
gb|EAZ01421.1|  hypothetical protein OsI_23455                          163   2e-42   
ref|NP_001057924.1|  Os06g0574200                                       163   3e-42   
ref|XP_004492743.1|  PREDICTED: U-box domain-containing protein 3...    164   3e-42   
ref|XP_004492744.1|  PREDICTED: U-box domain-containing protein 3...    164   3e-42   
ref|XP_003623970.1|  U-box domain-containing protein                    164   3e-42   
gb|ABD32822.1|  Protein kinase; U box                                   164   3e-42   
ref|XP_009604176.1|  PREDICTED: U-box domain-containing protein 3...    162   4e-42   
ref|XP_008671148.1|  PREDICTED: U-box domain-containing protein 3...    161   4e-42   
ref|NP_001047666.1|  Os02g0665500                                       158   6e-42   
ref|XP_004966034.1|  PREDICTED: U-box domain-containing protein 3...    162   8e-42   
ref|XP_002451775.1|  hypothetical protein SORBIDRAFT_04g007630          161   9e-42   
ref|XP_009779501.1|  PREDICTED: U-box domain-containing protein 3...    160   1e-41   
ref|XP_009779502.1|  PREDICTED: U-box domain-containing protein 3...    160   1e-41   
ref|XP_003564276.1|  PREDICTED: U-box domain-containing protein 3...    161   1e-41   
ref|XP_010324040.1|  PREDICTED: U-box domain-containing protein 3...    160   1e-41   
ref|XP_004155827.1|  PREDICTED: U-box domain-containing protein 3...    155   2e-41   
ref|XP_009597494.1|  PREDICTED: U-box domain-containing protein 3...    160   2e-41   
gb|EMS67875.1|  U-box domain-containing protein 33                      160   2e-41   
ref|XP_009779500.1|  PREDICTED: U-box domain-containing protein 3...    160   2e-41   
ref|XP_009340098.1|  PREDICTED: U-box domain-containing protein 3...    161   2e-41   
ref|XP_009779499.1|  PREDICTED: U-box domain-containing protein 3...    160   2e-41   
dbj|BAK00360.1|  predicted protein                                      160   2e-41   
ref|XP_009597479.1|  PREDICTED: U-box domain-containing protein 3...    160   2e-41   
ref|XP_004252067.1|  PREDICTED: U-box domain-containing protein 34      160   2e-41   
ref|XP_010661796.1|  PREDICTED: U-box domain-containing protein 3...    161   2e-41   
ref|XP_009597475.1|  PREDICTED: U-box domain-containing protein 3...    160   2e-41   
ref|XP_009597487.1|  PREDICTED: U-box domain-containing protein 3...    160   3e-41   
ref|XP_011078027.1|  PREDICTED: U-box domain-containing protein 34      160   3e-41   
ref|XP_002274993.2|  PREDICTED: U-box domain-containing protein 3...    161   3e-41   
emb|CAN67166.1|  hypothetical protein VITISV_015820                     160   3e-41   
gb|KDO86177.1|  hypothetical protein CISIN_1g002719mg                   158   3e-41   
gb|KHM99371.1|  U-box domain-containing protein 33                      160   4e-41   
ref|XP_009604175.1|  PREDICTED: U-box domain-containing protein 3...    159   5e-41   
ref|XP_003552396.1|  PREDICTED: U-box domain-containing protein 3...    160   5e-41   
ref|XP_006657074.1|  PREDICTED: U-box domain-containing protein 3...    159   5e-41   
ref|XP_003576876.1|  PREDICTED: U-box domain-containing protein 3...    159   6e-41   
tpg|DAA36482.1|  TPA: putative U-box domain protein kinase family       160   6e-41   
ref|XP_002438607.1|  hypothetical protein SORBIDRAFT_10g022690          159   6e-41   
ref|XP_008659702.1|  PREDICTED: U-box domain-containing protein 3...    159   8e-41   
ref|XP_002437884.1|  hypothetical protein SORBIDRAFT_10g004400          159   9e-41   
gb|KDO86176.1|  hypothetical protein CISIN_1g002719mg                   157   9e-41   
gb|KDP28621.1|  hypothetical protein JCGZ_14392                         159   2e-40   
gb|AFW87025.1|  putative U-box domain protein kinase family             157   2e-40   
ref|XP_004243743.1|  PREDICTED: U-box domain-containing protein 3...    158   2e-40   
gb|AFW66044.1|  putative U-box domain protein kinase family             157   2e-40   
ref|XP_009762433.1|  PREDICTED: U-box domain-containing protein 3...    157   2e-40   
ref|NP_001046306.2|  Os02g0218600                                       158   3e-40   
ref|XP_006342326.1|  PREDICTED: U-box domain-containing protein 3...    156   4e-40   
ref|XP_004951442.1|  PREDICTED: U-box domain-containing protein 3...    155   4e-40   
ref|XP_007220262.1|  hypothetical protein PRUPE_ppa001267mg             158   4e-40   
gb|EAZ22253.1|  hypothetical protein OsJ_05908                          157   4e-40   
gb|EAY86992.1|  hypothetical protein OsI_08386                          158   5e-40   
gb|KJB09820.1|  hypothetical protein B456_001G169300                    156   5e-40   
gb|KDO86175.1|  hypothetical protein CISIN_1g002719mg                   157   5e-40   
ref|XP_010234043.1|  PREDICTED: U-box domain-containing protein 3...    157   5e-40   
ref|XP_008438039.1|  PREDICTED: U-box domain-containing protein 3...    156   6e-40   
emb|CDP08807.1|  unnamed protein product                                155   6e-40   
ref|NP_001173108.1|  Os02g0665700                                       150   7e-40   
ref|XP_006342325.1|  PREDICTED: U-box domain-containing protein 3...    156   8e-40   
ref|XP_010241939.1|  PREDICTED: U-box domain-containing protein 3...    157   9e-40   
dbj|BAD17181.1|  putative serine threonine kinase                       157   1e-39   
gb|KJB65211.1|  hypothetical protein B456_010G084700                    155   1e-39   
ref|XP_002459853.1|  hypothetical protein SORBIDRAFT_02g012390          151   1e-39   
gb|KDO86171.1|  hypothetical protein CISIN_1g002719mg                   157   1e-39   
gb|EYU32126.1|  hypothetical protein MIMGU_mgv1a001191mg                156   1e-39   
gb|EAY85031.1|  hypothetical protein OsI_06388                          156   1e-39   
gb|KJB65210.1|  hypothetical protein B456_010G084700                    155   1e-39   
gb|KJB09821.1|  hypothetical protein B456_001G169300                    156   1e-39   
ref|XP_008679841.1|  PREDICTED: U-box domain-containing protein 3...    155   1e-39   
gb|KJB09822.1|  hypothetical protein B456_001G169300                    156   1e-39   
gb|KJB09824.1|  hypothetical protein B456_001G169300                    156   1e-39   
ref|XP_008338844.1|  PREDICTED: U-box domain-containing protein 33      156   1e-39   
ref|XP_010255340.1|  PREDICTED: U-box domain-containing protein 3...    156   2e-39   
ref|XP_008679840.1|  PREDICTED: U-box domain-containing protein 3...    155   2e-39   
ref|XP_010241880.1|  PREDICTED: U-box domain-containing protein 3...    155   2e-39   
ref|XP_009408916.1|  PREDICTED: U-box domain-containing protein 3...    154   2e-39   
ref|NP_001063982.1|  Os09g0570000                                       150   2e-39   
ref|XP_003534561.1|  PREDICTED: U-box domain-containing protein 3...    155   2e-39   
ref|XP_006648456.1|  PREDICTED: U-box domain-containing protein 3...    154   2e-39   
ref|XP_002318809.1|  kinase family protein                              154   3e-39   
gb|KHN29352.1|  U-box domain-containing protein 33                      155   3e-39   
ref|XP_008234211.1|  PREDICTED: U-box domain-containing protein 32      155   3e-39   
ref|XP_009411514.1|  PREDICTED: U-box domain-containing protein 3...    155   3e-39   
ref|XP_009629842.1|  PREDICTED: U-box domain-containing protein 3...    155   3e-39   
ref|XP_009629843.1|  PREDICTED: U-box domain-containing protein 3...    155   3e-39   
ref|XP_006445027.1|  hypothetical protein CICLE_v10018795mg             155   3e-39   
ref|XP_004496550.1|  PREDICTED: U-box domain-containing protein 3...    154   4e-39   
ref|XP_002301359.1|  hypothetical protein POPTR_0002s16160g             154   4e-39   
ref|XP_008232891.1|  PREDICTED: U-box domain-containing protein 3...    155   4e-39   
ref|XP_010670312.1|  PREDICTED: U-box domain-containing protein 3...    155   4e-39   
ref|XP_010670307.1|  PREDICTED: U-box domain-containing protein 3...    155   4e-39   
ref|XP_011469012.1|  PREDICTED: U-box domain-containing protein 3...    155   5e-39   
gb|EPS70423.1|  hypothetical protein M569_04335                         153   5e-39   
ref|XP_004306778.1|  PREDICTED: U-box domain-containing protein 3...    155   5e-39   
ref|XP_007139837.1|  hypothetical protein PHAVU_008G062200g             154   5e-39   
ref|XP_007139838.1|  hypothetical protein PHAVU_008G062200g             154   5e-39   
ref|XP_010241879.1|  PREDICTED: U-box domain-containing protein 3...    154   5e-39   
ref|XP_010241877.1|  PREDICTED: U-box domain-containing protein 3...    154   5e-39   
ref|XP_007220228.1|  hypothetical protein PRUPE_ppa002129mg             153   5e-39   
dbj|BAD46228.1|  putative serine/threonine protein kinase               150   5e-39   
ref|XP_009408917.1|  PREDICTED: U-box domain-containing protein 3...    153   6e-39   
ref|XP_010106466.1|  U-box domain-containing protein 33                 154   6e-39   
ref|XP_009629845.1|  PREDICTED: U-box domain-containing protein 3...    154   6e-39   
ref|XP_004951441.1|  PREDICTED: U-box domain-containing protein 3...    153   6e-39   
ref|XP_009629844.1|  PREDICTED: U-box domain-containing protein 3...    154   7e-39   
ref|XP_011023324.1|  PREDICTED: U-box domain-containing protein 3...    152   8e-39   
ref|XP_004956230.1|  PREDICTED: U-box domain-containing protein 3...    154   9e-39   
ref|XP_011023323.1|  PREDICTED: U-box domain-containing protein 3...    152   9e-39   
ref|XP_004956232.1|  PREDICTED: U-box domain-containing protein 3...    153   1e-38   
ref|XP_009367847.1|  PREDICTED: U-box domain-containing protein 3...    153   1e-38   
ref|XP_011092453.1|  PREDICTED: U-box domain-containing protein 33      154   1e-38   
gb|AID16031.1|  putative universal stress protein                       154   1e-38   
ref|XP_009340053.1|  PREDICTED: U-box domain-containing protein 32      153   1e-38   
ref|XP_006576315.1|  PREDICTED: U-box domain-containing protein 3...    152   1e-38   
ref|XP_006583292.1|  PREDICTED: U-box domain-containing protein 3...    153   1e-38   
ref|XP_006661003.1|  PREDICTED: U-box domain-containing protein 3...    151   1e-38   
ref|XP_006583291.1|  PREDICTED: U-box domain-containing protein 3...    153   1e-38   
ref|XP_011023322.1|  PREDICTED: U-box domain-containing protein 3...    152   1e-38   
gb|EMS46585.1|  U-box domain-containing protein 33                      152   2e-38   
ref|XP_010087958.1|  U-box domain-containing protein 33                 153   2e-38   
ref|XP_006606131.1|  PREDICTED: U-box domain-containing protein 3...    151   2e-38   
ref|XP_009367846.1|  PREDICTED: U-box domain-containing protein 3...    153   2e-38   
ref|XP_011030135.1|  PREDICTED: U-box domain-containing protein 3...    152   2e-38   
gb|KHN06633.1|  U-box domain-containing protein 34                      148   2e-38   
ref|NP_182115.2|  U-box domain-containing protein 33                    152   2e-38   
ref|XP_002880206.1|  kinase family protein                              152   2e-38   
gb|AAC28534.1|  putative protein kinase                                 152   2e-38   
ref|XP_004964767.1|  PREDICTED: U-box domain-containing protein 3...    152   2e-38   
ref|XP_006661002.1|  PREDICTED: U-box domain-containing protein 3...    151   2e-38   
gb|AAO00872.1|  putative protein kinase                                 152   2e-38   
ref|XP_008438038.1|  PREDICTED: U-box domain-containing protein 3...    152   3e-38   
ref|XP_004134324.1|  PREDICTED: U-box domain-containing protein 3...    152   3e-38   
ref|XP_011030136.1|  PREDICTED: U-box domain-containing protein 3...    152   3e-38   
ref|XP_004955133.1|  PREDICTED: U-box domain-containing protein 3...    152   3e-38   
emb|CBI16147.3|  unnamed protein product                                152   3e-38   
ref|XP_003632149.1|  PREDICTED: U-box domain-containing protein 3...    152   3e-38   
gb|KDO72868.1|  hypothetical protein CISIN_1g003481mg                   150   4e-38   
ref|XP_006606130.1|  PREDICTED: U-box domain-containing protein 3...    151   4e-38   
gb|EMT09985.1|  U-box domain-containing protein 33                      150   4e-38   
gb|EMT30297.1|  U-box domain-containing protein 33                      152   4e-38   
ref|XP_006293675.1|  hypothetical protein CARUB_v10022633mg             152   4e-38   
gb|KDO72867.1|  hypothetical protein CISIN_1g003481mg                   150   5e-38   
gb|KCW71594.1|  hypothetical protein EUGRSUZ_E00122                     151   5e-38   
ref|XP_006606129.1|  PREDICTED: U-box domain-containing protein 3...    150   6e-38   
ref|XP_010255335.1|  PREDICTED: U-box domain-containing protein 3...    152   6e-38   
gb|KHN26961.1|  U-box domain-containing protein 33                      152   6e-38   
ref|XP_009773953.1|  PREDICTED: U-box domain-containing protein 3...    151   6e-38   
ref|XP_009773960.1|  PREDICTED: U-box domain-containing protein 3...    151   6e-38   
gb|KHN21763.1|  U-box domain-containing protein 32                      150   7e-38   
gb|ABB47963.2|  U-box domain containing protein, expressed              151   7e-38   
ref|XP_003521882.1|  PREDICTED: U-box domain-containing protein 3...    151   7e-38   
ref|XP_006576313.1|  PREDICTED: U-box domain-containing protein 3...    151   7e-38   
ref|XP_006589533.1|  PREDICTED: U-box domain-containing protein 3...    150   7e-38   
gb|KHN42195.1|  U-box domain-containing protein 33                      151   8e-38   
ref|XP_003592256.1|  U-box domain-containing protein                    149   8e-38   
ref|XP_006589534.1|  PREDICTED: U-box domain-containing protein 3...    150   8e-38   
gb|EAZ10148.1|  hypothetical protein OsI_32463                          150   8e-38   
ref|XP_008793291.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    152   9e-38   
ref|XP_010670277.1|  PREDICTED: U-box domain-containing protein 3...    151   9e-38   
ref|XP_010670301.1|  PREDICTED: U-box domain-containing protein 3...    150   1e-37   
gb|EMT08167.1|  U-box domain-containing protein 33                      151   1e-37   
gb|KDP22258.1|  hypothetical protein JCGZ_26089                         150   1e-37   
gb|KDP28620.1|  hypothetical protein JCGZ_14391                         150   1e-37   
ref|XP_004160207.1|  PREDICTED: U-box domain-containing protein 3...    149   1e-37   
ref|XP_007143438.1|  hypothetical protein PHAVU_007G072300g             149   1e-37   
ref|XP_004143203.1|  PREDICTED: U-box domain-containing protein 3...    149   1e-37   
ref|XP_010670296.1|  PREDICTED: U-box domain-containing protein 3...    150   1e-37   
ref|XP_007143439.1|  hypothetical protein PHAVU_007G072300g             149   1e-37   
gb|EEC67399.1|  hypothetical protein OsI_34560                          150   1e-37   
gb|KHN12148.1|  U-box domain-containing protein 33                      150   1e-37   
ref|XP_010918573.1|  PREDICTED: U-box domain-containing protein 3...    150   1e-37   
gb|AES62507.2|  tyrosine kinase family protein                          149   1e-37   
ref|XP_010925536.1|  PREDICTED: U-box domain-containing protein 34      151   1e-37   
ref|XP_008778874.1|  PREDICTED: U-box domain-containing protein 3...    149   1e-37   
gb|KEH43690.1|  tyrosine kinase family protein                          149   1e-37   
ref|XP_008464136.1|  PREDICTED: U-box domain-containing protein 3...    150   1e-37   
gb|AAK43512.1|AC020666_22  putative receptor kinase                     150   2e-37   
ref|XP_010248152.1|  PREDICTED: U-box domain-containing protein 3...    147   2e-37   
ref|NP_001065306.1|  Os10g0548700                                       150   2e-37   
gb|EEE57531.1|  hypothetical protein OsJ_07848                          150   2e-37   
ref|XP_004956231.1|  PREDICTED: U-box domain-containing protein 3...    150   2e-37   
ref|XP_010662714.1|  PREDICTED: U-box domain-containing protein 3...    149   2e-37   
ref|XP_007016430.1|  U-box domain-containing protein kinase famil...    150   2e-37   
ref|XP_010055116.1|  PREDICTED: U-box domain-containing protein 33      150   2e-37   
gb|KDO72865.1|  hypothetical protein CISIN_1g003481mg                   150   2e-37   
gb|EAY86993.1|  hypothetical protein OsI_08387                          150   2e-37   
ref|XP_010506575.1|  PREDICTED: U-box domain-containing protein 3...    150   2e-37   
ref|XP_007143436.1|  hypothetical protein PHAVU_007G072300g             149   2e-37   
ref|XP_010662713.1|  PREDICTED: U-box domain-containing protein 3...    149   2e-37   
ref|XP_007143437.1|  hypothetical protein PHAVU_007G072300g             149   3e-37   
gb|KEH39429.1|  U-box kinase family protein                             148   3e-37   
gb|KDO72866.1|  hypothetical protein CISIN_1g003481mg                   149   3e-37   
ref|XP_009773947.1|  PREDICTED: U-box domain-containing protein 3...    149   3e-37   
ref|XP_009773940.1|  PREDICTED: U-box domain-containing protein 3...    149   3e-37   
ref|XP_009400254.1|  PREDICTED: U-box domain-containing protein 3...    149   4e-37   
ref|XP_007132069.1|  hypothetical protein PHAVU_011G064400g             149   4e-37   
gb|KGN47155.1|  hypothetical protein Csa_6G190460                       149   4e-37   
ref|XP_002454510.1|  hypothetical protein SORBIDRAFT_04g032450          149   4e-37   
gb|AFW63306.1|  putative U-box domain protein kinase family             149   5e-37   
ref|XP_008678920.1|  PREDICTED: U-box domain-containing protein 33      148   7e-37   
ref|XP_008778865.1|  PREDICTED: U-box domain-containing protein 3...    148   8e-37   
ref|XP_010518237.1|  PREDICTED: U-box domain-containing protein 3...    148   9e-37   
ref|XP_006339578.1|  PREDICTED: U-box domain-containing protein 3...    148   1e-36   
ref|XP_009386200.1|  PREDICTED: U-box domain-containing protein 3...    148   1e-36   
gb|EMS50016.1|  U-box domain-containing protein 35                      147   1e-36   
ref|XP_009758746.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    145   1e-36   
ref|XP_010671850.1|  PREDICTED: U-box domain-containing protein 33      148   1e-36   
ref|XP_008778858.1|  PREDICTED: U-box domain-containing protein 3...    148   1e-36   
ref|XP_006488315.1|  PREDICTED: U-box domain-containing protein 3...    147   1e-36   
ref|XP_006424819.1|  hypothetical protein CICLE_v10027788mg             147   1e-36   
ref|XP_008784570.1|  PREDICTED: U-box domain-containing protein 3...    147   2e-36   
ref|XP_008379884.1|  PREDICTED: U-box domain-containing protein 32      147   2e-36   
gb|KEH39428.1|  U-box kinase family protein                             147   2e-36   
ref|XP_006348991.1|  PREDICTED: U-box domain-containing protein 3...    147   2e-36   
ref|XP_002513684.1|  receptor protein kinase, putative                  146   3e-36   
ref|XP_006397759.1|  hypothetical protein EUTSA_v10001310mg             147   3e-36   
ref|XP_006490424.1|  PREDICTED: U-box domain-containing protein 3...    146   3e-36   



>ref|XP_002510995.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF51597.1| receptor protein kinase, putative [Ricinus communis]
Length=466

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ETGPVGT+CYIDPEY R+GLIS KSDVYA GMVILQLLTAK AI LTH++E AID D L 
Sbjct  272  ETGPVGTLCYIDPEYQRSGLISSKSDVYAFGMVILQLLTAKPAIALTHMMEAAIDDDRLS  331

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD+EAGKWP EETKELA+L L C EL+R+DRPDLKD +LP LE+LK+VA++A++  S 
Sbjct  332  EMLDSEAGKWPLEETKELALLGLSCAELRRRDRPDLKDQVLPTLERLKEVADRARDTISK  391

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKD+M DPCVAADGYTYDR+AIE WL  N+ S MTNL L +KNLLPN
Sbjct  392  VQRTPPNHFICPILKDIMFDPCVAADGYTYDRRAIEKWLEVNDKSLMTNLALANKNLLPN  451

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKS  Q
Sbjct  452  YTLLSAIMEWKSSNQ  466



>ref|XP_009588521.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
tomentosiformis]
 ref|XP_009588522.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
tomentosiformis]
Length=813

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTG+ISPKSDVYA GMV+LQLLTAK A+GL HIVETAID D+L 
Sbjct  616  DTGPVGTLCYIDPEYQRTGMISPKSDVYAFGMVLLQLLTAKAAMGLPHIVETAIDKDSLT  675

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD++AG+WP EETK+LA LAL+CTE+ R+DRPDLKD ILP L++LK VA++A++ AS 
Sbjct  676  KVLDSKAGEWPLEETKKLAALALKCTEISRRDRPDLKDEILPALKRLKVVADKARDSAST  735

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
              PPPP Y++CP+LKDVME+PCVAADGYTYDRKAIE+WL EN+ SPMTNLPLPHKNLLPN
Sbjct  736  TRPPPPTYYLCPLLKDVMEEPCVAADGYTYDRKAIETWLKENDISPMTNLPLPHKNLLPN  795

Query  200  YTILSAITVWKSGK  159
            Y +LSAI  WKS K
Sbjct  796  YALLSAILDWKSRK  809



>ref|XP_009771774.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
 ref|XP_009771775.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
 ref|XP_009771776.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
 ref|XP_009771777.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=815

 Score =   278 bits (712),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTG+ISPKSDVYA GMV+LQLLTAK  +GL HIVETAID D+L 
Sbjct  618  DTGPVGTLCYIDPEYQRTGMISPKSDVYAFGMVLLQLLTAKAPMGLPHIVETAIDKDSLT  677

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD++AG+WP EETK+LA LAL+CTE+ R+DRPDLK+ ILP LEKLK+VAN+A++ AS 
Sbjct  678  KVLDSKAGEWPLEETKKLAALALKCTEICRRDRPDLKEEILPALEKLKEVANKARDSAST  737

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
              PPPP Y++CP+LKDVME+PCVAADGYTYDRKAIE+WL +N+ SPMTNLPLPHKNLLPN
Sbjct  738  TRPPPPTYYLCPLLKDVMEEPCVAADGYTYDRKAIETWLKDNDISPMTNLPLPHKNLLPN  797

Query  200  YTILSAITVWKSGK  159
            Y +LSAI  WKS K
Sbjct  798  YALLSAILDWKSRK  811



>ref|XP_006358228.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Solanum tuberosum]
 ref|XP_006358229.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Solanum tuberosum]
Length=809

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISP SD+YA GMV+LQLLTAK A+GL HIVETAID D L 
Sbjct  617  DTGPVGTLCYIDPEYQRTGLISPTSDIYAFGMVLLQLLTAKAAMGLPHIVETAIDKDNLT  676

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD EAGKWP EETK+LA+LAL+CTEL R+DRPDLKD ILP LEKLK+ A++ ++ AS 
Sbjct  677  KVLDPEAGKWPIEETKKLAMLALKCTELYRRDRPDLKDEILPALEKLKEFADKTRDSAST  736

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               PPPNYF+CP+LKD+M+DPCVAADG+TYDR AIE+WL E + SPMT+LPL HKNLLPN
Sbjct  737  TKSPPPNYFLCPLLKDIMKDPCVAADGFTYDRNAIETWLKEKDISPMTSLPLAHKNLLPN  796

Query  200  YTILSAITVWKS  165
            Y +LSAI  WKS
Sbjct  797  YALLSAILDWKS  808



>gb|KJB07883.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
Length=727

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSD+YA GM+ILQLLTAK AI LTH+VETAID D L 
Sbjct  533  DTGPVGTLCYIDPEYQRTGLISPKSDIYAFGMIILQLLTAKPAIALTHVVETAIDDDNLT  592

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD+EAG WP EETKELA+L L C EL+RKDRP LKD +LP+LEK+K+VAN+A+   S 
Sbjct  593  RILDSEAGNWPVEETKELAILGLSCAELRRKDRPGLKDRVLPILEKMKEVANKARNSISN  652

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                 PN+F+CPI KDVM++PCVAADGYTY+RKAIE W+  N+ SPMTNL LP+KNLLPN
Sbjct  653  IQSAHPNHFICPISKDVMDEPCVAADGYTYERKAIEKWIETNDISPMTNLALPNKNLLPN  712

Query  200  YTILSAITVWKSGKQ  156
            Y++LSAI  WKS KQ
Sbjct  713  YSLLSAILEWKSRKQ  727



>gb|KDP22458.1| hypothetical protein JCGZ_26289 [Jatropha curcas]
Length=812

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI LTHI+ETAI+   L 
Sbjct  618  DTGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAIALTHIMETAIEDGNLA  677

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            EILD+ AG WP EETK+LA+L L C EL+RKDRPDLK+ +LP LE+LK+VA++A+ + S 
Sbjct  678  EILDSSAGNWPFEETKQLALLGLSCAELRRKDRPDLKEQVLPALERLKEVADRARNIISS  737

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A   PPN+F+CPILKDVM +PCVAADGYTYDRKAIE WL EN+ SP+TNLPL +K +LPN
Sbjct  738  AQCTPPNHFICPILKDVMMEPCVAADGYTYDRKAIEKWLEENDESPITNLPLSNKIVLPN  797

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKS  +
Sbjct  798  YTLLSAIIEWKSNNK  812



>emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera]
Length=804

 Score =   272 bits (696),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGL+SPKSDVYA GMV+LQLLTAK AI L H+VETAI  D L E
Sbjct  610  TGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLME  669

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP +ETKELA+L L C EL+R+DRPDLKD +LP LE+LKDVA+++++ A   
Sbjct  670  ILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDVADRSRDSAPKV  729

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PPN+F+CPILKDVM DPCVAADGYTYDR+AIE W+ EN+NSPMTNL LP+KNL+PNY
Sbjct  730  QLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNY  789

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  790  TLLSAIVEWKS  800



>gb|KHG01292.1| U-box domain-containing 35 -like protein [Gossypium arboreum]
Length=826

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSD+YA GM+ILQLLTAK AI LTH+VETAID D L 
Sbjct  632  DTGPVGTLCYIDPEYQRTGLISPKSDIYAFGMIILQLLTAKPAIALTHVVETAIDNDNLT  691

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD+EAG WP EETKELA+L L C EL+RKDRP LKD +LP+LEK+K+VAN+A+   S 
Sbjct  692  RILDSEAGNWPVEETKELAILGLSCAELRRKDRPGLKDRVLPILEKMKEVANKARNSISN  751

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                 PN+F+CPI KDVM++PCVAADGYTY+RKAIE W+  N+ SPMTNL LP+KNLLPN
Sbjct  752  IQSAHPNHFICPISKDVMDEPCVAADGYTYERKAIEKWIETNDISPMTNLALPNKNLLPN  811

Query  200  YTILSAITVWKSGKQ  156
            Y++LSAI  WKS KQ
Sbjct  812  YSLLSAILEWKSRKQ  826



>ref|XP_006421585.1| hypothetical protein CICLE_v10004338mg [Citrus clementina]
 gb|ESR34825.1| hypothetical protein CICLE_v10004338mg [Citrus clementina]
Length=757

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  566  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  625

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  626  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  685

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL EN+ SP+T+ PLP+KNLLPNY
Sbjct  686  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQENDKSPITDFPLPNKNLLPNY  745

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  746  TLLSAILDWKS  756



>ref|XP_006355617.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=847

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+S KSDVYA GMVILQLLTAK+AI L H+VE A + D L 
Sbjct  654  DTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTAKRAIALAHMVEMATEEDKLV  713

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG+WP EETKELAVLAL+CTEL+R+DRPDLKD +LP+LE+ K+VA++A+  +  
Sbjct  714  ELLDQEAGEWPLEETKELAVLALKCTELRRRDRPDLKDEVLPILERFKEVADRARH-SKY  772

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
              PPPP++F CP+LK+V++DPCVAADGYTYDRKAIESWL +N+NSP+TNLPLPHK+LLPN
Sbjct  773  NQPPPPSHFKCPLLKEVIQDPCVAADGYTYDRKAIESWLADNDNSPVTNLPLPHKHLLPN  832

Query  200  YTILSAITVWKSGKQ  156
            Y +LSAI  WKSGK 
Sbjct  833  YALLSAIKEWKSGKH  847



>gb|KJB07882.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
Length=821

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSD+YA GM+ILQLLTAK AI LTH+VETAID D L 
Sbjct  627  DTGPVGTLCYIDPEYQRTGLISPKSDIYAFGMIILQLLTAKPAIALTHVVETAIDDDNLT  686

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD+EAG WP EETKELA+L L C EL+RKDRP LKD +LP+LEK+K+VAN+A+   S 
Sbjct  687  RILDSEAGNWPVEETKELAILGLSCAELRRKDRPGLKDRVLPILEKMKEVANKARNSISN  746

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                 PN+F+CPI KDVM++PCVAADGYTY+RKAIE W+  N+ SPMTNL LP+KNLLPN
Sbjct  747  IQSAHPNHFICPISKDVMDEPCVAADGYTYERKAIEKWIETNDISPMTNLALPNKNLLPN  806

Query  200  YTILSAITVWKSGKQ  156
            Y++LSAI  WKS KQ
Sbjct  807  YSLLSAILEWKSRKQ  821



>gb|KJB07880.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
 gb|KJB07881.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
Length=819

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSD+YA GM+ILQLLTAK AI LTH+VETAID D L 
Sbjct  625  DTGPVGTLCYIDPEYQRTGLISPKSDIYAFGMIILQLLTAKPAIALTHVVETAIDDDNLT  684

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD+EAG WP EETKELA+L L C EL+RKDRP LKD +LP+LEK+K+VAN+A+   S 
Sbjct  685  RILDSEAGNWPVEETKELAILGLSCAELRRKDRPGLKDRVLPILEKMKEVANKARNSISN  744

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                 PN+F+CPI KDVM++PCVAADGYTY+RKAIE W+  N+ SPMTNL LP+KNLLPN
Sbjct  745  IQSAHPNHFICPISKDVMDEPCVAADGYTYERKAIEKWIETNDISPMTNLALPNKNLLPN  804

Query  200  YTILSAITVWKSGKQ  156
            Y++LSAI  WKS KQ
Sbjct  805  YSLLSAILEWKSRKQ  819



>gb|KDO45275.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
 gb|KDO45276.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=757

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  566  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  625

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  626  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  685

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL EN+ SP+T+LPLP+KNLLPNY
Sbjct  686  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQENDKSPITDLPLPNKNLLPNY  745

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  746  TLLSAILDWKS  756



>ref|XP_009768170.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=875

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+S KSDVYA GMVILQLLTAK+AI L H+VE AI+ D L 
Sbjct  682  DTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTAKRAIALAHMVEMAIEDDNLV  741

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG+WP EETKELAVLA++CTEL+R+DRPDLKD +LP LE+LK+VA++A+++  I
Sbjct  742  ELLDQEAGEWPIEETKELAVLAIKCTELRRRDRPDLKDEVLPALERLKEVADRARDLIYI  801

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               P P++F CP+LK+VM+DPCVAADGYTYDRKAIESWL +N++SP+TN PLPHK+LLPN
Sbjct  802  Q-SPSPSHFKCPLLKEVMQDPCVAADGYTYDRKAIESWLKDNDHSPVTNSPLPHKHLLPN  860

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKSGK 
Sbjct  861  YTLLSAIKEWKSGKH  875



>ref|XP_010662271.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Vitis vinifera]
Length=716

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGL+SPKSDVYA GMV+LQLLTAK AI L H+VETAI  D L +
Sbjct  522  TGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMK  581

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP +ETKELA+L L C EL+R+DRPDLKD +LP LE+LKD A+++++ A   
Sbjct  582  ILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKV  641

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PPN+F+CPILKDVM DPCVAADGYTYDR+AIE W+ EN+NSPMTNL LP+KNL+PNY
Sbjct  642  QLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNY  701

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  702  TLLSAIMEWKS  712



>ref|XP_009607007.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nicotiana tomentosiformis]
Length=844

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+S KSDVYA GMVILQLLTAK+AI L H+VE AI+ + L 
Sbjct  651  DTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTAKRAIALAHMVEMAIEDNNLV  710

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG+WP EETKELAVLA++CTEL+R+DRPDLKD +LP LE+LK+VA++A+++  I
Sbjct  711  ELLDQEAGEWPIEETKELAVLAIKCTELRRRDRPDLKDEVLPALERLKEVADRARDLIYI  770

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               P P++F CPILK+VM DPCVAADGYTYDRKAIESWL +N++SP+TN PLPHK LL N
Sbjct  771  L-SPSPSHFKCPILKEVMHDPCVAADGYTYDRKAIESWLKDNDHSPVTNSPLPHKQLLAN  829

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKSGK 
Sbjct  830  YTLLSAIKEWKSGKH  844



>gb|KDO45272.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=802

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  611  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  670

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  671  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  730

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL EN+ SP+T+LPLP+KNLLPNY
Sbjct  731  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQENDKSPITDLPLPNKNLLPNY  790

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  791  TLLSAILDWKS  801



>ref|XP_009607006.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nicotiana tomentosiformis]
Length=875

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+S KSDVYA GMVILQLLTAK+AI L H+VE AI+ + L 
Sbjct  682  DTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTAKRAIALAHMVEMAIEDNNLV  741

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG+WP EETKELAVLA++CTEL+R+DRPDLKD +LP LE+LK+VA++A+++  I
Sbjct  742  ELLDQEAGEWPIEETKELAVLAIKCTELRRRDRPDLKDEVLPALERLKEVADRARDLIYI  801

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               P P++F CPILK+VM DPCVAADGYTYDRKAIESWL +N++SP+TN PLPHK LL N
Sbjct  802  L-SPSPSHFKCPILKEVMHDPCVAADGYTYDRKAIESWLKDNDHSPVTNSPLPHKQLLAN  860

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKSGK 
Sbjct  861  YTLLSAIKEWKSGKH  875



>ref|XP_006421586.1| hypothetical protein CICLE_v10004338mg [Citrus clementina]
 gb|ESR34826.1| hypothetical protein CICLE_v10004338mg [Citrus clementina]
Length=810

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  619  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  678

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  679  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  738

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL EN+ SP+T+ PLP+KNLLPNY
Sbjct  739  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQENDKSPITDFPLPNKNLLPNY  798

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  799  TLLSAILDWKS  809



>ref|XP_007038300.1| U-box domain-containing protein kinase family protein isoform 
2 [Theobroma cacao]
 gb|EOY22801.1| U-box domain-containing protein kinase family protein isoform 
2 [Theobroma cacao]
Length=817

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI LTH+VETAID   L 
Sbjct  623  DTGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAIALTHVVETAIDDGNLP  682

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD+EAG WP EET+ELA+L L C EL+RKDRP LKD +LPVLE++K+VA++A+   S 
Sbjct  683  GILDSEAGPWPVEETRELAILGLSCAELRRKDRPGLKDQVLPVLERMKEVADRARISISK  742

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM+DPCVAADGYTYDRKAIE WL+ N+ SPMTNLPL +KNLLPN
Sbjct  743  VQSAPPNHFICPILKDVMDDPCVAADGYTYDRKAIEKWLDGNDKSPMTNLPLLNKNLLPN  802

Query  200  YTILSAITVWKSGKQ  156
            Y +LSAI  WKS KQ
Sbjct  803  YNLLSAIVEWKSRKQ  817



>gb|KDO45273.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
 gb|KDO45274.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=810

 Score =   270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  619  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  678

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  679  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  738

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL EN+ SP+T+LPLP+KNLLPNY
Sbjct  739  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQENDKSPITDLPLPNKNLLPNY  798

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  799  TLLSAILDWKS  809



>ref|XP_007038299.1| U-box domain-containing protein kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOY22800.1| U-box domain-containing protein kinase family protein isoform 
1 [Theobroma cacao]
Length=831

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI LTH+VETAID   L 
Sbjct  637  DTGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAIALTHVVETAIDDGNLP  696

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD+EAG WP EET+ELA+L L C EL+RKDRP LKD +LPVLE++K+VA++A+   S 
Sbjct  697  GILDSEAGPWPVEETRELAILGLSCAELRRKDRPGLKDQVLPVLERMKEVADRARISISK  756

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM+DPCVAADGYTYDRKAIE WL+ N+ SPMTNLPL +KNLLPN
Sbjct  757  VQSAPPNHFICPILKDVMDDPCVAADGYTYDRKAIEKWLDGNDKSPMTNLPLLNKNLLPN  816

Query  200  YTILSAITVWKSGKQ  156
            Y +LSAI  WKS KQ
Sbjct  817  YNLLSAIVEWKSRKQ  831



>emb|CBI38656.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   269 bits (688),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGL+SPKSDVYA GMV+LQLLTAK AI L H+VETAI  D L +
Sbjct  590  TGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMK  649

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP +ETKELA+L L C EL+R+DRPDLKD +LP LE+LKD A+++++ A   
Sbjct  650  ILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKV  709

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PPN+F+CPILKDVM DPCVAADGYTYDR+AIE W+ EN+NSPMTNL LP+KNL+PNY
Sbjct  710  QLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNY  769

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  770  TLLSAIMEWKS  780



>ref|XP_002266973.2| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Vitis vinifera]
 ref|XP_010662270.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Vitis vinifera]
Length=804

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGL+SPKSDVYA GMV+LQLLTAK AI L H+VETAI  D L +
Sbjct  610  TGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVVLQLLTAKPAIALAHLVETAIQDDQLMK  669

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP +ETKELA+L L C EL+R+DRPDLKD +LP LE+LKD A+++++ A   
Sbjct  670  ILDPMAGQWPMKETKELALLGLSCLELRRRDRPDLKDEVLPALERLKDAADRSRDSAPKV  729

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PPN+F+CPILKDVM DPCVAADGYTYDR+AIE W+ EN+NSPMTNL LP+KNL+PNY
Sbjct  730  QLAPPNHFVCPILKDVMHDPCVAADGYTYDRRAIEKWVEENDNSPMTNLALPNKNLIPNY  789

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  790  TLLSAIMEWKS  800



>ref|XP_004307786.2| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011470050.1| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
Length=815

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ETGPVGT+CYIDPEY RTG+IS KSDVYALGMVILQLLTAK AI +TH+VETAI   TL+
Sbjct  620  ETGPVGTMCYIDPEYQRTGVISSKSDVYALGMVILQLLTAKPAIAITHLVETAIHDKTLK  679

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA-S  384
            ++LD +AG WP EE ++LA L L C EL+R+DRPDLK+ ++P LE+LK+VA++A++ A +
Sbjct  680  DVLDPKAGSWPMEEARQLAELGLSCAELRRRDRPDLKEQVVPALERLKEVADKARDSAPT  739

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +   PPPN+F+CPILKDVM +PCVAADGYTYDR+AIE WL EN+NSPMTNL LP+K+L+P
Sbjct  740  VQCLPPPNHFVCPILKDVMNEPCVAADGYTYDRRAIEKWLEENDNSPMTNLALPNKHLIP  799

Query  203  NYTILSAITVWKSGKQ  156
            NYT+LSAI  WKS KQ
Sbjct  800  NYTLLSAIVEWKSRKQ  815



>ref|XP_010321478.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Solanum 
lycopersicum]
 ref|XP_004240245.2| PREDICTED: U-box domain-containing protein 35 isoform X2 [Solanum 
lycopersicum]
Length=839

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+S KSDVYA GMVILQLLT+K+AI L H+VE A + D L 
Sbjct  646  DTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTSKRAIALAHMVEMATEEDKLV  705

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG+WP EETKELAVLAL+CTEL+R+DRPDLKD +LP+LE+ K+VA++A+ +   
Sbjct  706  ELLDQEAGEWPLEETKELAVLALKCTELRRRDRPDLKDEVLPILERFKEVADRARHL-KC  764

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
              PPPP++F CP+LK+V++DPCVAADGYTYDRKAIESWL +N++SP+TNLPLPHK+LLPN
Sbjct  765  NLPPPPSHFKCPLLKEVIQDPCVAADGYTYDRKAIESWLADNDHSPVTNLPLPHKHLLPN  824

Query  200  YTILSAITVWKSGKQ  156
            Y +LSAI  WKSGK 
Sbjct  825  YALLSAIKEWKSGKH  839



>ref|XP_010318173.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum]
 ref|XP_010318174.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum]
Length=809

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISP SD+YA GMV+LQLLTAK A+GL HIVETAID D L 
Sbjct  617  DTGPVGTLCYIDPEYQRTGLISPTSDIYAFGMVLLQLLTAKAAMGLPHIVETAIDKDNLT  676

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD EAG WP EETK+LA+LAL+CTEL R+DRPDLKD ILP LE LK+VA++ ++ A  
Sbjct  677  KVLDPEAGNWPLEETKKLAMLALKCTELCRRDRPDLKDEILPALETLKEVADKTRDSALT  736

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               PPPNY++CP+LKD+M+DPCVAADG+TYDR AIE+WL E + SPMT+LPL HKNLLPN
Sbjct  737  TKSPPPNYYLCPLLKDIMKDPCVAADGFTYDRNAIETWLKEKDISPMTSLPLAHKNLLPN  796

Query  200  YTILSAITVWKS  165
            Y +LSAI  WKS
Sbjct  797  YALLSAILDWKS  808



>ref|XP_004143742.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis sativus]
Length=836

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            +GPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK A+ LTH+VETAID   L  
Sbjct  615  SGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAVALTHVVETAIDNSNLIN  674

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD EAG WP EET ELA L LRC E++RKDRPDLKD +LP+L  LK VA++A+ +AS  
Sbjct  675  VLDIEAGHWPLEETYELARLGLRCAEMQRKDRPDLKDQVLPLLMTLKKVADKARNLASKV  734

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P   PN+F+CPIL+DVM DPCVAADGYTYDR+AIE WL +N+NSPMT LPLP KNL+PNY
Sbjct  735  PAAIPNHFICPILQDVMNDPCVAADGYTYDRQAIEKWLQKNDNSPMTKLPLPDKNLIPNY  794

Query  197  TILSAITVWKSGKQ  156
            ++LSAI  W S ++
Sbjct  795  SLLSAIVEWNSKRK  808



>ref|XP_006490171.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Citrus sinensis]
Length=802

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  611  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  670

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  671  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  730

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL E   SP+T+LPLP+KNLLPNY
Sbjct  731  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQEKNKSPITDLPLPNKNLLPNY  790

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  791  TLLSAILDWKS  801



>ref|XP_008437017.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cucumis melo]
Length=808

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            +GPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK A+ LTH+VETAID   L +
Sbjct  615  SGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAVALTHVVETAIDNSNLIK  674

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD EAG WP EET ELA L LRC E++RKDRPDLKD +LP+L  LK VA++A+  AS  
Sbjct  675  VLDIEAGHWPLEETYELARLGLRCAEMQRKDRPDLKDQVLPLLMTLKKVADEARNFASKV  734

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P   PN+F+CPIL+DVM DPCVAADGYTYDR+AIE WL +N+NSPMT LPLP KNL+PNY
Sbjct  735  PAAIPNHFICPILQDVMNDPCVAADGYTYDRQAIEKWLQKNDNSPMTKLPLPDKNLIPNY  794

Query  197  TILSAITVWKSGK  159
            ++LSAI  W S +
Sbjct  795  SLLSAIVEWNSKR  807



>ref|XP_010321477.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Solanum 
lycopersicum]
Length=879

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+S KSDVYA GMVILQLLT+K+AI L H+VE A + D L 
Sbjct  686  DTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTSKRAIALAHMVEMATEEDKLV  745

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG+WP EETKELAVLAL+CTEL+R+DRPDLKD +LP+LE+ K+VA++A+ +   
Sbjct  746  ELLDQEAGEWPLEETKELAVLALKCTELRRRDRPDLKDEVLPILERFKEVADRARHL-KC  804

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
              PPPP++F CP+LK+V++DPCVAADGYTYDRKAIESWL +N++SP+TNLPLPHK+LLPN
Sbjct  805  NLPPPPSHFKCPLLKEVIQDPCVAADGYTYDRKAIESWLADNDHSPVTNLPLPHKHLLPN  864

Query  200  YTILSAITVWKSGKQ  156
            Y +LSAI  WKSGK 
Sbjct  865  YALLSAIKEWKSGKH  879



>ref|XP_008437015.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cucumis melo]
 ref|XP_008437016.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cucumis melo]
Length=820

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            +GPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK A+ LTH+VETAID   L +
Sbjct  627  SGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAVALTHVVETAIDNSNLIK  686

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD EAG WP EET ELA L LRC E++RKDRPDLKD +LP+L  LK VA++A+  AS  
Sbjct  687  VLDIEAGHWPLEETYELARLGLRCAEMQRKDRPDLKDQVLPLLMTLKKVADEARNFASKV  746

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P   PN+F+CPIL+DVM DPCVAADGYTYDR+AIE WL +N+NSPMT LPLP KNL+PNY
Sbjct  747  PAAIPNHFICPILQDVMNDPCVAADGYTYDRQAIEKWLQKNDNSPMTKLPLPDKNLIPNY  806

Query  197  TILSAITVWKSGK  159
            ++LSAI  W S +
Sbjct  807  SLLSAIVEWNSKR  819



>ref|XP_006490170.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Citrus sinensis]
Length=810

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI +TH VETAID D L E
Sbjct  619  TGPVGTLCYIDPEYQRTGLISPKSDVYAYGMVILQLLTAKPAIAITHKVETAIDEDNLAE  678

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD +AG WP +ETKELA L L C EL+RKDRPDLK+ +LPVLE+LK+VA++A++     
Sbjct  679  ILDAQAGDWPIKETKELAALGLSCAELRRKDRPDLKNQVLPVLERLKEVADRARDTVPSV  738

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILK+VM +PCVAADGYTYDRKAIE WL E   SP+T+LPLP+KNLLPNY
Sbjct  739  HPAPPNHFICPILKEVMNEPCVAADGYTYDRKAIEEWLQEKNKSPITDLPLPNKNLLPNY  798

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  799  TLLSAILDWKS  809



>gb|KHN42779.1| U-box domain-containing protein 35 [Glycine soja]
Length=799

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY RTGLISPKSDVYA GMVILQLLTAK AI L H VETAID   L 
Sbjct  603  DTAPVGTLSYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAIALAHKVETAIDGGNLT  662

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILDTEAG WP +ET ELA+L L C EL+R+DRPDL+DH+LP LE+LK V ++A+  ASI
Sbjct  663  DILDTEAGAWPYQETLELALLGLSCAELRRRDRPDLQDHVLPTLERLKQVFDRAQHSASI  722

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL EN  SPMTN+ LPHK+L+
Sbjct  723  VTIKSKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEENHKSPMTNMALPHKHLI  782

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  783  PNYTLLSAILEWKS  796



>gb|KGN50313.1| hypothetical protein Csa_5G167050 [Cucumis sativus]
Length=857

 Score =   266 bits (680),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            +GPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK A+ LTH+VETAID   L  
Sbjct  664  SGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAVALTHVVETAIDNSNLIN  723

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD EAG WP EET ELA L LRC E++RKDRPDLKD +LP+L  LK VA++A+ +AS  
Sbjct  724  VLDIEAGHWPLEETYELARLGLRCAEMQRKDRPDLKDQVLPLLMTLKKVADKARNLASKV  783

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P   PN+F+CPIL+DVM DPCVAADGYTYDR+AIE WL +N+NSPMT LPLP KNL+PNY
Sbjct  784  PAAIPNHFICPILQDVMNDPCVAADGYTYDRQAIEKWLQKNDNSPMTKLPLPDKNLIPNY  843

Query  197  TILSAITVWKSGK  159
            ++LSAI  W S +
Sbjct  844  SLLSAIVEWNSKR  856



>ref|XP_007148721.1| hypothetical protein PHAVU_005G0089000g, partial [Phaseolus vulgaris]
 gb|ESW20715.1| hypothetical protein PHAVU_005G0089000g, partial [Phaseolus vulgaris]
Length=740

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK AI L H VE AI+   L 
Sbjct  544  DTAPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAIALAHKVEIAIEGGNLT  603

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD EAG WP +ET +LAVL L C EL+R+DRPDLKD +LP LE+LK+VA++A+  AS 
Sbjct  604  DILDPEAGAWPFKETLDLAVLGLSCAELRRRDRPDLKDQVLPTLERLKEVADRAQHSAST  663

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL EN+NSPMTN+ LPHK+L+
Sbjct  664  VTIKSKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLQENDNSPMTNMALPHKHLI  723

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  724  PNYTLLSAILEWKS  737



>ref|XP_011076521.1| PREDICTED: U-box domain-containing protein 52 [Sesamum indicum]
Length=812

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY RTGL+SPKSDVYA GMV+LQLLTAK AI L   VE AID D L+
Sbjct  618  DTRPVGTLRYIDPEYLRTGLVSPKSDVYAFGMVLLQLLTAKPAIALARTVEMAIDDDCLD  677

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             +LD EAG WP EETKELA+LALRCTEL+ +DRPDL++ ILP LEKLK VA+QA+++A+ 
Sbjct  678  HVLDPEAGNWPAEETKELAILALRCTELRHRDRPDLRNQILPALEKLKMVADQARDLATS  737

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            AP  PP++ MCPIL+ VM DPCVAADGY+Y+RKAIE WL EN+NSP+T++PLP+K+L+PN
Sbjct  738  APTGPPSHCMCPILEVVMNDPCVAADGYSYERKAIEEWLEENDNSPVTSMPLPNKSLIPN  797

Query  200  YTILSAITVWKSGK  159
            YT+LSAIT WKSG+
Sbjct  798  YTLLSAITHWKSGQ  811



>ref|XP_004158155.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis sativus]
Length=1074

 Score =   268 bits (684),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  737   TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
             +GPVGT+CYIDPEY RTGLISPKSDVYA GMVILQLLTAK A+ LTH+VETAID   L  
Sbjct  853   SGPVGTLCYIDPEYQRTGLISPKSDVYAFGMVILQLLTAKPAVALTHVVETAIDNSNLIN  912

Query  557   ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
             +LD EAG WP EET ELA L LRC E++RKDRPDLKD +LP+L  LK VA++A+ +AS  
Sbjct  913   VLDIEAGHWPLEETYELARLGLRCAEMQRKDRPDLKDQVLPLLMTLKKVADKARNLASKV  972

Query  377   PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P   PN+F+CPIL+DVM DPCVAADGYTYDR+AIE WL +N+NSPMT LPLP KNL+PNY
Sbjct  973   PAAIPNHFICPILQDVMNDPCVAADGYTYDRQAIEKWLQKNDNSPMTKLPLPDKNLIPNY  1032

Query  197   TILSAITVWKSGKQ  156
             ++LSAI  W S ++
Sbjct  1033  SLLSAIVEWNSKRK  1046



>ref|XP_003522847.2| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Glycine max]
Length=796

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGLISPKSD+YA GMVILQLLTAK AI L H VETAID   L 
Sbjct  600  DTAPVGTLCYIDPEYQRTGLISPKSDIYAFGMVILQLLTAKPAIALAHKVETAIDSGNLT  659

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD EAG WP +ET +LA+L L C EL+R+DRPDL+DH+LP LE+LK+V ++A+  ASI
Sbjct  660  DILDPEAGAWPYQETLDLALLGLSCAELRRRDRPDLQDHVLPTLERLKEVVDRAQCSASI  719

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL EN+ SPMTN+ LPHK+L+
Sbjct  720  VTIKSKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEENDKSPMTNMALPHKHLI  779

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  780  PNYTLLSAILEWKS  793



>gb|KHN32504.1| U-box domain-containing protein 35 [Glycine soja]
Length=810

 Score =   265 bits (676),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGLISPKSD+YA GMVILQLLTAK AI L H VETAID   L 
Sbjct  614  DTAPVGTLCYIDPEYQRTGLISPKSDIYAFGMVILQLLTAKPAIALAHKVETAIDSGNLT  673

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD EAG WP +ET +LA+L L C EL+R+DRPDL+DH+LP LE+LK+V ++A+  ASI
Sbjct  674  DILDPEAGAWPYQETLDLALLGLSCAELRRRDRPDLQDHVLPTLERLKEVVDRAQCSASI  733

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL EN+ SPMTN+ LPHK+L+
Sbjct  734  VTIKSKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEENDKSPMTNMALPHKHLI  793

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  794  PNYTLLSAILEWKS  807



>ref|XP_006578363.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Glycine max]
 ref|XP_006578364.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Glycine max]
Length=810

 Score =   265 bits (676),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGLISPKSD+YA GMVILQLLTAK AI L H VETAID   L 
Sbjct  614  DTAPVGTLCYIDPEYQRTGLISPKSDIYAFGMVILQLLTAKPAIALAHKVETAIDSGNLT  673

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD EAG WP +ET +LA+L L C EL+R+DRPDL+DH+LP LE+LK+V ++A+  ASI
Sbjct  674  DILDPEAGAWPYQETLDLALLGLSCAELRRRDRPDLQDHVLPTLERLKEVVDRAQCSASI  733

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL EN+ SPMTN+ LPHK+L+
Sbjct  734  VTIKSKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEENDKSPMTNMALPHKHLI  793

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  794  PNYTLLSAILEWKS  807



>emb|CDP05368.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   265 bits (676),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT CYIDPEY RTGLISP SDVY  G+VILQLLTAK  +G+ H++E AI+ D+L 
Sbjct  613  DTAPVGTFCYIDPEYQRTGLISPSSDVYGFGIVILQLLTAKPPMGIAHLMEKAIENDSLM  672

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD +AG+WP +ET+ELA+LALRCTEL+ KDRPDLKD ILP LEKLK+ A++ ++   I
Sbjct  673  DVLDQDAGEWPGKETRELAMLALRCTELRGKDRPDLKDKILPALEKLKETADKGRDWPPI  732

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A   PPN F+CPILKDVME+PCVAADGYTYDRKAIE WL EN NSPMTNLPLPHKNLLPN
Sbjct  733  AKLLPPNMFVCPILKDVMENPCVAADGYTYDRKAIEEWLEENGNSPMTNLPLPHKNLLPN  792

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKSG+ 
Sbjct  793  YTLLSAIMEWKSGRH  807



>ref|XP_010275384.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
 ref|XP_010275385.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=802

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGL+SPKSDVYA GMVILQLLTAK  I LTHIVETA+    L +
Sbjct  609  TGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVILQLLTAKPPIALTHIVETALGNGHLID  668

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD EAGKWP EET++LA+L L CTEL+R DRPDLK  +LPVLE LK  A++A+++    
Sbjct  669  ILDPEAGKWPIEETQQLAILGLSCTELRRSDRPDLKTQVLPVLETLKRTADRARDLRPGV  728

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PPN+F+CPILKDVM+DP VAADGYTYDRKAIE WL +N+ SPMTNLPLP+KNL+PNY
Sbjct  729  QPSPPNHFICPILKDVMDDPYVAADGYTYDRKAIEIWLAKNDKSPMTNLPLPNKNLIPNY  788

Query  197  TILSAITVWKSGKQ  156
            T+LSAI  WKS KQ
Sbjct  789  TLLSAIIEWKSTKQ  802



>ref|XP_009372840.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
 ref|XP_009372841.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=778

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  +TH+VETA+    L 
Sbjct  584  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARAITHLVETAVKDKNLT  643

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD +AG WP EET++LA L L C EL+R+DRPDLK+ ++P+LE+LK+VA  AK  AS+
Sbjct  644  DVLDPKAGHWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKEVAETAKNSASV  703

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM++PCVAADGYTYDRKAIE WL EN+NSPMTNLPLP+KN++ N
Sbjct  704  VQCLPPNHFICPILKDVMDEPCVAADGYTYDRKAIEKWLEENDNSPMTNLPLPNKNVILN  763

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WK+ KQ
Sbjct  764  YTLLSAIMEWKTRKQ  778



>ref|XP_006385122.1| hypothetical protein POPTR_0004s24130g [Populus trichocarpa]
 gb|ERP62919.1| hypothetical protein POPTR_0004s24130g [Populus trichocarpa]
Length=824

 Score =   262 bits (670),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTG+ISPKSD YA GM+ILQLLTAK AI L H++ETA++   L E
Sbjct  621  TGPVGTLCYIDPEYQRTGVISPKSDAYAFGMIILQLLTAKPAIALAHVMETAMEEGHLVE  680

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD+EAG WP EETKELA+L L CTE++RKDRPDLKD +LP LE+LK VA +A+E  S  
Sbjct  681  ILDSEAGNWPLEETKELAILGLSCTEMRRKDRPDLKDVVLPALERLKKVARRAQESVSSL  740

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP + +CPILKD+M+DPCVAADGYTYDRKAI+ WL EN+ SPMTNLPLP+K+LLP+Y
Sbjct  741  QLTPPKHLICPILKDLMDDPCVAADGYTYDRKAIQKWLEENDKSPMTNLPLPNKDLLPSY  800

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  801  TLLSAIMEWKS  811



>ref|XP_004499632.1| PREDICTED: U-box domain-containing protein 35-like isoform X5 
[Cicer arietinum]
Length=651

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY R+GLISPKSDVYA G+V+LQLLTAK A+ LT +VETAID   L 
Sbjct  458  DTAPVGTLCYIDPEYQRSGLISPKSDVYAFGLVVLQLLTAKPAMALTDMVETAIDNGNLA  517

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET ++A LAL C EL+RKDRPDLKDH+LP+LE+LK+VA+ A   ASI
Sbjct  518  DILDPKAGSWPLQETLDIARLALSCAELRRKDRPDLKDHVLPMLERLKEVADGAAHSASI  577

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDR AIE WL EN  SPMTN+ LPHKNL+
Sbjct  578  VNLKSRPPNHFICPILQDVMDDPCVAADGYTYDRNAIEKWLEENGKSPMTNMALPHKNLI  637

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  638  PNYTLLSAILEWKS  651



>ref|XP_004499631.1| PREDICTED: U-box domain-containing protein 35-like isoform X4 
[Cicer arietinum]
Length=709

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY R+GLISPKSDVYA G+V+LQLLTAK A+ LT +VETAID   L 
Sbjct  516  DTAPVGTLCYIDPEYQRSGLISPKSDVYAFGLVVLQLLTAKPAMALTDMVETAIDNGNLA  575

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET ++A LAL C EL+RKDRPDLKDH+LP+LE+LK+VA+ A   ASI
Sbjct  576  DILDPKAGSWPLQETLDIARLALSCAELRRKDRPDLKDHVLPMLERLKEVADGAAHSASI  635

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDR AIE WL EN  SPMTN+ LPHKNL+
Sbjct  636  VNLKSRPPNHFICPILQDVMDDPCVAADGYTYDRNAIEKWLEENGKSPMTNMALPHKNLI  695

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  696  PNYTLLSAILEWKS  709



>ref|XP_010062525.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 ref|XP_010062534.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 ref|XP_010062542.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 gb|KCW90868.1| hypothetical protein EUGRSUZ_A02915 [Eucalyptus grandis]
Length=806

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CY+DPEY RTG  SPKSDVYA GMVILQLLTAK A+ LTH VE AI+  +L E
Sbjct  604  TGPVGTLCYMDPEYQRTGQNSPKSDVYAFGMVILQLLTAKPAVALTHTVERAIEEGSLVE  663

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD EAG WP EET+ELA+L L C EL+R+DRPDLKD +LP LEKLK +A++A++ AS  
Sbjct  664  ILDEEAGDWPLEETRELAMLGLSCAELRRRDRPDLKDEVLPKLEKLKKIADKARDAASNV  723

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP++F+CPILKDVM DP VAADGYTYDR AIE WL EN+ SPMTNLPLPHKNL+PNY
Sbjct  724  KISPPSHFICPILKDVMADPYVAADGYTYDRTAIEKWLEENDKSPMTNLPLPHKNLIPNY  783

Query  197  TILSAITVWKS  165
            T+LSAIT WKS
Sbjct  784  TLLSAITEWKS  794



>ref|XP_008351452.1| PREDICTED: U-box domain-containing protein 52-like [Malus domestica]
Length=394

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  +TH+VETA++   L 
Sbjct  200  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARAITHLVETAVNDKNLT  259

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP EET++LA L L C EL+R DRPDLK+ ++P+LE+LK VA  AK  AS 
Sbjct  260  DILDPKAGLWPMEETRQLAELGLSCAELRRIDRPDLKEQVVPLLERLKLVAYAAKNSASA  319

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM +PCVAADGYTYDRKAIE+WL E +NSP+TN+PLP+KN++PN
Sbjct  320  VHCLPPNHFICPILKDVMNEPCVAADGYTYDRKAIETWLEETDNSPVTNVPLPNKNVMPN  379

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKS +Q
Sbjct  380  YTLLSAIMEWKSREQ  394



>ref|XP_010258804.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=803

 Score =   259 bits (661),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY RTGL+SPKSDVYA GMVILQLLTAK A+ L HIVETA+    L +
Sbjct  609  TGPVGTLCYIDPEYQRTGLVSPKSDVYAFGMVILQLLTAKPAMALAHIVETALGDGHLID  668

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD EAG WP EET++LAVL L CTEL+R DRPDL+  +LPVLE LK++A + + +A   
Sbjct  669  ILDHEAGNWPIEETQKLAVLGLSCTELQRGDRPDLRTQVLPVLESLKEIAARGRGLAPGG  728

Query  377  -PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
              P PP++F+CPILKDVM++PCVAADGYTYDR+AIE WL +N+ SPMTNLPLP+KNLLPN
Sbjct  729  LQPSPPSHFICPILKDVMDNPCVAADGYTYDRRAIEIWLAQNDKSPMTNLPLPNKNLLPN  788

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAIT WKS KQ
Sbjct  789  YTLLSAITEWKSTKQ  803



>ref|XP_009362703.1| PREDICTED: U-box domain-containing protein 35 [Pyrus x bretschneideri]
Length=794

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  +TH+VETA++   L 
Sbjct  600  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARAITHLVETAVNDKNLT  659

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP EET++LA L L C EL+R DRPDLK+ ++P+LE+LK+VA  AK  AS 
Sbjct  660  DILDPKAGLWPMEETRQLAKLGLSCAELRRIDRPDLKEQVVPLLERLKEVAYAAKNSASA  719

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM +PCVAADGYTYDR+AIE+WL EN+NSP+TN+PLP+KN++PN
Sbjct  720  VHCLPPNHFICPILKDVMNEPCVAADGYTYDREAIETWLEENDNSPVTNVPLPNKNVMPN  779

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKSG+Q
Sbjct  780  YTLLSAIMEWKSGEQ  794



>ref|XP_004499628.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cicer arietinum]
 ref|XP_004499629.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cicer arietinum]
 ref|XP_004499630.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Cicer arietinum]
Length=797

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY R+GLISPKSDVYA G+V+LQLLTAK A+ LT +VETAID   L 
Sbjct  604  DTAPVGTLCYIDPEYQRSGLISPKSDVYAFGLVVLQLLTAKPAMALTDMVETAIDNGNLA  663

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET ++A LAL C EL+RKDRPDLKDH+LP+LE+LK+VA+ A   ASI
Sbjct  664  DILDPKAGSWPLQETLDIARLALSCAELRRKDRPDLKDHVLPMLERLKEVADGAAHSASI  723

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDR AIE WL EN  SPMTN+ LPHKNL+
Sbjct  724  VNLKSRPPNHFICPILQDVMDDPCVAADGYTYDRNAIEKWLEENGKSPMTNMALPHKNLI  783

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  784  PNYTLLSAILEWKS  797



>ref|XP_003598187.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES68438.1| U-box kinase family protein [Medicago truncatula]
Length=797

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY R+GLIS KSDVYA G+VILQLLTAK AI LTHIVETAID   L 
Sbjct  604  DTAPVGTLSYIDPEYQRSGLISTKSDVYAFGLVILQLLTAKPAIALTHIVETAIDGGNLA  663

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET ++A LAL C E++RKDRPDL DH+LP+LE+LK+VA++A+  ASI
Sbjct  664  DILDPKAGSWPLQETLDIARLALGCAEMRRKDRPDLNDHVLPMLERLKEVADKAQHSASI  723

Query  380  A--PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                  PPN+F+CPIL+DVM+DPCVAADGYTYDR AIE WL EN+ SPMTN+ LPHK+L+
Sbjct  724  VTIKSRPPNHFICPILQDVMDDPCVAADGYTYDRNAIEKWLEENDKSPMTNMVLPHKHLI  783

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WK+
Sbjct  784  PNYTLLSAILEWKT  797



>ref|XP_004499634.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cicer arietinum]
Length=798

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY R+GLIS KSDVYA G+V+LQLLTAK AI LTH+VE AI+   L 
Sbjct  602  DTAPVGTLSYIDPEYQRSGLISTKSDVYAFGLVMLQLLTAKPAIALTHVVEMAIEGGNLT  661

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET +LA LAL C EL+RKDRPDLKDH+LP+LE+LK+V+++A   AS+
Sbjct  662  DILDPKAGSWPFQETLDLARLALSCAELRRKDRPDLKDHVLPILERLKEVSDRAHHSASM  721

Query  380  --APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                P PPN+F+CPIL+D+M+DPCVAADGYTY+R AIE WL ENE SPMTN+ LPHK L+
Sbjct  722  ITIKPKPPNHFICPILQDLMDDPCVAADGYTYNRNAIEKWLEENEKSPMTNMDLPHKLLI  781

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  782  PNYTLLSAILEWKS  795



>ref|XP_010109120.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXC20961.1| U-box domain-containing protein 35 [Morus notabilis]
Length=804

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 158/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+CYIDPEY RTGLISPKSDVYALGMVILQLLTAK AI L H+VETA+    + 
Sbjct  609  DTGPVGTLCYIDPEYQRTGLISPKSDVYALGMVILQLLTAKPAIALAHVVETAVADGNVM  668

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS-  384
             ILD  AG WP EETKE A L L C EL+R+DRPDL+D +LP L++LK+VA++A++ AS 
Sbjct  669  NILDPNAGNWPVEETKEFAELGLSCAELRRRDRPDLQDQVLPSLQRLKEVADKARDSASK  728

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +   PPPN+F+CPILKDVM DPCVAADGYTYDRKAI+ WL  N+ SP TNLPLP K L+P
Sbjct  729  LHFSPPPNHFICPILKDVMNDPCVAADGYTYDRKAIDKWLEVNDTSPRTNLPLPSKTLIP  788

Query  203  NYTILSAITVWKSGKQ  156
            NYT+LSAI   KS +Q
Sbjct  789  NYTLLSAIMERKSKEQ  804



>ref|XP_004499633.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cicer arietinum]
Length=806

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY R+GLIS KSDVYA G+V+LQLLTAK AI LTH+VE AI+   L 
Sbjct  610  DTAPVGTLSYIDPEYQRSGLISTKSDVYAFGLVMLQLLTAKPAIALTHVVEMAIEGGNLT  669

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET +LA LAL C EL+RKDRPDLKDH+LP+LE+LK+V+++A   AS+
Sbjct  670  DILDPKAGSWPFQETLDLARLALSCAELRRKDRPDLKDHVLPILERLKEVSDRAHHSASM  729

Query  380  --APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                P PPN+F+CPIL+D+M+DPCVAADGYTY+R AIE WL ENE SPMTN+ LPHK L+
Sbjct  730  ITIKPKPPNHFICPILQDLMDDPCVAADGYTYNRNAIEKWLEENEKSPMTNMDLPHKLLI  789

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  790  PNYTLLSAILEWKS  803



>gb|EYU20190.1| hypothetical protein MIMGU_mgv1a001539mg [Erythranthe guttata]
Length=800

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGL+SPKSDVYA GMV+LQLLTAK AI L   VE A+D D + 
Sbjct  608  DTSPVGTLCYIDPEYQRTGLVSPKSDVYAYGMVVLQLLTAKPAIALARTVEMALDDDDVA  667

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             ILD EAG WP EETKELA LALRCTEL+ +DRPDL+ HILP LEKL+ V+ +A ++A +
Sbjct  668  RILDKEAGSWPIEETKELAELALRCTELRHRDRPDLRTHILPTLEKLRMVSMKAHDLAVL  727

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PPN+F+CP+LKDVM DPCVAADGYTYDRKAIE WL EN  SP+TNLPL  K+L+PN
Sbjct  728  GPTGPPNHFICPLLKDVMNDPCVAADGYTYDRKAIEEWLRENNTSPVTNLPLLSKSLIPN  787

Query  200  YTILSAITVWKSG  162
            +++L+AI   KS 
Sbjct  788  HSLLTAIMQQKSA  800



>ref|XP_008376381.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Malus 
domestica]
 ref|XP_008376382.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Malus 
domestica]
Length=781

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLL+AK A  +TH+VETA+    L 
Sbjct  587  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLSAKPARAITHLVETAVKDKNLT  646

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD +AG WP EET++LA L L C EL+R+DRPDLK+ ++P+LE+LK+VA+ AK  A  
Sbjct  647  DVLDPKAGHWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKEVADTAKNSAPP  706

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM++PCVAADGYTYDRKAIE W  EN NSPMTNLPLP+K+++ N
Sbjct  707  VQCLPPNHFICPILKDVMDEPCVAADGYTYDRKAIEKWFEENNNSPMTNLPLPNKDVILN  766

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WK+ KQ
Sbjct  767  YTLLSAIMEWKTRKQ  781



>ref|XP_008376383.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Malus 
domestica]
Length=778

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLL+AK A  +TH+VETA+    L 
Sbjct  584  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLSAKPARAITHLVETAVKDKNLT  643

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD +AG WP EET++LA L L C EL+R+DRPDLK+ ++P+LE+LK+VA+ AK  A  
Sbjct  644  DVLDPKAGHWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKEVADTAKNSAPP  703

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM++PCVAADGYTYDRKAIE W  EN NSPMTNLPLP+K+++ N
Sbjct  704  VQCLPPNHFICPILKDVMDEPCVAADGYTYDRKAIEKWFEENNNSPMTNLPLPNKDVILN  763

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WK+ KQ
Sbjct  764  YTLLSAIMEWKTRKQ  778



>ref|XP_011028464.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Populus euphratica]
Length=824

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY R G+ISPKSD YA GM+ILQLLTAK AI L H++ETA++   L E
Sbjct  621  TGPVGTLCYIDPEYQRNGVISPKSDAYAFGMIILQLLTAKPAIALAHVMETAMEEGHLVE  680

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD+EAG WP EETKELA L L CTE+++KDRPDLKD +LP LE+L +VA +A++  S  
Sbjct  681  ILDSEAGNWPLEETKELATLGLSCTEIRQKDRPDLKDVVLPALERLNEVARRARDSVSSL  740

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP + +CPILKD+M+DPCVAADGYTY+RKAI+ WL EN+ SPMTNLPLP+K+LLP+Y
Sbjct  741  QLTPPKHLICPILKDLMDDPCVAADGYTYNRKAIQKWLEENDKSPMTNLPLPNKDLLPSY  800

Query  197  TILSAITVWKSGKQ  156
            T+LSAI  WKS  Q
Sbjct  801  TLLSAIMEWKSKTQ  814



>ref|XP_011028465.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Populus euphratica]
Length=822

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT+CYIDPEY R G+ISPKSD YA GM+ILQLLTAK AI L H++ETA++   L E
Sbjct  619  TGPVGTLCYIDPEYQRNGVISPKSDAYAFGMIILQLLTAKPAIALAHVMETAMEEGHLVE  678

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD+EAG WP EETKELA L L CTE+++KDRPDLKD +LP LE+L +VA +A++  S  
Sbjct  679  ILDSEAGNWPLEETKELATLGLSCTEIRQKDRPDLKDVVLPALERLNEVARRARDSVSSL  738

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP + +CPILKD+M+DPCVAADGYTY+RKAI+ WL EN+ SPMTNLPLP+K+LLP+Y
Sbjct  739  QLTPPKHLICPILKDLMDDPCVAADGYTYNRKAIQKWLEENDKSPMTNLPLPNKDLLPSY  798

Query  197  TILSAITVWKSGKQ  156
            T+LSAI  WKS  Q
Sbjct  799  TLLSAIMEWKSKTQ  812



>ref|XP_008391798.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=793

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  +TH+VETA++   L 
Sbjct  599  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARAITHLVETAVNDKNLM  658

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP EET++LA L L C EL+R DRPDLK+ ++P+LE+LK+VA  AK  AS 
Sbjct  659  DILDPKAGLWPMEETRQLAELGLSCAELRRIDRPDLKEQVVPLLERLKEVAYAAKNSASA  718

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+C ILKDVM +PCVAADGYTYDRKAIE+WL EN+NSP+TN+PLP+KN++PN
Sbjct  719  VHCLPPNHFICRILKDVMNEPCVAADGYTYDRKAIETWLEENDNSPVTNVPLPNKNVMPN  778

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAI  WKS +Q
Sbjct  779  YTLLSAIMEWKSREQ  793



>ref|XP_008234435.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Prunus mume]
Length=808

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 164/196 (84%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  LTH+VETAI    L 
Sbjct  613  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARALTHLVETAISDRNLM  672

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS-  384
            ++LD +AG WP EET++LA L L C EL+R+DRPDLK+ ++P+LE+LK VA++A++ AS 
Sbjct  673  DVLDPKAGVWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKMVADKARDSAST  732

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +    PPN+F+CPILKDVM++PCVAADGYTYDRK+IE+W+ EN+ SPMTNLPLP+KNL+P
Sbjct  733  VQCRLPPNHFLCPILKDVMQEPCVAADGYTYDRKSIETWIQENDKSPMTNLPLPNKNLIP  792

Query  203  NYTILSAITVWKSGKQ  156
            NYT+LSAI  WKS  Q
Sbjct  793  NYTLLSAIMEWKSRGQ  808



>ref|XP_008234434.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Prunus mume]
Length=810

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 164/196 (84%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  LTH+VETAI    L 
Sbjct  615  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARALTHLVETAISDRNLM  674

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS-  384
            ++LD +AG WP EET++LA L L C EL+R+DRPDLK+ ++P+LE+LK VA++A++ AS 
Sbjct  675  DVLDPKAGVWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKMVADKARDSAST  734

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +    PPN+F+CPILKDVM++PCVAADGYTYDRK+IE+W+ EN+ SPMTNLPLP+KNL+P
Sbjct  735  VQCRLPPNHFLCPILKDVMQEPCVAADGYTYDRKSIETWIQENDKSPMTNLPLPNKNLIP  794

Query  203  NYTILSAITVWKSGKQ  156
            NYT+LSAI  WKS  Q
Sbjct  795  NYTLLSAIMEWKSRGQ  810



>ref|XP_007218920.1| hypothetical protein PRUPE_ppa001518mg [Prunus persica]
 gb|EMJ20119.1| hypothetical protein PRUPE_ppa001518mg [Prunus persica]
Length=810

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 164/196 (84%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  LTH+VETAI    L 
Sbjct  615  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARALTHLVETAISDRNLM  674

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS-  384
            ++LD +AG WP EET++LA L L C EL+R+DRPDLK+ ++P+LE+LK VA++A++ AS 
Sbjct  675  DVLDPKAGVWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKMVADKARDSAST  734

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +    PPN+F+CPILKDVM++PCVAADGYTYDRK+IE+W+ EN+ SPMTNLPLP+KNL+P
Sbjct  735  VQCRLPPNHFICPILKDVMQEPCVAADGYTYDRKSIETWIQENDKSPMTNLPLPNKNLIP  794

Query  203  NYTILSAITVWKSGKQ  156
            NYT+LSAI  WKS  Q
Sbjct  795  NYTLLSAIMEWKSRGQ  810



>gb|KEH32844.1| U-box kinase family protein [Medicago truncatula]
Length=801

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY R+GLIS KSDVYA G+V+LQLLTAK A  LTH+VETAI+   L 
Sbjct  605  DTAPVGTLSYIDPEYQRSGLISTKSDVYAFGLVMLQLLTAKPATALTHVVETAIEDGNLT  664

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET +LA LAL C EL+R+DRPDL DH+LP LE+LK+VA++A   AS+
Sbjct  665  DILDPKAGLWPFQETLDLARLALSCAELRRRDRPDLLDHVLPTLERLKEVADRAHHSASM  724

Query  380  AP--PPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                P PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL E + SPMTN+PLPHK L+
Sbjct  725  VAIKPKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEEKDKSPMTNIPLPHKILI  784

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  785  PNYTLLSAILEWKS  798



>ref|XP_003598188.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES68439.1| U-box kinase family protein [Medicago truncatula]
Length=809

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY R+GLIS KSDVYA G+V+LQLLTAK A  LTH+VETAI+   L 
Sbjct  613  DTAPVGTLSYIDPEYQRSGLISTKSDVYAFGLVMLQLLTAKPATALTHVVETAIEDGNLT  672

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD +AG WP +ET +LA LAL C EL+R+DRPDL DH+LP LE+LK+VA++A   AS+
Sbjct  673  DILDPKAGLWPFQETLDLARLALSCAELRRRDRPDLLDHVLPTLERLKEVADRAHHSASM  732

Query  380  AP--PPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
                P PPN+F+CPIL+DVM+DPCVAADGYTYDRKAIE WL E + SPMTN+PLPHK L+
Sbjct  733  VAIKPKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEEKDKSPMTNIPLPHKILI  792

Query  206  pNYTILSAITVWKS  165
            PNYT+LSAI  WKS
Sbjct  793  PNYTLLSAILEWKS  806



>ref|NP_199940.1| U-box domain-containing protein 53 [Arabidopsis thaliana]
 sp|Q9LU47.1|PUB53_ARATH RecName: Full=Putative U-box domain-containing protein 53; AltName: 
Full=Plant U-box protein 53; Includes: RecName: Full=E3 
ubiquitin ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 dbj|BAA97390.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96060.1| U-box domain-containing protein 53 [Arabidopsis thaliana]
Length=819

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI---D  570
            +T PVGT+CYIDPEY RTG ISPKSDVYA GM+ILQLLT +QA+ LT+ VETA++    D
Sbjct  622  QTSPVGTLCYIDPEYQRTGRISPKSDVYAFGMIILQLLTGQQAMALTYTVETAMENNNDD  681

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL+CTEL+ KDRPDL+D ILPVLE LK VA++A+  
Sbjct  682  ELIQILDEKAGNWPIEETRQLAALALQCTELRSKDRPDLEDQILPVLESLKKVADKARNS  741

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S AP  PP++F CP+LKDVM++PC+AADGYTYDR+AIE W+  +  SP+TN PL + NL
Sbjct  742  LSAAPSQPPSHFFCPLLKDVMKEPCIAADGYTYDRRAIEEWMENHRTSPVTNSPLQNVNL  801

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W++  Q
Sbjct  802  LPNHTLYAAIVEWRNRNQ  819



>ref|XP_010671630.1| PREDICTED: U-box domain-containing protein 35-like [Beta vulgaris 
subsp. vulgaris]
Length=790

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 157/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ET PVGT+CYIDPEY RTG +S KSD+YALG+VILQLLTAK A+G+ +++E AID  TL 
Sbjct  594  ETSPVGTLCYIDPEYQRTGRVSTKSDIYALGVVILQLLTAKPAVGIAYMIEDAIDEGTLT  653

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            EILD EAG+WP +ET ELA+L L+C+EL+ +DRPDLK+ +LP LE+ K+VA++A+E AS 
Sbjct  654  EILDPEAGEWPEKETLELAMLGLQCSELRGRDRPDLKERVLPALERFKEVADRARESASN  713

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A    P +FMCPILKD MEDP VAADGYTYDRKAIE WL EN+ SP TN PLPHK ++PN
Sbjct  714  ALTATPTHFMCPILKDFMEDPYVAADGYTYDRKAIEQWLTENDTSPTTNQPLPHKFIMPN  773

Query  200  YTILSAITVWKSGK  159
             ++L AIT WKS K
Sbjct  774  TSLLEAITQWKSKK  787



>ref|XP_010038414.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 gb|KCW46250.1| hypothetical protein EUGRSUZ_K00132 [Eucalyptus grandis]
Length=781

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TG VGT+CYIDPEY RTG +SPKSDVYA G+VILQLLT+K AI LTH+VE A+   +L +
Sbjct  588  TGSVGTLCYIDPEYQRTGSVSPKSDVYAFGIVILQLLTSKPAIALTHMVERALSEGSLMD  647

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD +AG WP EET+ELA+L + C EL+RKDRPDL+D +LPVLEKLK+VA+QAK+  S  
Sbjct  648  VLDADAGDWPPEETEELALLGICCAELRRKDRPDLRDQVLPVLEKLKEVASQAKDATSWV  707

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP++F+CPI +DVM+DP VA DGYTYDR+AIE WL  N+ SPMTNLPL +K+L+PNY
Sbjct  708  KLAPPSHFICPISQDVMKDPYVAVDGYTYDRRAIEKWLEGNDKSPMTNLPLLNKHLIPNY  767

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  768  TLLSAIKEWKS  778



>ref|XP_002865849.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42108.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=854

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG ISPKSDVYA GM+ILQLLT +QA+ LT+ VETA+   D D
Sbjct  657  QTSPVGTLCYIDPEYQRTGRISPKSDVYAFGMIILQLLTGQQAMALTYTVETAMENNDYD  716

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL+CTEL+ KDRPDL+D ILPVLE LK VA++ +  
Sbjct  717  ELIQILDQKAGNWPIEETRQLAGLALQCTELRSKDRPDLEDQILPVLESLKKVADKERNS  776

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S AP  PP++F+CP+LKDVM++PC+AADGYTYDR+AIE W+  +  SP+T  PL + +L
Sbjct  777  LSTAPSQPPSHFICPLLKDVMKEPCIAADGYTYDRRAIEEWMENHRTSPVTESPLQNVSL  836

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W+   Q
Sbjct  837  LPNHTLYAAIVEWRKRNQ  854



>ref|XP_009401652.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=800

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT  Y+DPEY RTGL+SPKSD YALGMVILQLLTAK  +GL  IVETA++ D L 
Sbjct  606  DTDPVGTFFYMDPEYQRTGLVSPKSDTYALGMVILQLLTAKSPMGLALIVETALERDCLM  665

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD++AG+WP+ E KELA+L L C EL+RKDRPDLKD +LPVLE+LK +A QA + A  
Sbjct  666  DILDSKAGQWPKAEAKELAILGLSCLELRRKDRPDLKDQVLPVLERLKAIAEQAYDSALH  725

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILK VM+DPC+AADGYTY+R AIE+WL+ N+ SPMTNL LP + ++ N
Sbjct  726  DSSVPPNHFICPILKVVMDDPCIAADGYTYNRNAIETWLSRNDTSPMTNLLLPTQEIICN  785

Query  200  YTILSAITVWKSGKQ  156
             ++LSAI  WK+  Q
Sbjct  786  NSLLSAIKDWKARTQ  800



>ref|XP_002864738.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40997.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQLLTAK AI +TH++E AI  D   
Sbjct  589  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGIVILQLLTAKPAIAITHMMEEAIGDDAEF  648

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              ILD +AG WP  ET+ELA L L CTE++R+DRPDLKD I+P LE+LK VA++A+   S
Sbjct  649  MAILDKKAGSWPISETRELAALGLCCTEMRRRDRPDLKDQIIPALERLKKVADKAQNSLS  708

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP++K VM +PCVAADGYTYDR+AIE WL EN+ SP+TNLPLP+KNLL 
Sbjct  709  RTPSGPPSHFICPLVKGVMNEPCVAADGYTYDREAIEEWLRENDTSPVTNLPLPNKNLLA  768

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS KQ
Sbjct  769  NYTLYSAIMEWKSNKQ  784



>ref|XP_002862537.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38795.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=846

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQLLTAK AI +TH++E AI  D   
Sbjct  651  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGIVILQLLTAKPAIAITHMMEEAIGDDAEF  710

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              ILD +AG WP  ET+ELA L L CTE++R+DRPDLKD I+P LE+LK VA++A+   S
Sbjct  711  MAILDKKAGSWPISETRELAALGLCCTEMRRRDRPDLKDQIIPALERLKKVADKAQNSLS  770

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP++K VM +PCVAADGYTYDR+AIE WL EN+ SP+TNLPLP+KNLL 
Sbjct  771  RTPSGPPSHFICPLVKGVMNEPCVAADGYTYDREAIEEWLRENDTSPVTNLPLPNKNLLA  830

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS KQ
Sbjct  831  NYTLYSAIMEWKSNKQ  846



>ref|XP_006655773.1| PREDICTED: U-box domain-containing protein 35-like [Oryza brachyantha]
Length=804

 Score =   245 bits (626),  Expect = 9e-72, Method: Composition-based stats.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT CYIDPEY RTG++S KSDVYALG+VILQLLTAK  +G+ H+VETA++     +
Sbjct  612  TAPVGTFCYIDPEYQRTGVVSMKSDVYALGIVILQLLTAKSPMGIAHVVETALEEGHFLD  671

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP++E +ELAVLAL+C E++R+DRPDL DH+LP LE+LKDVA +A+EMA   
Sbjct  672  ILDASAGQWPQKEAQELAVLALKCAEMRRRDRPDLSDHVLPALERLKDVAAKAREMALHG  731

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
              PPP++F+CPIL++VM DP VA+DGYTYDRKAIE WL+ N+ SPMTNL LPHKNL+PN+
Sbjct  732  QTPPPSHFICPILQEVMVDPYVASDGYTYDRKAIELWLSMNDKSPMTNLRLPHKNLIPNH  791

Query  197  TILSAITVWKS  165
            ++ SAI  W+S
Sbjct  792  SLRSAIMDWRS  802



>ref|XP_010693732.1| PREDICTED: U-box domain-containing protein 35-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 156/195 (80%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTGLIS K+DVYALGMVILQLLTAK A+G+TH+VE AI    L 
Sbjct  616  DTSPVGTLCYIDPEYQRTGLISMKADVYALGMVILQLLTAKPAVGITHVVEDAIKEGRLM  675

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD  AG+WP  ET E+A+L L+C EL+RKDRPDLK  ILP LE++KDVA  A+++A+ 
Sbjct  676  KILDRSAGRWPLRETAEIALLGLQCAELRRKDRPDLKS-ILPALERIKDVAENARDLAAK  734

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PP++F+CPILK VM+DPCVA+DGYTYDRKAIE WL +N+ SP T+ PL  KNL+PN
Sbjct  735  ILIAPPSHFICPILKGVMDDPCVASDGYTYDRKAIEMWLKDNDTSPTTDFPLSSKNLIPN  794

Query  200  YTILSAITVWKSGKQ  156
            YT+  AIT WKS ++
Sbjct  795  YTLSYAITEWKSKRR  809



>ref|XP_010934652.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
 ref|XP_010934653.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
Length=804

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT  YIDPEY RTGL+SPKSDVYALG+VILQLLTAK  +GLT IVE A++   L 
Sbjct  610  DTTPVGTFFYIDPEYQRTGLVSPKSDVYALGIVILQLLTAKPPMGLTLIVERALEEGNLT  669

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            EILD  AG+WP EET+ELA+L + C EL+R+DRPDLK+ +LP+LEKLK  A++A + AS 
Sbjct  670  EILDPGAGEWPLEETQELALLGIGCAELRRRDRPDLKEQVLPLLEKLKVCADKAHDCASH  729

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PPN+F+CPIL++VM DPCVA+DGYTYDRKAIE W+  N+ SPMTNL LP+KNL+PN
Sbjct  730  TPSAPPNHFICPILQEVMNDPCVASDGYTYDRKAIEIWVGMNDKSPMTNLLLPNKNLIPN  789

Query  200  YTILSAITVWKSGKQ  156
            Y++ SAI  WKS  Q
Sbjct  790  YSLRSAIMDWKSRSQ  804



>ref|XP_010555606.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555607.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555608.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
Length=839

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI-DIDTL  564
             T PVGT+CYIDPEY RTG+IS KSDVY+ GM+ILQLLTAK AI LTH+VE A+ + +  
Sbjct  644  HTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIILQLLTAKPAIALTHVVERAMSNNNEF  703

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              ILD +AG WP EET+EL  LAL CTEL+RKDRPDLKD ILP LE L+ VA++A+   S
Sbjct  704  LGILDQKAGNWPIEETRELTALALCCTELRRKDRPDLKDQILPALEGLRKVADKARNSLS  763

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LKDVM +PCVAADGYTYDR+AIE WL + + SPMTN P P KNLLP
Sbjct  764  SVPTQPPSHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEQKDTSPMTNSPFPSKNLLP  823

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  824  NYTLYTAIMEWRS  836



>ref|XP_010555605.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Tarenaya 
hassleriana]
Length=876

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI-DIDTL  564
             T PVGT+CYIDPEY RTG+IS KSDVY+ GM+ILQLLTAK AI LTH+VE A+ + +  
Sbjct  681  HTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIILQLLTAKPAIALTHVVERAMSNNNEF  740

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              ILD +AG WP EET+EL  LAL CTEL+RKDRPDLKD ILP LE L+ VA++A+   S
Sbjct  741  LGILDQKAGNWPIEETRELTALALCCTELRRKDRPDLKDQILPALEGLRKVADKARNSLS  800

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LKDVM +PCVAADGYTYDR+AIE WL + + SPMTN P P KNLLP
Sbjct  801  SVPTQPPSHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEQKDTSPMTNSPFPSKNLLP  860

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  861  NYTLYTAIMEWRS  873



>ref|XP_010448470.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=832

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLTAK AI L H VE+A+D  D  
Sbjct  639  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPAIALAHFVESAMDSNDEF  698

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDLKD ILP LE LK VA++A+   S
Sbjct  699  LKILDQKAGNWPIEETRELTALALCCTELRGKDRPDLKDQILPALESLKKVADKARNSLS  758

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+ PL  K+LLP
Sbjct  759  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDSPLRSKSLLP  818

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  819  NYTLYTAIMEWRS  831



>ref|XP_010438919.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
 ref|XP_010438921.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=831

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLTAK AI L H VE+A+D  D  
Sbjct  638  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPAIALAHFVESAMDSNDEF  697

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDLKD ILP LE LK VA++A+   S
Sbjct  698  LKILDQKAGNWPIEETRELTALALCCTELRGKDRPDLKDQILPALESLKKVADKARNSLS  757

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+ PL  K+LLP
Sbjct  758  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDSPLRSKSLLP  817

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  818  NYTLYTAIMEWRS  830



>gb|AAO72614.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
Length=448

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT CYIDPEY R+G++S KSDVYALG+VILQLLTAK  +G+ H+VETA++     +
Sbjct  255  TAPVGTFCYIDPEYQRSGVVSMKSDVYALGIVILQLLTAKSPMGIAHVVETALEDGHFVD  314

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA-SI  381
            ILD  AG+WP  E +ELA LAL+C E++R+DRPDL DH+LP LE+LKDVA +A+EMA + 
Sbjct  315  ILDAAAGQWPLNEAQELAFLALKCAEMRRRDRPDLSDHVLPALERLKDVATKAREMAFNG  374

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PP++F+CPIL++VM DP VA+DGYTYDRKAIE WL+ N+ SPMTNL LPHK+L+PN
Sbjct  375  HQTAPPSHFICPILQEVMADPYVASDGYTYDRKAIELWLSMNDKSPMTNLRLPHKSLIPN  434

Query  200  YTILSAITVWKS  165
            +++ SAI  W++
Sbjct  435  HSLRSAIIDWRT  446



>ref|XP_002865850.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42109.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=812

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI---D  570
            +T PVGT+CYIDPEY RTG ISPKSDVYALGM+ILQLLTA+ A+ LT+ VE A++    D
Sbjct  615  QTSPVGTLCYIDPEYQRTGRISPKSDVYALGMIILQLLTAQPAMALTYTVEIAMENNNDD  674

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTEL+ KDRPDL+D ILPVLE LK VA++A+  
Sbjct  675  ELIQILDKKAGNWPIEETRQLAALALYCTELRAKDRPDLEDQILPVLESLKKVADKARNS  734

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S AP  PP++F+CP+LKDVM++PC+AADGYTYDR+AIE W+  +  SP+T+ PL + NL
Sbjct  735  LSAAPSQPPSHFICPLLKDVMKEPCIAADGYTYDRRAIEEWMENHRTSPVTDSPLQNVNL  794

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W++  Q
Sbjct  795  LPNHTLYAAIVEWRNRNQ  812



>ref|XP_002437797.1| hypothetical protein SORBIDRAFT_10g002760 [Sorghum bicolor]
 gb|EER89164.1| hypothetical protein SORBIDRAFT_10g002760 [Sorghum bicolor]
Length=770

 Score =   242 bits (617),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT CYIDPEY RTG++S KSDVYALG+V+LQLLTA+  +GL H+VETA++     +
Sbjct  577  TAPVGTFCYIDPEYQRTGVLSMKSDVYALGIVLLQLLTARSPMGLAHVVETALEDGCFVD  636

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP  E +ELA+LALRC+E++RKDRPDL DH+LP LE+LKDVA +A+E A   
Sbjct  637  ILDATAGQWPLNEAQELAILALRCSEMRRKDRPDLNDHVLPTLERLKDVAAKAREDAFQG  696

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP++F+CPIL++VM DP VA+DGYTYDRKAIE WL+ NE SPMTNL LP+K+L+PN+
Sbjct  697  HTAPPSHFICPILQEVMIDPYVASDGYTYDRKAIELWLSTNETSPMTNLRLPNKSLIPNH  756

Query  197  TILSAITVWKS  165
            ++ SAI  W+S
Sbjct  757  SLRSAILDWRS  767



>ref|XP_008809460.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Phoenix dactylifera]
Length=745

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY RTGL+S KSD+YALGMVILQLLTAK  +GLT IVE A++   L 
Sbjct  551  DTTPVGTMFYIDPEYQRTGLVSAKSDIYALGMVILQLLTAKPPMGLTLIVERALEEGNLM  610

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD  AG+WP EET+ELA+L L C EL+RKDRP LK+ +LP+LEKLK +A++A   AS 
Sbjct  611  EVLDPGAGQWPLEETQELALLGLGCAELRRKDRPALKEQVLPLLEKLKVIADKAHVCASH  670

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PPN+F+CPIL++VM DPCVA+DGYTYDRKAIE WL  N+ SPMTNL LP+KNL+PN
Sbjct  671  TPSAPPNHFICPILQEVMNDPCVASDGYTYDRKAIEIWLGMNDKSPMTNLQLPNKNLIPN  730

Query  200  YTILSAITVWKSGKQ  156
            +++ SAI  WKS  Q
Sbjct  731  HSLRSAIMDWKSRSQ  745



>ref|NP_200963.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
 sp|Q9FKG6.1|PUB52_ARATH RecName: Full=U-box domain-containing protein 52; AltName: Full=Plant 
U-box protein 52; Includes: RecName: Full=E3 ubiquitin 
ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 dbj|BAB08999.1| receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED97486.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
Length=845

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  650  QTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  709

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              ILD +AG WP  +T+ELA L L CTE++R+DRPDLKD I+P LE+L+ VA++A+ + S
Sbjct  710  MAILDKKAGSWPISDTRELAALGLCCTEMRRRDRPDLKDQIIPALERLRKVADKAQNLLS  769

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LK VM +PCVAADGYTYDR+AIE WL + + SP+TNLPLP+KNL+ 
Sbjct  770  RTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWLRQKDTSPVTNLPLPNKNLIA  829

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS K+
Sbjct  830  NYTLYSAIMEWKSNKR  845



>ref|XP_008803845.1| PREDICTED: U-box domain-containing protein 52 [Phoenix dactylifera]
Length=811

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT  YIDPEY RTGL+SP+SD YALGMVIL+LLTAK  +GL HIVE A+    L 
Sbjct  617  DTAPVGTFFYIDPEYQRTGLVSPQSDTYALGMVILELLTAKSPMGLAHIVENALQGSCLM  676

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD+ AG+WP EET+ELA L L C E++RKDRPDLKD +LP LE+LKD AN A ++A  
Sbjct  677  DVLDSRAGQWPPEETQELAFLGLSCLEMRRKDRPDLKDQVLPWLERLKDFANNAHDLARQ  736

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A   PP+YF+CP+LK VM+DPC+A+DGYTY+R AIE+WL  N+ SPMTNLPLP+K+L+PN
Sbjct  737  ATSIPPSYFICPLLKRVMDDPCIASDGYTYNRNAIETWLRTNDKSPMTNLPLPNKDLIPN  796

Query  200  YTILSAITVWKSGKQ  156
             T+LSAI   KS  Q
Sbjct  797  QTLLSAIKDRKSRTQ  811



>ref|NP_001190588.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
 gb|AED97487.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
Length=860

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  650  QTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  709

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              ILD +AG WP  +T+ELA L L CTE++R+DRPDLKD I+P LE+L+ VA++A+ + S
Sbjct  710  MAILDKKAGSWPISDTRELAALGLCCTEMRRRDRPDLKDQIIPALERLRKVADKAQNLLS  769

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LK VM +PCVAADGYTYDR+AIE WL + + SP+TNLPLP+KNL+ 
Sbjct  770  RTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWLRQKDTSPVTNLPLPNKNLIA  829

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS K+
Sbjct  830  NYTLYSAIMEWKSNKR  845



>ref|XP_010919905.1| PREDICTED: U-box domain-containing protein 35 [Elaeis guineensis]
Length=815

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 152/195 (78%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ++ PVGT  YIDPEY RTGL+SP+SD YALGMVIL LLTAK  +GL HIVE A+    L 
Sbjct  621  DSAPVGTFFYIDPEYQRTGLVSPQSDTYALGMVILGLLTAKSPMGLAHIVEKALQDSCLM  680

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD+ AG+WP EET+ELA L L C EL+RKDRPDLKD +LP LE+LKD AN+A ++A  
Sbjct  681  DVLDSRAGQWPPEETQELAFLGLSCLELRRKDRPDLKDRVLPWLERLKDFANKAHDLAQQ  740

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A   PP+YF+CP++K VM+DPC+A+DGYTY R AIE+WL  N  SPMTNL LP+K+L+PN
Sbjct  741  ATSIPPSYFICPLVKRVMDDPCIASDGYTYSRNAIETWLRTNGKSPMTNLLLPNKDLIPN  800

Query  200  YTILSAITVWKSGKQ  156
             ++LSAI  WKS  Q
Sbjct  801  QSLLSAINDWKSRTQ  815



>ref|XP_009401649.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401650.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401651.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=803

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT  Y+DPEY RTGL+SPKSD YALGMVILQLLTAK  +GL  IVETA++ D L 
Sbjct  606  DTDPVGTFFYMDPEYQRTGLVSPKSDTYALGMVILQLLTAKSPMGLALIVETALERDCLM  665

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD++AG+WP+ E KELA+L L C EL+RKDRPDLKD +LPVLE+LK +A QA + A  
Sbjct  666  DILDSKAGQWPKAEAKELAILGLSCLELRRKDRPDLKDQVLPVLERLKAIAEQAYDSALH  725

Query  380  APPPPPNYFMCPILKD---VMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
                PPN+F+CPILK    VM+DPC+AADGYTY+R AIE+WL+ N+ SPMTNL LP + +
Sbjct  726  DSSVPPNHFICPILKFVQVVMDDPCIAADGYTYNRNAIETWLSRNDTSPMTNLLLPTQEI  785

Query  209  lpNYTILSAITVWKSGKQ  156
            + N ++LSAI  WK+  Q
Sbjct  786  ICNNSLLSAIKDWKARTQ  803



>ref|XP_006413335.1| hypothetical protein EUTSA_v10024396mg [Eutrema salsugineum]
 gb|ESQ54788.1| hypothetical protein EUTSA_v10024396mg [Eutrema salsugineum]
Length=841

 Score =   241 bits (616),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 127/193 (66%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLT K AI LTH VE A+D  D  
Sbjct  647  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMILLQLLTGKPAIALTHYVERAMDSNDEF  706

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDLKD ILP LE LK VA +A+   S
Sbjct  707  LKILDQKAGNWPVEETRELTALALCCTELRGKDRPDLKDQILPALESLKKVAEKARNSVS  766

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMTNLPL +KNLLP
Sbjct  767  GVPTQPPTHFLCPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTNLPLHNKNLLP  826

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  827  NYTLYTAIMEWRS  839



>ref|XP_008809455.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008809457.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008809458.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008809459.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
Length=804

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+ YIDPEY RTGL+S KSD+YALGMVILQLLTAK  +GLT IVE A++   L 
Sbjct  610  DTTPVGTMFYIDPEYQRTGLVSAKSDIYALGMVILQLLTAKPPMGLTLIVERALEEGNLM  669

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD  AG+WP EET+ELA+L L C EL+RKDRP LK+ +LP+LEKLK +A++A   AS 
Sbjct  670  EVLDPGAGQWPLEETQELALLGLGCAELRRKDRPALKEQVLPLLEKLKVIADKAHVCASH  729

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PPN+F+CPIL++VM DPCVA+DGYTYDRKAIE WL  N+ SPMTNL LP+KNL+PN
Sbjct  730  TPSAPPNHFICPILQEVMNDPCVASDGYTYDRKAIEIWLGMNDKSPMTNLQLPNKNLIPN  789

Query  200  YTILSAITVWKSGKQ  156
            +++ SAI  WKS  Q
Sbjct  790  HSLRSAIMDWKSRSQ  804



>gb|KFK27907.1| kinase family protein [Arabis alpina]
Length=855

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+T K AI +THI+E AI  D   
Sbjct  660  QTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITGKPAIAITHIMEEAIGNDAEF  719

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V ++A+   S
Sbjct  720  MALLDVKAGSWPINETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVDKAQNSLS  779

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LK VM +PCVAADGYTYDR++IE WL +N+ SP+TNLPLP+KNLL 
Sbjct  780  RTPSGPPSHFICPLLKGVMNEPCVAADGYTYDRESIEEWLRKNDTSPVTNLPLPNKNLLA  839

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS K+
Sbjct  840  NYTLYSAIMSWKSNKK  855



>ref|XP_009127317.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
Length=791

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG++SPKSDVYALGM+ILQLLTA+ AI LT+ VE A+   D D
Sbjct  594  QTSPVGTLCYIDPEYQRTGMLSPKSDVYALGMIILQLLTAQPAIALTYTVEIAMENNDDD  653

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTE++ KDRPDL+  ILPVLE LK VA +A++ 
Sbjct  654  ELIQILDKKAGDWPMEETRKLAALALHCTEIRAKDRPDLEKQILPVLESLKKVAEKARKT  713

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             + AP  PP++F+CP+LKDVM+DPC+AADGYTYDRKAIE W+ ++ +SP+T+ PL +  L
Sbjct  714  IASAPKQPPSHFICPLLKDVMKDPCIAADGYTYDRKAIEKWMEDHRSSPVTDSPLENMTL  773

Query  209  lpNYTILSAITVW  171
            LPN+T+ +AI  W
Sbjct  774  LPNHTLHAAIVEW  786



>emb|CDY16329.1| BnaA02g11330D [Brassica napus]
Length=792

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG++SPKSDVYALGM+ILQLLTA+ AI LT+ VE A+   D D
Sbjct  595  QTSPVGTLCYIDPEYQRTGMLSPKSDVYALGMIILQLLTAQPAIALTYTVEIAMENNDDD  654

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTE++ KDRPDL+  ILPVLE LK VA +A++ 
Sbjct  655  ELIQILDKKAGDWPIEETRQLAALALHCTEIRAKDRPDLEKQILPVLESLKKVAEKARKT  714

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             + AP  PP++F+CP+LKDVM+DPC+AADGYTYDRKAIE W+ ++ +SP+T+ PL +  L
Sbjct  715  IASAPKQPPSHFICPLLKDVMKDPCIAADGYTYDRKAIEKWMEDHRSSPVTDSPLENMTL  774

Query  209  lpNYTILSAITVW  171
            LPN+T+ +AI  W
Sbjct  775  LPNHTLHAAIVEW  787



>ref|XP_010433680.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Camelina 
sativa]
Length=740

 Score =   239 bits (610),  Expect = 7e-70, Method: Composition-based stats.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLTAK AI L H VE+A+D  D  
Sbjct  547  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPAIALAHFVESAMDSNDEF  606

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDLKD ILP LE LK VA++A+   S
Sbjct  607  LKILDQKAGNWPIEETRELTSLALCCTELRGKDRPDLKDQILPALESLKKVADKARNSLS  666

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+ PL  K+LLP
Sbjct  667  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDSPLRSKSLLP  726

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  727  NYTLYTAIMEWRS  739



>ref|XP_009130169.1| PREDICTED: U-box domain-containing protein 52 [Brassica rapa]
Length=855

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+T K AI +TH+VE AI  D   
Sbjct  661  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGIVILQLITGKPAIAITHVVEEAIGDDAEF  720

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V ++A+ +  
Sbjct  721  MALLDMKAGPWPISETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVDKAQNLIG  780

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LK VM +PCVAADGYTYDR+AI+ WL EN+ SP+TNLPLP+KNLL 
Sbjct  781  RTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIQDWLRENDTSPVTNLPLPNKNLLA  840

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WKS K
Sbjct  841  NYTLYSAIMEWKSNK  855



>ref|XP_006283114.1| hypothetical protein CARUB_v10004133mg [Capsella rubella]
 gb|EOA16012.1| hypothetical protein CARUB_v10004133mg [Capsella rubella]
Length=830

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLTAK AI L H VE+A+D +   
Sbjct  637  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPAIALAHYVESAMDSNEEF  696

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             ++LD +AG WP EET+EL  LAL CTEL+ KDRPDLKD ILP LE LK VA++A+   S
Sbjct  697  LKMLDQKAGNWPIEETRELTALALCCTELRGKDRPDLKDQILPALESLKKVADKARNSLS  756

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+ PL  KNLLP
Sbjct  757  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDSPLRSKNLLP  816

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  817  NYTLYTAIMEWRS  829



>ref|XP_006281721.1| hypothetical protein CARUB_v10027877mg [Capsella rubella]
 gb|EOA14619.1| hypothetical protein CARUB_v10027877mg [Capsella rubella]
Length=849

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  654  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  713

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V ++A+   S
Sbjct  714  MALLDVKAGSWPISETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVDKAQNSLS  773

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP++K VM +PCVAADGYTYDR+AIE WL E + SP+TNLPLP+K+LL 
Sbjct  774  RTPSGPPSHFICPLVKGVMNEPCVAADGYTYDREAIEEWLREKDTSPVTNLPLPNKSLLA  833

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WKS K
Sbjct  834  NYTLYSAIMEWKSNK  848



>ref|XP_004964500.1| PREDICTED: U-box domain-containing protein 35-like [Setaria italica]
Length=802

 Score =   239 bits (610),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 120/191 (63%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT+CYIDPEY RTG++S KSDVYALG+VILQLLTA+  +GL H+VETA++     +
Sbjct  609  TAPVGTLCYIDPEYQRTGVLSMKSDVYALGIVILQLLTARSPMGLAHVVETALEDGCFAD  668

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG+WP  ET+ELA LALRC+E++RKDRPDL +H+LP LE+LKDVA +A+E     
Sbjct  669  ILDATAGQWPLNETQELAALALRCSEMRRKDRPDLNEHVLPTLERLKDVATKARESVLKG  728

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
               PP++F+CPIL++VM DP VA+DGYTYDRKAIE WL+ N+ SPMTNL LP+K L+PN+
Sbjct  729  HTAPPSHFICPILQEVMIDPYVASDGYTYDRKAIELWLSTNDTSPMTNLRLPNKGLIPNH  788

Query  197  TILSAITVWKS  165
            ++ SAI  W+S
Sbjct  789  SLRSAIMDWRS  799



>ref|XP_006279824.1| hypothetical protein CARUB_v10028126mg [Capsella rubella]
 gb|AFJ66208.1| hypothetical protein 34G24.6 [Capsella rubella]
 gb|EOA12722.1| hypothetical protein CARUB_v10028126mg [Capsella rubella]
Length=810

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 152/195 (78%), Gaps = 3/195 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG ISPKSDVYALGM+ILQLLT +QA+ LT+ VE A+   D +
Sbjct  613  QTSPVGTLCYIDPEYQRTGRISPKSDVYALGMIILQLLTGQQAMALTYTVEIAMENNDDE  672

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTEL+ KDRPDLKD ILP LE LK  A++A+  
Sbjct  673  ELIQILDHKAGNWPMEETRQLAALALCCTELRAKDRPDLKDQILPALESLKKEADKARNS  732

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S AP  PP++F+CP+LKDVM++PC+AADGYTYDR AI  W+  N  SP+T+ PL + NL
Sbjct  733  ISAAPSQPPSHFLCPLLKDVMKEPCIAADGYTYDRSAIVEWMENNRTSPVTSSPLQNVNL  792

Query  209  lpNYTILSAITVWKS  165
            LPN+T+ +AI  W++
Sbjct  793  LPNHTLYAAIVEWRN  807



>gb|KFK29004.1| hypothetical protein AALP_AA7G076800 [Arabis alpina]
Length=831

 Score =   239 bits (610),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 123/193 (64%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CY+DPEY RTG IS KSDVY+ GM++LQLLTAK AI LTH VE+A+D  D  
Sbjct  637  QTSPVGTLCYMDPEYQRTGRISAKSDVYSFGMIVLQLLTAKPAIALTHFVESAMDSNDEF  696

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP +ET+EL  LAL CTEL+ KDRPDLK+ ILP LE LK VA++A+   S
Sbjct  697  VKILDQKAGNWPVQETRELTSLALCCTELRGKDRPDLKNQILPALESLKKVADKARNSIS  756

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+L L  KNLLP
Sbjct  757  GVPTQPPTHFLCPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDLLLHSKNLLP  816

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  817  NYTLYTAIMEWRS  829



>ref|XP_011076423.1| PREDICTED: U-box domain-containing protein 35 [Sesamum indicum]
Length=803

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTG++SP+SDVYA GMVILQLLTAK AI L H VE A++ D L 
Sbjct  609  DTAPVGTLCYIDPEYQRTGVVSPQSDVYAFGMVILQLLTAKPAIALAHEVELAVENDRLM  668

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG WP EET +LA++AL+CTEL+R+DRPDL+D +LPVLEK+KD A  A+ +  I
Sbjct  669  EVLDPEAGPWPVEETNDLALIALKCTELRRRDRPDLRDQVLPVLEKMKDKAETARNLTLI  728

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            +PPPPP++F CPILK+VM DPCVA DGYTY+R AI+ WL E + SPMTNL LPHK L+P+
Sbjct  729  SPPPPPDHFKCPILKEVMTDPCVAGDGYTYERNAIKEWLKEKDTSPMTNLQLPHKCLIPD  788

Query  200  YTILSAITVWKSGKQ  156
            YT+LS I  WKSGK 
Sbjct  789  YTLLSVIMEWKSGKH  803



>ref|XP_009370502.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=778

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT+ YIDPEY RTG+ISP+SDVYA GMVILQLLTAK A  +TH+VETA+    L 
Sbjct  584  DTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARAITHLVETAVKDKNLT  643

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             +LD +AG WP EET++LA L L C EL+R+DRPDL++ ++P+LE+LK+VA  AK  AS+
Sbjct  644  AVLDPKAGHWPMEETRQLAELGLSCAELRRRDRPDLREQVVPLLERLKEVAETAKNSASV  703

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PPN+F+CPILKDVM++PCVAADGYTYDRK IE WL EN+NSPMTNLPLP+KN++ N
Sbjct  704  VQCLPPNHFICPILKDVMDEPCVAADGYTYDRKEIEKWLEENDNSPMTNLPLPNKNVILN  763

Query  200  YTILSAITVWKSGKQ  156
            YT+LSAIT WK+ KQ
Sbjct  764  YTLLSAITEWKTRKQ  778



>emb|CDX91574.1| BnaC02g15860D [Brassica napus]
Length=798

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG++SPKSDVYALGM+ILQLLTA+ AI LT+ VE A+   D D
Sbjct  601  QTSPVGTLCYIDPEYQRTGMLSPKSDVYALGMIILQLLTAQPAIALTYTVEIAMENNDDD  660

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTE++ KDRPDL+  ILPVLE LK VA +A++ 
Sbjct  661  ELIQILDKKAGGWPMEETRKLAALALHCTEIRAKDRPDLEKQILPVLENLKKVAEKARKT  720

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             + AP  PP++F+CP+LKDVM+DPC+AADGYTYDRKAIE W+ +  +SP+T+ PL +  L
Sbjct  721  IASAPKQPPSHFICPLLKDVMKDPCIAADGYTYDRKAIEKWMEDYRSSPVTDSPLENMTL  780

Query  209  lpNYTILSAITVW  171
            LPN+T+ +AI  W
Sbjct  781  LPNHTLHAAIVEW  793



>ref|XP_010482460.1| PREDICTED: LOW QUALITY PROTEIN: putative U-box domain-containing 
protein 53 [Camelina sativa]
Length=821

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI---D  570
            +T PVGT+CYIDPEY RTG I+PKSDVYA GM+ILQLLTA+ A+ LT+ VE A++    D
Sbjct  624  QTSPVGTLCYIDPEYQRTGRITPKSDVYAFGMIILQLLTAQPAMALTYTVEIAMENNNDD  683

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTEL+ KDRPDLKD ILP LE LK VA++AK  
Sbjct  684  ELIQILDQKAGNWPIEETRQLAALALCCTELRSKDRPDLKDQILPELESLKKVADKAKNS  743

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S AP  PP++F+CP+LKDVM+DPC+AADGY+YDR+AI  W++ +  SP+TN PL + NL
Sbjct  744  LSAAPSQPPSHFLCPLLKDVMKDPCIAADGYSYDRQAIMEWMDNHRTSPVTNSPLQNVNL  803

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W++  Q
Sbjct  804  LPNHTLYAAIVEWRNRNQ  821



>ref|XP_006394493.1| hypothetical protein EUTSA_v10005349mg [Eutrema salsugineum]
 gb|ESQ31779.1| hypothetical protein EUTSA_v10005349mg [Eutrema salsugineum]
Length=846

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  652  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  711

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V ++A+   S
Sbjct  712  MGLLDVKAGSWPISETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVDKAQNSLS  771

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LK VM +PCVAADGYTYDR+AIE WL E + SP+TNLPLP+KNLL 
Sbjct  772  RTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEDWLREKDVSPVTNLPLPNKNLLA  831

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WKS K
Sbjct  832  NYTLYSAIMEWKSNK  846



>ref|XP_010433679.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Camelina 
sativa]
Length=831

 Score =   238 bits (608),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLTAK AI L H VE+A+D  D  
Sbjct  638  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPAIALAHFVESAMDSNDEF  697

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDLKD ILP LE LK VA++A+   S
Sbjct  698  LKILDQKAGNWPIEETRELTSLALCCTELRGKDRPDLKDQILPALESLKKVADKARNSLS  757

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+ PL  K+LLP
Sbjct  758  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDSPLRSKSLLP  817

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  818  NYTLYTAIMEWRS  830



>emb|CDX87220.1| BnaC09g05350D [Brassica napus]
Length=827

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 153/196 (78%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTGLISPKSDVY+LG+VILQL+TAK AIG+THIVE AI  D   
Sbjct  631  KTSPVGTLCYIDPEYQRTGLISPKSDVYSLGVVILQLITAKPAIGITHIVEEAIGDDAEF  690

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L LRCTE++R+DRPDLKD I+P LE+L+ V ++ +   S
Sbjct  691  MGLLDVKAGAWPISETRELAALGLRCTEMRRRDRPDLKDEIIPALERLRKVVDKYQNSLS  750

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++F+CP+LK VM  PC+A+DGYTYDR+AIE WL E + SP+TNLPLP++NLL 
Sbjct  751  RTPSGPPSHFICPLLKGVMNQPCLASDGYTYDREAIEDWLREKDTSPVTNLPLPNRNLLA  810

Query  203  NYTILSAITVWKSGKQ  156
            NY++ SAI  WK   +
Sbjct  811  NYSLYSAIMEWKKSNK  826



>ref|NP_194246.2| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9SW11.2|PUB35_ARATH RecName: Full=U-box domain-containing protein 35; AltName: Full=Plant 
U-box protein 35; Includes: RecName: Full=E3 ubiquitin 
ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 gb|AEE85018.1| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
Length=835

 Score =   238 bits (608),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 125/195 (64%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG IS KSD+Y+ GM++LQLLTAK AI LTH VE+A+D  D  
Sbjct  641  QTSPVGTLCYIDPEYQRTGRISSKSDIYSFGMILLQLLTAKPAIALTHFVESAMDSNDEF  700

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+ELA LAL CTEL+ KDRPDLKD ILP LE LK VA +A+   S
Sbjct  701  LKILDQKAGNWPIEETRELAALALCCTELRGKDRPDLKDQILPALENLKKVAEKARNSFS  760

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR AIE WL E+  SPMT+ PL  KNLLP
Sbjct  761  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRHAIEEWLKEHNTSPMTDSPLHSKNLLP  820

Query  203  NYTILSAITVWKSGK  159
            NYT+ +AI  W+S +
Sbjct  821  NYTLYTAIMEWRSTR  835



>ref|XP_010457459.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
 ref|XP_010457466.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=849

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 154/196 (79%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  654  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  713

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V ++A+   S
Sbjct  714  MALLDVKAGTWPISETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVDKAQNTLS  773

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CP++K VM +PCVAADGYTYDR+AIE WL E + SP+TNLPLP+K+LL 
Sbjct  774  RTLSGPPSHFICPLIKGVMNEPCVAADGYTYDREAIEEWLREKDTSPVTNLPLPNKSLLA  833

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS KQ
Sbjct  834  NYTLYSAIMEWKSNKQ  849



>ref|XP_010442610.1| PREDICTED: putative U-box domain-containing protein 53 [Camelina 
sativa]
Length=804

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG ISPKSDVYA GM+ILQLLTA+ A+ LT+ VE A+   D D
Sbjct  607  QTSPVGTLCYIDPEYQRTGRISPKSDVYAFGMIILQLLTAQPAMALTYTVEIAMENNDDD  666

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L ++LD +AG WP EET++LA LAL CTEL+ KDRPDL+D +LPVLE LK VA +AK  
Sbjct  667  ELIQLLDKKAGNWPIEETRKLAALALYCTELRSKDRPDLEDQVLPVLESLKKVAAKAKNS  726

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
               AP  PP++F+CP+LKDVM+DPC+AADGY+YDRKAI  W+  +  SP+TN PL + NL
Sbjct  727  FFAAPSQPPSHFICPLLKDVMKDPCIAADGYSYDRKAIVEWMENHRTSPVTNSPLQNVNL  786

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W++  Q
Sbjct  787  LPNHTLYAAIVEWRNRNQ  804



>ref|XP_002867622.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43881.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=832

 Score =   238 bits (607),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 124/195 (64%), Positives = 150/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG+IS KSDVY+ GM++LQLLTAK AI LTH VE+A+D  D  
Sbjct  638  QTSPVGTLCYIDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPAIALTHFVESAMDSNDEF  697

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDLK+ ILP LE LK VA  A+   S
Sbjct  698  LKILDQKAGNWPIEETRELTALALCCTELRGKDRPDLKNQILPALENLKKVAEMARNSLS  757

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR+AIE WL E++ SPMT+ PL  KNLLP
Sbjct  758  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRRAIEEWLEEHDTSPMTDSPLHSKNLLP  817

Query  203  NYTILSAITVWKSGK  159
            NYT+ +AI  W+S +
Sbjct  818  NYTLYTAIMEWRSTR  832



>gb|AFW85931.1| putative U-box domain protein kinase family [Zea mays]
Length=358

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 152/193 (79%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT CYIDPEY RTG++S KSDVYALG+V+LQLLTA+  +GL H VETA++     
Sbjct  163  DTAPVGTFCYIDPEYQRTGVLSMKSDVYALGIVLLQLLTARPPVGLAHAVETALEEGRFA  222

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD  AG+WP  E +ELAVLALRC+E++RKDRPDL   +LP LE+LKDVA +A+E A  
Sbjct  223  DVLDAAAGQWPLGEAQELAVLALRCSEMRRKDRPDLNGRVLPALERLKDVAAKAREGAFQ  282

Query  380  A-PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CPIL++VM DP VA+DGYTYD KAIE WL+ NE SPMTNL LP+K+L+P
Sbjct  283  GHAAAPPSHFICPILQEVMVDPYVASDGYTYDGKAIELWLSTNETSPMTNLRLPNKSLIP  342

Query  203  NYTILSAITVWKS  165
            N+++ SAI  W+S
Sbjct  343  NHSLRSAIMDWRS  355



>emb|CDY12184.1| BnaC04g12140D [Brassica napus]
Length=529

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ GM++LQLLTAK  + LTH+VE+A+D  D  
Sbjct  334  QTSPVGTLSYMDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPPMALTHLVESAMDSNDEF  393

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDR DL+D ILP LE LK VA +A+   S
Sbjct  394  LKILDQKAGNWPVEETRELTSLALCCTELRGKDRLDLRDQILPALESLKKVAEKARNSIS  453

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR+AIE W  E+  SPMT+ PL  KNLLP
Sbjct  454  SVPTQPPFHFLCPLLKDVMNEPCVAADGYTYDRRAIEEWFEEHNTSPMTDSPLLSKNLLP  513

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  514  NYTLYTAIMEWRS  526



>emb|CAB36758.1| putative Ser/Thr protein kinase [Arabidopsis thaliana]
 emb|CAB79425.1| putative Ser/Thr protein kinase [Arabidopsis thaliana]
Length=814

 Score =   237 bits (605),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 125/195 (64%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+CYIDPEY RTG IS KSD+Y+ GM++LQLLTAK AI LTH VE+A+D  D  
Sbjct  620  QTSPVGTLCYIDPEYQRTGRISSKSDIYSFGMILLQLLTAKPAIALTHFVESAMDSNDEF  679

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+ELA LAL CTEL+ KDRPDLKD ILP LE LK VA +A+   S
Sbjct  680  LKILDQKAGNWPIEETRELAALALCCTELRGKDRPDLKDQILPALENLKKVAEKARNSFS  739

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP +F+CP+LKDVM +PCVAADGYTYDR AIE WL E+  SPMT+ PL  KNLLP
Sbjct  740  GVSTQPPTHFICPLLKDVMNEPCVAADGYTYDRHAIEEWLKEHNTSPMTDSPLHSKNLLP  799

Query  203  NYTILSAITVWKSGK  159
            NYT+ +AI  W+S +
Sbjct  800  NYTLYTAIMEWRSTR  814



>ref|NP_001056754.1| Os06g0140800 [Oryza sativa Japonica Group]
 dbj|BAF18668.1| Os06g0140800 [Oryza sativa Japonica Group]
 dbj|BAG89620.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79961.1| hypothetical protein OsI_21572 [Oryza sativa Indica Group]
 gb|EEE65060.1| hypothetical protein OsJ_20070 [Oryza sativa Japonica Group]
Length=806

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT CYIDPEY R+G++S KSDVYALG+VILQLLTAK  +G+ H+VETA++     +
Sbjct  613  TAPVGTFCYIDPEYQRSGVVSMKSDVYALGIVILQLLTAKSPMGIAHVVETALEDGHFVD  672

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA-SI  381
            ILD  AG+WP  E +ELA LAL+C E++R+DRPDL DH+LP LE+LKDVA +A+EMA + 
Sbjct  673  ILDAAAGQWPLNEAQELAFLALKCAEMRRRDRPDLSDHVLPALERLKDVATKAREMAFNG  732

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PP++F+CPIL++VM DP VA+DGYTYDRKAIE WL+ N+ SPMTNL LPHK+L+PN
Sbjct  733  HQTAPPSHFICPILQEVMADPYVASDGYTYDRKAIELWLSMNDKSPMTNLRLPHKSLIPN  792

Query  200  YTILSAITVWKS  165
            +++ SAI  W++
Sbjct  793  HSLRSAIIDWRT  804



>ref|XP_009138907.1| PREDICTED: U-box domain-containing protein 35 [Brassica rapa]
Length=840

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ GM++LQLLTAK  + LTH+VE+A+D  D  
Sbjct  645  QTSPVGTLSYMDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPPMALTHLVESAMDSNDEF  704

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D ILP LE LK VA +A+   S
Sbjct  705  LKILDQKAGNWPVEETRELTSLALCCTELRGKDRPDLRDQILPALESLKKVAEKARNSIS  764

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR+AIE W  E+  SPMT+ PL  KNLLP
Sbjct  765  SVPTQPPFHFLCPLLKDVMNEPCVAADGYTYDRRAIEEWFEEHNTSPMTDSPLLSKNLLP  824

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  825  NYTLYTAIMEWRS  837



>emb|CDY34347.1| BnaA01g14500D [Brassica napus]
Length=840

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ GM++LQLLTAK  + LTH+VE+A+D  D  
Sbjct  645  QTSPVGTLSYMDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPPMALTHLVESAMDSNDEF  704

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D ILP LE LK VA +A+   S
Sbjct  705  LKILDQKAGNWPVEETRELTSLALCCTELRGKDRPDLRDQILPALESLKKVAEKARNSIS  764

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR+AIE W  E+  SPMT+ PL  KNLLP
Sbjct  765  SVPTQPPFHFLCPLLKDVMNEPCVAADGYTYDRRAIEEWFEEHNTSPMTDSPLLSKNLLP  824

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  825  NYTLYTAIMEWRS  837



>ref|XP_010548832.1| PREDICTED: U-box domain-containing protein 52-like [Tarenaya 
hassleriana]
Length=812

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 160/197 (81%), Gaps = 2/197 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY R+G+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  616  DTSPVGTLCYIDPEYQRSGIISPKSDVYSLGVVILQLMTAKPAIAVTHLVEEAIGDDAQF  675

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             E+LD +AG+WP  ET+ELA LAL CTEL+R+DRPDLKD ILP LE+L+  A++A + + 
Sbjct  676  MEVLDAKAGEWPINETRELAALALWCTELRRRDRPDLKDQILPTLERLRKFADKAAQSSL  735

Query  383  I-APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
            + A   PP++F+CP+L DVM++PCVAADGYTYDR+AIE WL +++ SP+T LPLP KNLL
Sbjct  736  LKAMTRPPSHFICPLLMDVMKEPCVAADGYTYDRQAIEEWLRDHDASPVTKLPLPSKNLL  795

Query  206  pNYTILSAITVWKSGKQ  156
            PNYT+ +AI  WKS K+
Sbjct  796  PNYTLHAAIVEWKSQKK  812



>ref|XP_010483826.1| PREDICTED: U-box domain-containing protein 52 [Camelina sativa]
 ref|XP_010483827.1| PREDICTED: U-box domain-containing protein 52 [Camelina sativa]
Length=849

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 154/196 (79%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  654  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  713

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V ++A+   S
Sbjct  714  MALLDVKAGTWPISETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVDKAQNSLS  773

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CP++K VM +PCVAADGYTYDR+AIE WL E + SP+TNLPLP+KNLL 
Sbjct  774  RTLSGPPSHFICPLIKGVMNEPCVAADGYTYDREAIEEWLREKDTSPVTNLPLPNKNLLA  833

Query  203  NYTILSAITVWKSGKQ  156
            NYT+ SAI  WKS +Q
Sbjct  834  NYTLYSAIMEWKSNEQ  849



>ref|XP_006837329.1| hypothetical protein AMTR_s00111p00076670 [Amborella trichopoda]
 gb|ERN00183.1| hypothetical protein AMTR_s00111p00076670 [Amborella trichopoda]
Length=803

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ET  VGT CY+DPEY RTG++S KSD+YA G++ILQLLTAK A+ L + VETA++   LE
Sbjct  609  ETSLVGTFCYVDPEYVRTGVVSSKSDLYAFGIIILQLLTAKPAMALANYVETALEGGKLE  668

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            EILD  AGKWP EET+ELA+LAL C EL+R+DRPDLK ++ PVLE+LK+ A+ ++     
Sbjct  669  EILDLTAGKWPLEETQELALLALGCAELRRRDRPDLKTNVFPVLERLKEKADLSRGSIPQ  728

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PP++F+CPI +DVME+PCVAADGYTY+ +AI+ WL+ N+ SPMTNLP+PHKNL+PN
Sbjct  729  VHCVPPSHFICPIFQDVMENPCVAADGYTYEHRAIDKWLSMNDKSPMTNLPMPHKNLVPN  788

Query  200  YTILSAITVWKSGKQ  156
            +T+LSAI  WKSG Q
Sbjct  789  FTLLSAIMEWKSGNQ  803



>ref|XP_010690148.1| PREDICTED: U-box domain-containing protein 35-like [Beta vulgaris 
subsp. vulgaris]
Length=871

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ET PVGT+CYIDPEY R G +S KSD+YALG+VILQLLTAK A+G+ +++E AID  TL 
Sbjct  675  ETSPVGTLCYIDPEYQRAGRVSTKSDIYALGVVILQLLTAKPAVGIAYMIEDAIDEGTLT  734

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E+LD EAG WP +ET ELA+L L+C EL+ +DRPDL++ +LP LE  KDVA++A+E AS 
Sbjct  735  ELLDPEAGAWPEKETLELALLGLQCAELRGRDRPDLREKVLPALEIFKDVADRARESASN  794

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A    P +FMCPILKD MEDP VAADGYTYDRKAIE WL E++ SP TN PLPHK ++PN
Sbjct  795  ALAETPAHFMCPILKDFMEDPYVAADGYTYDRKAIEKWLMESDMSPTTNQPLPHKFIMPN  854

Query  200  YTILSAITVWKSGK  159
             ++L AI  WKS K
Sbjct  855  TSLLEAIKQWKSKK  868



>emb|CDY00462.1| BnaA10g08110D [Brassica napus]
Length=637

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY R+G++S KSDVYA GM+ILQLLTA  AI LT+ VE A++ +  E
Sbjct  440  QTSPVGTLCYIDPEYQRSGMLSFKSDVYAFGMIILQLLTALPAIALTYKVEMAMENNDDE  499

Query  560  E---ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
            E   ILD +AG WP EET++LA LAL CTE++ KDRPDL+ HILP LE  K+VA +++ +
Sbjct  500  ELIKILDKKAGDWPMEETRKLAALALSCTEIRAKDRPDLETHILPALESFKNVAVKSRNL  559

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S AP  PP++F+CP+LKDVM +PCVAADGYTYDR+AIE W+ ++  SP+TNLPL +  L
Sbjct  560  ISSAPNQPPSHFLCPLLKDVMSEPCVAADGYTYDRRAIEEWMQDHRTSPVTNLPLQNIKL  619

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+++  AI  W+   Q
Sbjct  620  LPNHSVYEAIVEWRRNNQ  637



>emb|CDY03375.1| BnaC01g17070D [Brassica napus]
Length=1297

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -2

Query  740   ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
             +T PVGT+ Y+DPEY RTG+IS KSDVY+ GM++LQLLTAK  + LTH+VE+A+D  D  
Sbjct  1102  QTSPVGTLSYMDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPPMALTHLVESAMDSNDEF  1161

Query  563   EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D ILP LE LK VA +A+   S
Sbjct  1162  LKILDQKAGNWPVEETRELTSLALCCTELRGKDRPDLRDQILPALESLKKVAEKARNSIS  1221

Query  383   IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
               P  PP +F+CP+LKDVM +PCVAADGYTYDR+AIE W  E+  SPMT+ PL  KNLLP
Sbjct  1222  SVPTQPPFHFLCPLLKDVMNEPCVAADGYTYDRRAIEDWFEEHNTSPMTDSPLLSKNLLP  1281

Query  203   NYTILSAITVWKS  165
             NYT+ +AI  W+S
Sbjct  1282  NYTLYTAIMEWRS  1294


 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 95/122 (78%), Gaps = 2/122 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ GM++LQLLTAK  + LTH+VE+A+D  D  
Sbjct  611  QTSPVGTLSYMDPEYQRTGMISSKSDVYSFGMIVLQLLTAKPPMALTHLVESAMDSNDEF  670

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDV-ANQAKEMA  387
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D ILP LE+   + A +AK+++
Sbjct  671  LKILDQKAGNWPVEETRELTSLALCCTELRGKDRPDLRDQILPALERCMSMDAEEAKDVS  730

Query  386  SI  381
            SI
Sbjct  731  SI  732



>ref|XP_009112093.1| PREDICTED: U-box domain-containing protein 52-like [Brassica 
rapa]
Length=608

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTGLISPKSDVY+LG+VILQL+TAK AI +THIVE AI  D   
Sbjct  412  KTSPVGTLCYIDPEYQRTGLISPKSDVYSLGVVILQLITAKPAIAITHIVEEAIGDDAEF  471

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L LRCTE++R+DRPDLKD I+P LE+L+ V ++ +   S
Sbjct  472  MGLLDVKAGAWPVSETRELAALGLRCTEMRRRDRPDLKDEIIPALERLRKVVDKYQNSLS  531

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++ +CP+LK VM++PC+AADGYTY+ +AI+ WL E + SP+TNLPLP+KNLL 
Sbjct  532  RTPSGPPSHLICPLLKGVMDEPCLAADGYTYEHEAIDDWLREKDTSPVTNLPLPNKNLLA  591

Query  203  NYTILSAITVWK  168
            NYT+ SAI  WK
Sbjct  592  NYTLYSAIMEWK  603



>ref|XP_009137072.1| PREDICTED: U-box domain-containing protein 52 [Brassica rapa]
Length=844

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  650  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  709

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTE++R+DRPDLKD I+P LE+L  V  +A+   S
Sbjct  710  MALLDVKAGSWPISETRELAALGLCCTEMRRRDRPDLKDQIIPTLERLWKVVEKAQNSLS  769

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CP+LK VM  PCVAADG+TYDR+AIE WL EN+ SP+TNLPLP+KN L 
Sbjct  770  RTSLDPPSHFICPLLKGVMNQPCVAADGFTYDREAIEDWLRENDTSPVTNLPLPNKNRLA  829

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WK+ K
Sbjct  830  NYTLYSAIMEWKANK  844



>ref|XP_010482459.1| PREDICTED: putative U-box domain-containing protein 53 [Camelina 
sativa]
Length=800

 Score =   232 bits (591),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG IS KSDVYA GM+ILQLLTA+ A+ LT+ VE A+   D D
Sbjct  603  QTSPVGTLCYIDPEYQRTGRISSKSDVYAFGMIILQLLTAQPAMALTYTVEIAMENNDDD  662

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L ++LD +AG WP EET++LA LAL CTEL+ KDRPDL+D +LPVLE LK VA +AK  
Sbjct  663  ELIQLLDKKAGNWPIEETRKLAALALYCTELRSKDRPDLEDQVLPVLESLKKVAAKAKNS  722

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
               AP  PP++F+CP+LKDVM+DPC+AADGY+YDR+AI  W+  +  SP+TN PL + NL
Sbjct  723  LLAAPSQPPSHFICPLLKDVMKDPCIAADGYSYDRQAIVEWMENHRTSPVTNSPLQNVNL  782

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W++  Q
Sbjct  783  LPNHTLDAAIVEWRNRNQ  800



>ref|XP_006401994.1| hypothetical protein EUTSA_v10012716mg [Eutrema salsugineum]
 gb|ESQ43447.1| hypothetical protein EUTSA_v10012716mg [Eutrema salsugineum]
Length=809

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI---DID  570
            +T PVGT+CYIDPEY RTG++SPKSDVYA GM+ILQLLTA+ AI LT+ VE A+   D +
Sbjct  612  QTSPVGTLCYIDPEYQRTGMLSPKSDVYAFGMIILQLLTAQPAIALTYTVEIAMENNDDE  671

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
             L +ILD +AG WP EET++LA LAL CTEL+ KDRPDL++ ILP LE LK VA++A+  
Sbjct  672  ELIQILDKKAGDWPIEETRQLAALALYCTELRAKDRPDLENQILPTLEILKKVADKARNS  731

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S +   PP++F+CP+LKDVM++PCVAADGYTYDR++IE W+  +  SP+T+LPL + NL
Sbjct  732  LSDSAKQPPSHFICPLLKDVMKEPCVAADGYTYDRRSIEEWMENHRTSPVTDLPLQNMNL  791

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W+   Q
Sbjct  792  LPNHTLYAAIVEWRRKNQ  809



>emb|CDY02135.1| BnaA03g40320D [Brassica napus]
Length=844

 Score =   233 bits (593),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  650  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  709

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTE++R+DRPDLKD I+P LE+L  V  +A+   S
Sbjct  710  MALLDVKAGSWPISETRELAALGLCCTEMRRRDRPDLKDQIIPTLERLWKVVEKAQNSLS  769

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CP+LK VM  PCVAADG+TYDR+AIE WL EN+ SP+TNLPLP+KNLL 
Sbjct  770  RTSLDPPSHFICPLLKGVMNQPCVAADGFTYDREAIEDWLRENDTSPVTNLPLPNKNLLA  829

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WK+ K
Sbjct  830  NYTLYSAIMEWKANK  844



>emb|CDY23059.1| BnaC07g31280D [Brassica napus]
Length=848

 Score =   232 bits (592),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  654  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  713

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTE++R+DRPDLKD I+P LE+L  V  +A+   S
Sbjct  714  MALLDVKAGSWPISETRELAALGLCCTEMRRRDRPDLKDQIIPTLERLWKVVEKAQNSLS  773

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CP+LK VM  PCVAADG+TYDR+AIE WL EN+ SP+TNLPLP+KNLL 
Sbjct  774  RTSLDPPSHFICPLLKGVMNQPCVAADGFTYDREAIEDWLRENDTSPVTNLPLPNKNLLA  833

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WK+ K
Sbjct  834  NYTLYSAIMEWKANK  848



>emb|CDY16813.1| BnaA09g05690D [Brassica napus]
Length=830

 Score =   232 bits (591),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 2/197 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVG +CYIDPEY RTGLISPKSDVY+LG+VILQL+TAK AI +THIVE AI  D   
Sbjct  634  KTSPVGNLCYIDPEYQRTGLISPKSDVYSLGVVILQLITAKPAIAITHIVEEAIGDDAEF  693

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L LRCTE++R+DRPDLKD I+P LE+L+ V ++ +   S
Sbjct  694  MGLLDVKAGAWPVSETRELAALGLRCTEMRRRDRPDLKDEIIPALERLRKVVDKYQNSLS  753

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP++ +CP+LK VM +PC+AADGYTY+R+AI+ WL E + SP+TNLPLP+KNLL 
Sbjct  754  RTPSGPPSHLICPLLKGVMNEPCLAADGYTYEREAIDDWLREKDTSPVTNLPLPNKNLLA  813

Query  203  NYTILSAITVW-KSGKQ  156
            NYT+ SAI  W KS KQ
Sbjct  814  NYTLYSAIMEWKKSNKQ  830



>ref|XP_010443973.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=849

 Score =   232 bits (592),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY RTG+ISPKSDVY+LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  654  KTSPVGTLCYIDPEYQRTGIISPKSDVYSLGVVILQLITAKPAIAITHMVEEAIGDDAEF  713

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
              +LD +AG WP  ET+ELA L L CTEL+R+DRPDLKD I+P LE+L+ V  +A+   S
Sbjct  714  MALLDVKAGTWPISETRELAALGLCCTELRRRDRPDLKDQIIPALERLRKVVEKAQNSLS  773

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CP++K VM +PCVAADGYTYDR+AIE WL   + SP+TNLPLP+KNLL 
Sbjct  774  RTLSGPPSHFICPLIKGVMNEPCVAADGYTYDREAIEEWLRVKDTSPVTNLPLPNKNLLA  833

Query  203  NYTILSAITVWKSGK  159
            NYT+ SAI  WKS K
Sbjct  834  NYTLYSAIMEWKSNK  848



>emb|CDX92680.1| BnaC07g39380D [Brassica napus]
Length=808

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDID-TL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ G+++LQLLTAK  + LTH VE+A+D D   
Sbjct  613  QTSPVGTLSYMDPEYQRTGMISSKSDVYSFGIILLQLLTAKPPMALTHFVESAMDSDDGF  672

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D +LP LE +K V  +A+   S
Sbjct  673  LKILDRKAGNWPVEETRELTALALCCTELRGKDRPDLRDQVLPALESIKRVGEKARHSIS  732

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR AIE WL E++ SPMT+ PL +K+LLP
Sbjct  733  GVPTQPPTHFLCPLLKDVMNEPCVAADGYTYDRHAIEKWLVEHDTSPMTDSPLNNKDLLP  792

Query  203  NYTILSAITVWKS  165
            NYT+ +AI  W+S
Sbjct  793  NYTLFTAIMEWRS  805



>emb|CDY00464.1| BnaA10g08090D [Brassica napus]
Length=776

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 154/196 (79%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAI-DIDTL  564
            +T PVGT+CYIDPEY R+G++S KSDVYA GM+ILQLLTA  AI LT+ VETA+   D  
Sbjct  581  QTSPVGTLCYIDPEYQRSGMLSFKSDVYAFGMIILQLLTALPAIALTYKVETAMGKNDEF  640

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET++LA LAL CTE++ KDRPDL+ HILP LE LK+VA +++ + S
Sbjct  641  IQILDKKAGDWPMEETRKLAALALSCTEIRAKDRPDLETHILPALESLKNVAVKSRNLIS  700

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
             AP  PP++F+CP+LK+VM DPCVAADGYTYDR+AIE W+ ++  SP+TNLPL + NLLP
Sbjct  701  SAPNQPPSHFLCPLLKEVMSDPCVAADGYTYDRRAIEEWMEDHCTSPVTNLPLQNINLLP  760

Query  203  NYTILSAITVWKSGKQ  156
            N+++ +AI  W+   Q
Sbjct  761  NHSVCAAIGEWRHKNQ  776



>ref|XP_008660730.1| PREDICTED: U-box domain-containing protein 35-like [Zea mays]
Length=701

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 152/193 (79%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT CYIDPEY RTG++S KSDVYALG+V+LQLLTA+  +GL H VETA++     
Sbjct  506  DTAPVGTFCYIDPEYQRTGVLSMKSDVYALGIVLLQLLTARPPVGLAHAVETALEEGRFA  565

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD  AG+WP  E +ELAVLALRC+E++RKDRPDL   +LP LE+LKDVA +A+E A  
Sbjct  566  DVLDAAAGQWPLGEAQELAVLALRCSEMRRKDRPDLNGRVLPALERLKDVAAKAREGAFQ  625

Query  380  A-PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
                 PP++F+CPIL++VM DP VA+DGYTYD KAIE WL+ NE SPMTNL LP+K+L+P
Sbjct  626  GHAAAPPSHFICPILQEVMVDPYVASDGYTYDGKAIELWLSTNETSPMTNLRLPNKSLIP  685

Query  203  NYTILSAITVWKS  165
            N+++ SAI  W+S
Sbjct  686  NHSLRSAIMDWRS  698



>ref|XP_010546140.1| PREDICTED: U-box domain-containing protein 51 isoform X2 [Tarenaya 
hassleriana]
Length=785

 Score =   230 bits (586),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 118/194 (61%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT  YIDPEY RTGL+SP+SDVYA G+++LQL+TAK A+ L H +E A+      E
Sbjct  591  TGPVGTFFYIDPEYQRTGLVSPESDVYAFGIILLQLVTAKPAMALAHAMEKAVREGRSAE  650

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ++D  AG WP +E KE+  L LRCTEL+R+DRPDL D ILPVLE++K+VA  A+   S A
Sbjct  651  MVDATAGDWPGDEMKEIIKLGLRCTELRRRDRPDLGDEILPVLERMKNVACMARTAVSEA  710

Query  377  -PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               PPP +F+CP+ KD+MEDPCVAADGYTYDR+AIE WL E++ SPMT+LP PH NLLPN
Sbjct  711  LIDPPPGHFVCPLRKDIMEDPCVAADGYTYDRRAIEEWLQESDRSPMTDLPFPHTNLLPN  770

Query  200  YTILSAITVWKSGK  159
            +++LSAI  W+S +
Sbjct  771  HSLLSAIQEWRSNQ  784



>ref|XP_010546142.1| PREDICTED: U-box domain-containing protein 51 isoform X4 [Tarenaya 
hassleriana]
Length=781

 Score =   230 bits (586),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 118/194 (61%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT  YIDPEY RTGL+SP+SDVYA G+++LQL+TAK A+ L H +E A+      E
Sbjct  587  TGPVGTFFYIDPEYQRTGLVSPESDVYAFGIILLQLVTAKPAMALAHAMEKAVREGRSAE  646

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ++D  AG WP +E KE+  L LRCTEL+R+DRPDL D ILPVLE++K+VA  A+   S A
Sbjct  647  MVDATAGDWPGDEMKEIIKLGLRCTELRRRDRPDLGDEILPVLERMKNVACMARTAVSEA  706

Query  377  -PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               PPP +F+CP+ KD+MEDPCVAADGYTYDR+AIE WL E++ SPMT+LP PH NLLPN
Sbjct  707  LIDPPPGHFVCPLRKDIMEDPCVAADGYTYDRRAIEEWLQESDRSPMTDLPFPHTNLLPN  766

Query  200  YTILSAITVWKSGK  159
            +++LSAI  W+S +
Sbjct  767  HSLLSAIQEWRSNQ  780



>ref|XP_010546141.1| PREDICTED: U-box domain-containing protein 51 isoform X3 [Tarenaya 
hassleriana]
Length=782

 Score =   230 bits (586),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 118/194 (61%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT  YIDPEY RTGL+SP+SDVYA G+++LQL+TAK A+ L H +E A+      E
Sbjct  588  TGPVGTFFYIDPEYQRTGLVSPESDVYAFGIILLQLVTAKPAMALAHAMEKAVREGRSAE  647

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ++D  AG WP +E KE+  L LRCTEL+R+DRPDL D ILPVLE++K+VA  A+   S A
Sbjct  648  MVDATAGDWPGDEMKEIIKLGLRCTELRRRDRPDLGDEILPVLERMKNVACMARTAVSEA  707

Query  377  -PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               PPP +F+CP+ KD+MEDPCVAADGYTYDR+AIE WL E++ SPMT+LP PH NLLPN
Sbjct  708  LIDPPPGHFVCPLRKDIMEDPCVAADGYTYDRRAIEEWLQESDRSPMTDLPFPHTNLLPN  767

Query  200  YTILSAITVWKSGK  159
            +++LSAI  W+S +
Sbjct  768  HSLLSAIQEWRSNQ  781



>ref|XP_010546139.1| PREDICTED: U-box domain-containing protein 51 isoform X1 [Tarenaya 
hassleriana]
Length=786

 Score =   230 bits (586),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 118/194 (61%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TGPVGT  YIDPEY RTGL+SP+SDVYA G+++LQL+TAK A+ L H +E A+      E
Sbjct  592  TGPVGTFFYIDPEYQRTGLVSPESDVYAFGIILLQLVTAKPAMALAHAMEKAVREGRSAE  651

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ++D  AG WP +E KE+  L LRCTEL+R+DRPDL D ILPVLE++K+VA  A+   S A
Sbjct  652  MVDATAGDWPGDEMKEIIKLGLRCTELRRRDRPDLGDEILPVLERMKNVACMARTAVSEA  711

Query  377  -PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
               PPP +F+CP+ KD+MEDPCVAADGYTYDR+AIE WL E++ SPMT+LP PH NLLPN
Sbjct  712  LIDPPPGHFVCPLRKDIMEDPCVAADGYTYDRRAIEEWLQESDRSPMTDLPFPHTNLLPN  771

Query  200  YTILSAITVWKSGK  159
            +++LSAI  W+S +
Sbjct  772  HSLLSAIQEWRSNQ  785



>ref|XP_009385227.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=786

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT  Y+DPEY RTGL+S KSD YALGMVIL+LLTAK  +GL   +ETA++ D L 
Sbjct  593  DTAPVGTFFYMDPEYQRTGLVSAKSDTYALGMVILELLTAKSPMGLAFAIETALETDCLM  652

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD++AG+WP    KELA L LRC E++RKDRP+LKD +LPVLE+LKD   QA  ++  
Sbjct  653  DILDSKAGRWPEAGAKELANLGLRCLEMRRKDRPELKDQVLPVLERLKDTMAQA-HVSLR  711

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PP +F+CPI K VM+DPC+AADGYTYDR AI +WL+ NENSPMTNLPLP+K L+P+
Sbjct  712  DPSVPPKHFICPIQKTVMDDPCIAADGYTYDRYAIGAWLSWNENSPMTNLPLPNKELIPD  771

Query  200  YTILSAITVWKSGKQ  156
             ++LSAI  WK+  Q
Sbjct  772  NSLLSAIIDWKARTQ  786



>ref|XP_009119427.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
 ref|XP_009119428.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
 ref|XP_009119429.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
Length=794

 Score =   229 bits (584),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTG +SPKSDVYA GM+ILQLLTA  AI LT+ VE A++ +  E
Sbjct  597  QTSPVGTLCYIDPEYQRTGRLSPKSDVYAFGMIILQLLTALPAIALTYKVEMAMENNDDE  656

Query  560  E---ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
            E   ILD +AG WP EET++LA LAL CTE++ KDRPDL++ ILP LE L  VA  A+ +
Sbjct  657  ELIKILDKKAGDWPMEETRKLAALALYCTEIRAKDRPDLENQILPTLESLNKVAENARTL  716

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S  P  PP++F CP+LKDVM +PCVA+DGYTYDR+AIE W+ ++  SP+TNLPL + NL
Sbjct  717  ISYEPKQPPSHFFCPLLKDVMNEPCVASDGYTYDRRAIEEWMADHRTSPVTNLPLQNINL  776

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W+   Q
Sbjct  777  LPNHTLYAAIVEWRCSNQ  794



>emb|CDY00461.1| BnaA10g08120D [Brassica napus]
Length=794

 Score =   229 bits (583),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTG +SPKSDVYA GM+ILQLLTA  AI LT+ VE A++ +  E
Sbjct  597  QTSPVGTLCYIDPEYQRTGRLSPKSDVYAFGMIILQLLTALPAIALTYKVEMAMENNDDE  656

Query  560  E---ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM  390
            E   ILD +AG WP EET++LA LAL CTE++ KDRPDL++ ILP LE L  VA  A+ +
Sbjct  657  ELIKILDKKAGDWPMEETRKLAALALYCTEIRAKDRPDLENQILPTLESLNKVAENARTL  716

Query  389  ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S  P  PP++F CP+LKDVM +PCVA+DGYTYDR+AIE W+ ++  SP+TNLPL + NL
Sbjct  717  ISYEPKQPPSHFFCPLLKDVMNEPCVASDGYTYDRRAIEEWMADHRTSPVTNLPLQNINL  776

Query  209  lpNYTILSAITVWKSGKQ  156
            LPN+T+ +AI  W+   Q
Sbjct  777  LPNHTLYAAIVEWRCSNQ  794



>emb|CDY11059.1| BnaA03g47180D [Brassica napus]
Length=812

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ G+++LQLLTAK  + LTH VE+A+D  D  
Sbjct  617  QTSPVGTISYMDPEYQRTGMISSKSDVYSFGIILLQLLTAKPPMALTHFVESAMDTNDGF  676

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D +LP LE +K VA +A+   S
Sbjct  677  LKILDRKAGNWPVEETRELTALALCCTELRAKDRPDLRDQVLPALESMKRVAEKARHSIS  736

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR AIE W   +  SPMT+ PL +K+LLP
Sbjct  737  EVPTQPPTHFLCPLLKDVMNEPCVAADGYTYDRHAIEKWFEGHNTSPMTDSPLNNKDLLP  796

Query  203  NYTILSAITVWK  168
            NYT+ +AI  W+
Sbjct  797  NYTLYTAIMEWR  808



>ref|XP_009137501.1| PREDICTED: U-box domain-containing protein 35-like [Brassica 
rapa]
Length=808

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDI-DTL  564
            +T PVGT+ Y+DPEY RTG+IS KSDVY+ G+++LQLLTAK  + LTH VE+A+D  D  
Sbjct  613  QTSPVGTISYMDPEYQRTGMISSKSDVYSFGIILLQLLTAKPPMALTHFVESAMDTNDGF  672

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET+EL  LAL CTEL+ KDRPDL+D +LP LE +K VA +A+   S
Sbjct  673  LKILDRKAGNWPVEETRELTALALCCTELRAKDRPDLRDQVLPALESMKRVAEKARHSIS  732

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
              P  PP +F+CP+LKDVM +PCVAADGYTYDR AIE W   +  SPMT+ PL +K+LLP
Sbjct  733  EVPTQPPTHFLCPLLKDVMNEPCVAADGYTYDRHAIEKWFEGHNTSPMTDSPLNNKDLLP  792

Query  203  NYTILSAITVWK  168
            NYT+ +AI  W+
Sbjct  793  NYTLYTAIMEWR  804



>emb|CDX99935.1| BnaC09g27700D [Brassica napus]
Length=742

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 148/196 (76%), Gaps = 1/196 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-L  564
            +T PVGT+CYIDPEY R+G++S KSDVYA GM+ILQLLTA  AI LT+ VETA++ +   
Sbjct  547  QTSPVGTLCYIDPEYQRSGMLSFKSDVYAFGMIILQLLTALPAIALTYKVETAMEKNVEF  606

Query  563  EEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
             +ILD +AG WP EET++LA LAL CTE++ KDRPDL+  ILP LE  K+ A + + + S
Sbjct  607  IQILDKKAGDWPMEETRKLAALALSCTEIRVKDRPDLETQILPALESFKNAAEKVRNLIS  666

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
             A   PP +F+CP+LKDVM DPCVAADGYTYDR+AIE W+ ++  SP+TNLPL +  LLP
Sbjct  667  SASKQPPRHFLCPLLKDVMSDPCVAADGYTYDRRAIEEWMEDHCTSPVTNLPLQNIKLLP  726

Query  203  NYTILSAITVWKSGKQ  156
            N+++ +A+  W+   Q
Sbjct  727  NHSVCAAMVEWRHTNQ  742



>ref|XP_010546147.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
 ref|XP_010546148.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
 ref|XP_010546149.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
 ref|XP_010546150.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
Length=826

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDID--T  567
            +T PVGT+CYIDPEY RTG+IS KSDVY+LG+VILQL+TAK AI +T ++E AI  D   
Sbjct  629  KTSPVGTLCYIDPEYQRTGMISTKSDVYSLGIVILQLITAKPAIAITQMMEDAISEDDAV  688

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              E+LD +AG WP  ET+E A L L CTEL+ +DRPDL+D ILPVLE+L+ V  +A + +
Sbjct  689  FMEVLDGKAGAWPINETREFAALGLCCTELRGRDRPDLEDQILPVLERLRKVTEKASQNS  748

Query  386  -SIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
             S A   PP++F+CP+LKDVM +PCVAADGYTYDR+ IE W  ++  SP+TNLPL +KNL
Sbjct  749  LSQARTSPPSHFVCPLLKDVMNEPCVAADGYTYDRECIEEWFRDHNTSPVTNLPLLNKNL  808

Query  209  lpNYTILSAITVWKSGKQ  156
            LPNYT+ +AI  WKS K+
Sbjct  809  LPNYTLYTAIMEWKSKKK  826



>ref|XP_003557213.1| PREDICTED: U-box domain-containing protein 35-like [Brachypodium 
distachyon]
Length=836

 Score =   223 bits (567),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 114/212 (54%), Positives = 151/212 (71%), Gaps = 19/212 (9%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDID----  570
            T PVGT CYIDPEY RTG +S KSDVYALG+V+LQLLT +  +GL H VETA+D+D    
Sbjct  623  TAPVGTFCYIDPEYQRTGAVSAKSDVYALGVVLLQLLTGRPPMGLAHAVETALDLDLEAT  682

Query  569  ------TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDV-  411
                     E+LD  AG+WP EE +ELA LALRC E++R+DRP L++H+LP LE++KD+ 
Sbjct  683  GGGSSSAFAEMLDAAAGEWPLEEARELAALALRCAEMRRRDRPGLREHVLPALERMKDLA  742

Query  410  ------ANQAKEMASI--APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNEN  255
                  A + K  A +  +  P P++F+CPIL++VM DPCVA+DGYTYDRKAIE WL  N
Sbjct  743  AKAAAAAAREKNTALVLGSSTPTPSHFLCPILQEVMADPCVASDGYTYDRKAIEVWLGMN  802

Query  254  ENSPMTnlplphknllpNYTILSAITVWKSGK  159
              SPMTNL L  ++L+PN+++ SAI  W++ +
Sbjct  803  TKSPMTNLKLQSRSLIPNHSLRSAIMDWRTSR  834



>gb|EYU20191.1| hypothetical protein MIMGU_mgv1a004066mg [Erythranthe guttata]
Length=546

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 144/191 (75%), Gaps = 3/191 (2%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            +G VGT+ YIDPEY RTG+++P+SDVYA GMV+LQL+T K A  LTH VETA+D D L E
Sbjct  359  SGLVGTLSYIDPEYQRTGVVAPESDVYAFGMVVLQLITGKPATALTHKVETAVDNDRLTE  418

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD + G WP EETK LA +AL+CTEL+R DRP +K  +LPVLE+LKD A +A  +A ++
Sbjct  419  LLDKKGGDWPIEETKVLARMALKCTELRRIDRPKMKGEVLPVLERLKDFAEKAPNLALVS  478

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P     F+CPI   VM DPCVA DGYTYDR AIE W+   + SP+T+L LPHK+L+PNY
Sbjct  479  APTQ---FICPISNVVMSDPCVAGDGYTYDRGAIEKWIKVKDTSPVTDLQLPHKHLIPNY  535

Query  197  TILSAITVWKS  165
            T+LSAI  WKS
Sbjct  536  TLLSAIMEWKS  546



>dbj|BAJ89872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=703

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 151/204 (74%), Gaps = 13/204 (6%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQA-IGLTHIVETAIDID---  570
            T PVGT CYIDPEY RTG +S KSDVYALG+V+LQLLT + + +GL H +ETA++ D   
Sbjct  497  TAPVGTFCYIDPEYQRTGAVSTKSDVYALGVVVLQLLTGRTSPLGLAHAMETALEEDGDD  556

Query  569  -TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKE  393
             +  E+LD  AG+WP EE +ELA+LAL+C E++RKDRP L +H+LP LE++K VA +A  
Sbjct  557  SSFAEMLDATAGEWPPEEARELALLALQCAEMRRKDRPGLHEHVLPALERIKGVAARAAR  616

Query  392  --------MASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMT  237
                      S A    P +F+CPIL+++MEDPCVAADGYTYDRKAIE+W++  + SPMT
Sbjct  617  ETKALLLRSVSAAAAGAPGHFLCPILQEIMEDPCVAADGYTYDRKAIETWVSMKDKSPMT  676

Query  236  nlplphknllpNYTILSAITVWKS  165
            NL LP ++L+PN+++ SAI  W+S
Sbjct  677  NLRLPSRSLIPNHSLRSAIMDWRS  700



>ref|XP_010523202.1| PREDICTED: U-box domain-containing protein 51-like isoform X2 
[Tarenaya hassleriana]
Length=699

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 145/195 (74%), Gaps = 5/195 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT  YIDPEY RTGL+S +SDVYA G+++LQL+TAK A+ L H VE A+      
Sbjct  504  QTGPVGTFFYIDPEYQRTGLVSTESDVYAFGIILLQLVTAKPAMALAHAVEKAMREGKFA  563

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E++D  AG WP E+  E+  L LRCTEL+R+DRP+L   I+P LE+LK+VA  A+ +  +
Sbjct  564  EMVDATAGDWPEEDMTEIVKLGLRCTELRRRDRPNLGQEIIPALERLKNVACMARNV--V  621

Query  380  APPP---PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
            AP     PP++F+CP+ KD+MEDPCVAADGYTYDR+ IE WL  N+ SPMT+LP P K L
Sbjct  622  APKTLIDPPSHFLCPLRKDIMEDPCVAADGYTYDRRGIEEWLQGNDKSPMTDLPFPDKTL  681

Query  209  lpNYTILSAITVWKS  165
            LP++++LSAI  W+S
Sbjct  682  LPSHSLLSAIKEWRS  696



>ref|XP_010523201.1| PREDICTED: U-box domain-containing protein 51-like isoform X1 
[Tarenaya hassleriana]
Length=700

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 145/195 (74%), Gaps = 5/195 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TGPVGT  YIDPEY RTGL+S +SDVYA G+++LQL+TAK A+ L H VE A+      
Sbjct  505  QTGPVGTFFYIDPEYQRTGLVSTESDVYAFGIILLQLVTAKPAMALAHAVEKAMREGKFA  564

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            E++D  AG WP E+  E+  L LRCTEL+R+DRP+L   I+P LE+LK+VA  A+ +  +
Sbjct  565  EMVDATAGDWPEEDMTEIVKLGLRCTELRRRDRPNLGQEIIPALERLKNVACMARNV--V  622

Query  380  APPP---PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknl  210
            AP     PP++F+CP+ KD+MEDPCVAADGYTYDR+ IE WL  N+ SPMT+LP P K L
Sbjct  623  APKTLIDPPSHFLCPLRKDIMEDPCVAADGYTYDRRGIEEWLQGNDKSPMTDLPFPDKTL  682

Query  209  lpNYTILSAITVWKS  165
            LP++++LSAI  W+S
Sbjct  683  LPSHSLLSAIKEWRS  697



>gb|ABL85042.1| serine threonine kinase [Brachypodium sylvaticum]
Length=829

 Score =   219 bits (559),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 114/209 (55%), Positives = 150/209 (72%), Gaps = 16/209 (8%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDID----  570
            T PVGT CYIDPEY RTG +S KSDVYALG+V+LQLLT +  +GL H VETA+D+D    
Sbjct  619  TAPVGTFCYIDPEYQRTGAVSAKSDVYALGVVLLQLLTGRPPMGLAHAVETALDLDLDPA  678

Query  569  ----TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDV---  411
                   E+LD  AG+WP EE +ELA LALRC E++R+DRP L++H+LP LE++K +   
Sbjct  679  TGGGAFAEMLDATAGEWPLEEARELAALALRCAEMRRRDRPGLREHVLPALERMKHLAAK  738

Query  410  -ANQAKEMASIAP----PPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENS  246
             A  A+E  +  P     P P++F+CPIL++VM DPCVA+DGYTYDRKAIE WL  N  S
Sbjct  739  AAAAAREKNTALPLGSATPTPSHFLCPILQEVMADPCVASDGYTYDRKAIEVWLGMNTKS  798

Query  245  PMTnlplphknllpNYTILSAITVWKSGK  159
            PMTNL L  ++L+PN+++ SAI  W++ +
Sbjct  799  PMTNLRLQSRSLIPNHSLRSAIMDWRTSR  827



>gb|EYU20192.1| hypothetical protein MIMGU_mgv1a026292mg [Erythranthe guttata]
Length=795

 Score =   219 bits (557),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 113/191 (59%), Positives = 143/191 (75%), Gaps = 3/191 (2%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            +G VGT+ YIDPEY RTG+++P+SDVYA GMV+LQL+T K AI LTH VETA+  D L E
Sbjct  608  SGLVGTLSYIDPEYQRTGVVAPESDVYAFGMVVLQLITGKPAIALTHKVETAVANDRLTE  667

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD   G WP EETK LA++AL+CTEL+R DRP++K  +LPVLE+LKD A + + +A ++
Sbjct  668  LLDKNGGDWPIEETKSLALIALKCTELRRTDRPEMKGEVLPVLERLKDFAEKTRNVALVS  727

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
                P  F+CPI   VM DPCVA DGYTYDR AIE W+   + SP+T+L LPHK L+PNY
Sbjct  728  ---APKQFICPISNVVMSDPCVAGDGYTYDRGAIEEWIKAKDTSPVTDLQLPHKYLIPNY  784

Query  197  TILSAITVWKS  165
            T+LSAI  W S
Sbjct  785  TLLSAIMEWNS  795



>gb|EMT31075.1| U-box domain-containing protein 35 [Aegilops tauschii]
Length=824

 Score =   219 bits (558),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 114/201 (57%), Positives = 152/201 (76%), Gaps = 10/201 (5%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQA-IGLTHIVETAIDID---  570
            T PVGT CYIDPEY RTG +S KSDVYALG+V+LQLLT + + +GL H VETA++ D   
Sbjct  621  TTPVGTFCYIDPEYQRTGAVSAKSDVYALGVVVLQLLTGRTSPLGLAHAVETALEEDGGD  680

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKE-  393
            +  E+LD  AG+WP +E +ELA LALRC E++R+DRP L++HILP LE++KDVA +A   
Sbjct  681  SFAEMLDAPAGQWPPKEARELAALALRCAEMRRRDRPGLREHILPALERIKDVAARAARE  740

Query  392  -----MASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlp  228
                 + + +    P +F+CPIL+++MEDPCVAADGYTYDRKAIE+W++  + SPMTNL 
Sbjct  741  TKALLVRTASSAAAPGHFLCPILQEIMEDPCVAADGYTYDRKAIETWVSMKDKSPMTNLR  800

Query  227  lphknllpNYTILSAITVWKS  165
            LP K+L+PN+++ SAI  W S
Sbjct  801  LPSKSLIPNHSLRSAIMDWSS  821



>gb|EMS55617.1| U-box domain-containing protein 35 [Triticum urartu]
Length=826

 Score =   219 bits (557),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 114/200 (57%), Positives = 151/200 (76%), Gaps = 9/200 (5%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQA-IGLTHIVETAIDID---  570
            T PVGT CYIDPEY RTG +S KSDVYALG+V+LQLLT + + +GL H VETA++ D   
Sbjct  624  TTPVGTFCYIDPEYQRTGAVSAKSDVYALGVVVLQLLTGRTSPLGLAHAVETALEEDGGD  683

Query  569  TLEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKE-  393
            +  E+LD  AG+WP EE +ELA LALRC E++R+DRP L +HILP LE++KD+A +A   
Sbjct  684  SFAEMLDATAGQWPPEEARELAALALRCAEMRRRDRPGLHEHILPALERIKDIAARAARE  743

Query  392  ----MASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlpl  225
                + + +    P +F+CPIL+++MEDPCVAADGYTYDRKAIE+W++  + SPMTNL L
Sbjct  744  TKALLRTASSSAAPGHFLCPILQEIMEDPCVAADGYTYDRKAIETWVSMKDKSPMTNLRL  803

Query  224  phknllpNYTILSAITVWKS  165
            P K+L+PN+++ SAI  W S
Sbjct  804  PSKSLIPNHSLRSAIMDWSS  823



>dbj|BAF00647.1| hypothetical protein [Arabidopsis thaliana]
Length=523

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  322  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHSIEKALRDQTGK  381

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+ M 
Sbjct  382  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASIARNMF  441

Query  386  SI----APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+LP P 
Sbjct  442  ADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPS  501

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI  W+S
Sbjct  502  DSLLPNHSLLSAIKEWRS  519



>ref|XP_006280030.1| hypothetical protein CARUB_v10025907mg [Capsella rubella]
 gb|EOA12928.1| hypothetical protein CARUB_v10025907mg [Capsella rubella]
Length=795

 Score =   216 bits (549),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 106/198 (54%), Positives = 150/198 (76%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+T + A+GL H +E A+   T  
Sbjct  594  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTGRSAMGLAHTIEKALRDQTGK  653

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL + ILPVLE+LK+ A+ A+ M 
Sbjct  654  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGEEILPVLERLKEFASSARNMF  713

Query  386  S----IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +    +     P++F CPI KDVME+PCVAADGYTY+++AI+ WL +N  SP+T+LP P+
Sbjct  714  TENLIVHHHNAPSHFYCPITKDVMENPCVAADGYTYEKRAIKEWLQKNHKSPITDLPFPN  773

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI VW+S
Sbjct  774  DSLLPNHSLLSAIKVWRS  791



>ref|XP_010443975.1| PREDICTED: U-box domain-containing protein 51-like [Camelina 
sativa]
Length=794

 Score =   213 bits (542),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 108/197 (55%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  594  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHTIEKALRDQTGK  653

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA  A+ M 
Sbjct  654  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVAYNARNMF  713

Query  386  SIAPP---PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphk  216
                      P++F CPI KDVME+PCVAADGYTY++ AI+ WL +N  SPMT+LP P+ 
Sbjct  714  DEIDHHHHSAPSHFYCPITKDVMENPCVAADGYTYEKSAIKEWLQKNHKSPMTDLPFPNH  773

Query  215  nllpNYTILSAITVWKS  165
            +LLPN+++LSAI  W+S
Sbjct  774  SLLPNHSLLSAINEWRS  790



>ref|XP_010457479.1| PREDICTED: U-box domain-containing protein 51-like [Camelina 
sativa]
Length=796

 Score =   212 bits (539),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 108/197 (55%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  596  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHTIEKALRDQTGK  655

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+ M 
Sbjct  656  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASNARNMF  715

Query  386  SIAPP---PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphk  216
                      P++F CPI KDVME+PCVAADGYTY++ AI+ WL +N  SPMT+LP P+ 
Sbjct  716  DEIDHHHHNAPSHFYCPITKDVMENPCVAADGYTYEKSAIKEWLQKNHKSPMTDLPFPNH  775

Query  215  nllpNYTILSAITVWKS  165
            +LLPN ++LSAI  W+S
Sbjct  776  SLLPNQSLLSAINEWRS  792



>ref|XP_010483834.1| PREDICTED: U-box domain-containing protein 51 [Camelina sativa]
Length=798

 Score =   211 bits (538),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 107/199 (54%), Positives = 147/199 (74%), Gaps = 7/199 (4%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  596  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHTIEKALRDQTGK  655

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKE--  393
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+   
Sbjct  656  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASNARNIF  715

Query  392  ---MASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplp  222
               +        P++F CPI KDVME+PCVAADGYTY++ AI+ WL +N  SPMT+LP P
Sbjct  716  AENLIDHHHHNAPSHFYCPITKDVMENPCVAADGYTYEKSAIKEWLQKNHKSPMTDLPFP  775

Query  221  hknllpNYTILSAITVWKS  165
            + +LLPN+++LSAI  W+S
Sbjct  776  NHSLLPNHSLLSAINEWRS  794



>ref|XP_002864740.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40999.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=795

 Score =   211 bits (538),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 107/198 (54%), Positives = 148/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  595  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHTIEKALRDQTGK  654

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+ M 
Sbjct  655  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASNARNMF  714

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+LP P+
Sbjct  715  ADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPN  774

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI  W+S
Sbjct  775  HSLLPNHSLLSAIKEWRS  792



>ref|XP_006394492.1| hypothetical protein EUTSA_v10003692mg [Eutrema salsugineum]
 gb|ESQ31778.1| hypothetical protein EUTSA_v10003692mg [Eutrema salsugineum]
Length=759

 Score =   210 bits (535),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 106/198 (54%), Positives = 148/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            +TGPVGT  YIDPEY RTG+++ +SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  558  DTGPVGTFFYIDPEYQRTGVVTTESDIYAFGIILLQLVTARSAMGLAHTLEKALRDQTGK  617

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ +L LRC+E++++DRPDL   ILPVLE+LKDVA  A+++ 
Sbjct  618  FTEILDKTAGDWPVKEAKEMVMLGLRCSEMRKRDRPDLGKEILPVLERLKDVACNARDLF  677

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P++F CPI KDV+E+PCVAADGYTY+++AI+ WL +N  SPMT+LP P 
Sbjct  678  AETLIDHHHHAPSHFYCPITKDVIENPCVAADGYTYEKRAIKEWLQQNRKSPMTDLPFPS  737

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI  W+S
Sbjct  738  DSLLPNHSLLSAIKEWRS  755



>dbj|BAB09000.1| unnamed protein product [Arabidopsis thaliana]
Length=763

 Score =   209 bits (533),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 107/198 (54%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  562  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHSIEKALRDQTGK  621

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+ M 
Sbjct  622  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASIARNMF  681

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+LP P 
Sbjct  682  ADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPS  741

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI  W+S
Sbjct  742  DSLLPNHSLLSAIKEWRS  759



>ref|NP_200964.2| U-box domain-containing protein 51 [Arabidopsis thaliana]
 sp|Q9FKG5.2|PUB51_ARATH RecName: Full=U-box domain-containing protein 51; AltName: Full=Plant 
U-box protein 51; Includes: RecName: Full=E3 ubiquitin 
ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 gb|AED97488.1| U-box domain-containing protein 51 [Arabidopsis thaliana]
Length=796

 Score =   209 bits (533),  Expect = 9e-59, Method: Composition-based stats.
 Identities = 107/198 (54%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  595  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHSIEKALRDQTGK  654

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+ M 
Sbjct  655  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASIARNMF  714

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+LP P 
Sbjct  715  ADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPS  774

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI  W+S
Sbjct  775  DSLLPNHSLLSAIKEWRS  792



>emb|CDY02134.1| BnaA03g40330D [Brassica napus]
Length=771

 Score =   209 bits (532),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 106/198 (54%), Positives = 144/198 (73%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL TA+ A+GL H VE A+   T  
Sbjct  569  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLATARSAMGLAHSVEKALRDQTGN  628

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRP L   ILPVLE+LKD+A  A+ M 
Sbjct  629  FSEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPYLGKEILPVLERLKDIACDARNMF  688

Query  386  SIAPPP----PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            S          P++F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+ P P+
Sbjct  689  SETVNKHHNHAPSHFYCPITKDVMENPCVASDGYTYEKRAIKEWLEKNHKSPMTDSPFPN  748

Query  218  knllpNYTILSAITVWKS  165
            + LLPN+++L AI  W+S
Sbjct  749  QTLLPNHSLLFAIKEWRS  766



>ref|NP_001190589.1| U-box domain-containing protein 51 [Arabidopsis thaliana]
 gb|AED97489.1| U-box domain-containing protein 51 [Arabidopsis thaliana]
Length=794

 Score =   209 bits (532),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 107/198 (54%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL+TA+ A+GL H +E A+   T  
Sbjct  593  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLVTARSAMGLAHSIEKALRDQTGK  652

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LK+VA+ A+ M 
Sbjct  653  FTEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKEVASIARNMF  712

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+LP P 
Sbjct  713  ADNLIDHHHNAPTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKSPMTDLPFPS  772

Query  218  knllpNYTILSAITVWKS  165
             +LLPN+++LSAI  W+S
Sbjct  773  DSLLPNHSLLSAIKEWRS  790



>emb|CDY42870.1| BnaAnng06950D [Brassica napus]
Length=792

 Score =   208 bits (530),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            +TGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL TA+ A+GL H +E A+   T  
Sbjct  591  QTGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLATARSAMGLAHSLEKALRDQTGK  650

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+LKDVA  A+ M 
Sbjct  651  FSEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLKDVACNARNMF  710

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVM++PCVA+DGYTY++KAI  WL +N  SPMT+ P P+
Sbjct  711  AETLMDHNHHAPGHFYCPITKDVMDNPCVASDGYTYEKKAITEWLEKNHKSPMTDAPFPN  770

Query  218  knllpNYTILSAITVWKS  165
            + LLPN ++LSAI  W+S
Sbjct  771  QTLLPNQSLLSAIKEWRS  788



>ref|XP_009130168.1| PREDICTED: U-box domain-containing protein 51 [Brassica rapa]
Length=792

 Score =   207 bits (527),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 105/198 (53%), Positives = 142/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            +TGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL TA+ A+GL H +E A+   T  
Sbjct  591  QTGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLATARSAMGLAHSLEKALRDQTGK  650

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRPDL   ILPVLE+L DVA  A+ M 
Sbjct  651  FSEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPDLGKEILPVLERLNDVACNARNMF  710

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVM++PCVA+DGYTY++KAI  WL +N  SPMT+ P P+
Sbjct  711  AETLIDHNHHAPGHFYCPITKDVMDNPCVASDGYTYEKKAIMEWLEKNHKSPMTDAPFPN  770

Query  218  knllpNYTILSAITVWKS  165
            + LLPN ++LSAI  W+S
Sbjct  771  QTLLPNQSLLSAIKEWRS  788



>ref|XP_009136489.1| PREDICTED: U-box domain-containing protein 51 [Brassica rapa]
 ref|XP_009136490.1| PREDICTED: U-box domain-containing protein 51 [Brassica rapa]
 ref|XP_009136491.1| PREDICTED: U-box domain-containing protein 51 [Brassica rapa]
Length=791

 Score =   206 bits (525),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL TA+ A+GL H VE A+   T  
Sbjct  589  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLATARSAMGLAHSVEKALRDQTGN  648

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E++++DRP L   ILPVLE+LKD+A  A+ M 
Sbjct  649  FSEILDKTAGDWPVKEAKEMVMIGLRCAEMRKRDRPYLGKEILPVLERLKDIACDARNMF  708

Query  386  SIAPPP----PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            S          P++F CPI KDVME+PCVA+DGYTY+++AI+ WL +N  SPMT+ P P+
Sbjct  709  SETVNKHNNHAPSHFYCPITKDVMENPCVASDGYTYEKRAIKEWLEKNHKSPMTDSPFPN  768

Query  218  knllpNYTILSAITVWKS  165
            + LLPN+++L AI  W S
Sbjct  769  QTLLPNHSLLFAIKEWIS  786



>emb|CDY68766.1| BnaCnng60400D [Brassica napus]
Length=792

 Score =   206 bits (524),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 105/198 (53%), Positives = 142/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            +TGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL TA+ A+GL H +E A+   T  
Sbjct  591  QTGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLATARSAMGLAHSLEKALRDQTGK  650

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMA  387
              EILD  AG WP +E KE+ ++ LRC E+++ DRPDL   ILPVLE+LKDV+  A+ M 
Sbjct  651  FSEILDKTAGDWPVKEAKEMVMIGLRCAEMRKLDRPDLGKEILPVLERLKDVSCNARNMF  710

Query  386  SIA----PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
            +          P +F CPI KDVM++PCVA+DGYTY++KAI  WL +N  SPMT+ P P+
Sbjct  711  TETLVDHNHHAPGHFYCPITKDVMDNPCVASDGYTYEKKAIMEWLEKNHKSPMTDAPFPN  770

Query  218  knllpNYTILSAITVWKS  165
            + LLPN ++LSAI  W+S
Sbjct  771  QTLLPNQSLLSAIKEWRS  788



>ref|XP_002460191.1| hypothetical protein SORBIDRAFT_02g024310 [Sorghum bicolor]
 gb|EER96712.1| hypothetical protein SORBIDRAFT_02g024310 [Sorghum bicolor]
Length=835

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  728  VGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILD  549
            VGT+ Y+DPEY RTG +S KSDVYALGMV LQLLTA   +GL   VE A++ D L +ILD
Sbjct  639  VGTLFYMDPEYQRTGQVSAKSDVYALGMVFLQLLTANSPMGLADTVERAVEEDRLIDILD  698

Query  548  TEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPP  369
              AGKWP  E  EL  L LRC E++ KDRPDLK  +L VLE+L ++A+ A +     P  
Sbjct  699  QHAGKWPVREAHELTQLGLRCLEMRSKDRPDLKSKVLVVLERLNNMASTACDSVQAVPVA  758

Query  368  PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTIL  189
            PP++F+CPILK VM++PC+A+DGY+Y+R AIE WL+EN+ SP+T   LP KNL+PN+ +L
Sbjct  759  PPSHFICPILKRVMQNPCIASDGYSYERVAIEMWLHENDVSPLTKTRLPDKNLVPNHALL  818

Query  188  SAITVWK  168
              I  WK
Sbjct  819  CLINCWK  825



>emb|CDY23058.1| BnaC07g31290D [Brassica napus]
Length=792

 Score =   205 bits (522),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 106/198 (54%), Positives = 144/198 (73%), Gaps = 6/198 (3%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT--  567
            ETGPVGT  YIDPEY RTG+++P+SD+YA G+++LQL TA+ A+GL H VE A+   T  
Sbjct  590  ETGPVGTFFYIDPEYQRTGVVTPESDIYAFGIILLQLATARSAMGLAHSVEKALRDQTGN  649

Query  566  LEEILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEM-  390
              EILD  AG WP +E KE+ ++ LRC E++++DRP L   ILPVLE+LKDVA+ A+ M 
Sbjct  650  FSEILDETAGDWPVKEAKEMVMIGLRCAEMRKRDRPYLGKEILPVLERLKDVASDARNMF  709

Query  389  ---ASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplph  219
                S      P++F CPI KDVME+PCVA+DGYTY+++AI+  L +N  SPMT+ P P+
Sbjct  710  SETVSTHHNHAPSHFHCPITKDVMENPCVASDGYTYEKRAIKECLEKNHKSPMTDSPFPN  769

Query  218  knllpNYTILSAITVWKS  165
            + LLPN+++L AI  W+S
Sbjct  770  QTLLPNHSLLFAIKEWRS  787



>ref|XP_008652694.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 
[Zea mays]
Length=710

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T  VGT+ Y+DPEY RTG +S KSDVYALGMV LQLLTAK  IGL    E A++ D L +
Sbjct  511  TDLVGTLFYLDPEYQRTGQVSAKSDVYALGMVFLQLLTAKSPIGLADTAERAMEEDHLID  570

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG WP  E  EL  L LRC E++ KDRPDLK  +L VLE+L ++A+         
Sbjct  571  ILDQRAGNWPVREAHELTQLGLRCLEMRSKDRPDLKSKVLVVLERLNNLASTVYHSVQPI  630

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P  PP++F+CPILK VM+DPC+A+DGY+Y+R AIE WLNEN+ SP+T   LP KNL+PN 
Sbjct  631  PTAPPSHFICPILKRVMQDPCIASDGYSYERVAIEMWLNENDVSPLTKARLPDKNLVPNL  690

Query  197  TILSAITVWK  168
             ++  I  WK
Sbjct  691  ALICLINSWK  700



>tpg|DAA61370.1| TPA: putative U-box domain protein kinase family [Zea mays]
Length=696

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T  VGT+ Y+DPEY RTG +S KSDVYALGMV LQLLTAK  IGL    E A++ D L +
Sbjct  497  TDLVGTLFYLDPEYQRTGQVSAKSDVYALGMVFLQLLTAKSPIGLADTAERAMEEDHLID  556

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG WP  E  EL  L LRC E++ KDRPDLK  +L VLE+L ++A+         
Sbjct  557  ILDQRAGNWPVREAHELTQLGLRCLEMRSKDRPDLKSKVLVVLERLNNLASTVYHSVQPI  616

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P  PP++F+CPILK VM+DPC+A+DGY+Y+R AIE WLNEN+ SP+T   LP KNL+PN 
Sbjct  617  PTAPPSHFICPILKRVMQDPCIASDGYSYERVAIEMWLNENDVSPLTKARLPDKNLVPNL  676

Query  197  TILSAITVWK  168
             ++  I  WK
Sbjct  677  ALICLINSWK  686



>ref|XP_008652693.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Zea mays]
Length=781

 Score =   204 bits (519),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T  VGT+ Y+DPEY RTG +S KSDVYALGMV LQLLTAK  IGL    E A++ D L +
Sbjct  582  TDLVGTLFYLDPEYQRTGQVSAKSDVYALGMVFLQLLTAKSPIGLADTAERAMEEDHLID  641

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG WP  E  EL  L LRC E++ KDRPDLK  +L VLE+L ++A+         
Sbjct  642  ILDQRAGNWPVREAHELTQLGLRCLEMRSKDRPDLKSKVLVVLERLNNLASTVYHSVQPI  701

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P  PP++F+CPILK VM+DPC+A+DGY+Y+R AIE WLNEN+ SP+T   LP KNL+PN 
Sbjct  702  PTAPPSHFICPILKRVMQDPCIASDGYSYERVAIEMWLNENDVSPLTKARLPDKNLVPNL  761

Query  197  TILSAITVWK  168
             ++  I  WK
Sbjct  762  ALICLINSWK  771



>ref|XP_008652691.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Zea mays]
Length=863

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T  VGT+ Y+DPEY RTG +S KSDVYALGMV LQLLTAK  IGL    E A++ D L +
Sbjct  664  TDLVGTLFYLDPEYQRTGQVSAKSDVYALGMVFLQLLTAKSPIGLADTAERAMEEDHLID  723

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILD  AG WP  E  EL  L LRC E++ KDRPDLK  +L VLE+L ++A+         
Sbjct  724  ILDQRAGNWPVREAHELTQLGLRCLEMRSKDRPDLKSKVLVVLERLNNLASTVYHSVQPI  783

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
            P  PP++F+CPILK VM+DPC+A+DGY+Y+R AIE WLNEN+ SP+T   LP KNL+PN 
Sbjct  784  PTAPPSHFICPILKRVMQDPCIASDGYSYERVAIEMWLNENDVSPLTKARLPDKNLVPNL  843

Query  197  TILSAITVWK  168
             ++  I  WK
Sbjct  844  ALICLINSWK  853



>ref|XP_004986806.1| PREDICTED: U-box domain-containing protein 35-like [Setaria italica]
Length=791

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 0/191 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T  VGT+ Y+DPEY R+G +S KSDVYALGMV LQLLTAK  +GL   VE A+    L 
Sbjct  591  DTDLVGTLFYMDPEYQRSGQVSAKSDVYALGMVFLQLLTAKSPMGLADTVERAVAQRRLV  650

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD  AGKWP +   ELA L L C E++ KDRPDLK ++L VLE+L ++A  A +    
Sbjct  651  DILDQRAGKWPVKAAYELAQLGLSCLEMRSKDRPDLKSNVLVVLERLNNIATTACDSVQQ  710

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PP++F+CPILK VM+DPC+A+DGY+Y+R AIE WL+EN+ SP+T   LP KNL+PN
Sbjct  711  VPTAPPSHFVCPILKRVMQDPCIASDGYSYERVAIEMWLHENDVSPLTKTRLPDKNLVPN  770

Query  200  YTILSAITVWK  168
            + +L AI  WK
Sbjct  771  HALLCAINSWK  781



>ref|XP_010229355.1| PREDICTED: U-box domain-containing protein 52-like [Brachypodium 
distachyon]
Length=804

 Score =   201 bits (510),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 104/191 (54%), Positives = 140/191 (73%), Gaps = 4/191 (2%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TG  GT+ YIDPEY RTG +S KSD YALGMVILQLLTA+  IGL  +VE A++   L +
Sbjct  613  TGLAGTLFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDGQLMD  672

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD  AG WP +E  +LA L L C E++ KDRPDLK+ +   LE+LK++A  A E     
Sbjct  673  VLDGSAGNWPAKEAYDLAHLGLSCLEMRSKDRPDLKNMVAVELERLKNIAGAASEPV---  729

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PP++F+CPILK+VM+DPC+AADG+TY+R AI  WL+++E SP+T   LP+K L+ N+
Sbjct  730  -PGPPSHFVCPILKEVMQDPCIAADGHTYERNAILMWLSKHELSPVTKALLPNKTLVSNH  788

Query  197  TILSAITVWKS  165
            ++LSAI+ W+S
Sbjct  789  SLLSAISSWRS  799



>gb|ACF22762.1| protein kinase [Brachypodium distachyon]
Length=803

 Score =   201 bits (510),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 104/191 (54%), Positives = 140/191 (73%), Gaps = 4/191 (2%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TG  GT+ YIDPEY RTG +S KSD YALGMVILQLLTA+  IGL  +VE A++   L +
Sbjct  612  TGLAGTLFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDGQLMD  671

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD  AG WP +E  +LA L L C E++ KDRPDLK+ +   LE+LK++A  A E     
Sbjct  672  VLDGSAGNWPAKEAYDLAHLGLSCLEMRSKDRPDLKNMVAVELERLKNIAGAASEPV---  728

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
             P PP++F+CPILK+VM+DPC+AADG+TY+R AI  WL+++E SP+T   LP+K L+ N+
Sbjct  729  -PGPPSHFVCPILKEVMQDPCIAADGHTYERNAILMWLSKHELSPVTKALLPNKTLVSNH  787

Query  197  TILSAITVWKS  165
            ++LSAI+ W+S
Sbjct  788  SLLSAISSWRS  798



>emb|CDY61455.1| BnaC09g53040D [Brassica napus]
Length=811

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 118/166 (71%), Gaps = 17/166 (10%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTG +SPK+DVYA GM+ILQLLTA  AI LT+            
Sbjct  619  QTSPVGTLCYIDPEYQRTGRLSPKTDVYAFGMIILQLLTALPAIALTY------------  666

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
                 +AG WP EET++LA LAL CTE++ KD PDL++ ILP LE L  VA  A+ + S 
Sbjct  667  -----KAGDWPMEETRKLAALALYCTEIRAKDGPDLENRILPTLESLNKVAENARTLISS  721

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSP  243
             P  PP++F+CP+LKDVM +PCVAADGYTYDR+AIE W+ ++  SP
Sbjct  722  EPKQPPSHFLCPLLKDVMNEPCVAADGYTYDRRAIEEWMADHRTSP  767



>ref|NP_001065387.1| Os10g0561500 [Oryza sativa Japonica Group]
 gb|AAK31267.1|AC079890_3 putative protein kinase [Oryza sativa Japonica Group]
 gb|ABB47985.2| U-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27224.1| Os10g0561500 [Oryza sativa Japonica Group]
 gb|EAZ16979.1| hypothetical protein OsJ_32463 [Oryza sativa Japonica Group]
Length=782

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 137/192 (71%), Gaps = 0/192 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T  VGT+ Y+DPEY RTG +S KSD YALGMV+LQLLT K  +GL  +VE A++   L 
Sbjct  587  DTDLVGTLFYMDPEYQRTGQVSTKSDTYALGMVLLQLLTGKPPVGLADLVEQAVENGHLV  646

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD  AGKWP +E  ELA L L C E++ K RPDLK  +L  LE+LK +A+   +    
Sbjct  647  DILDKSAGKWPAQEAHELAQLGLSCLEMRSKHRPDLKCKVLVELERLKKIASAVSDPVRP  706

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PP++F+CPILK +M+DPC+A+DGY+YDR AIE WL EN+ SP+T   LP+K+L+PN
Sbjct  707  VISGPPSHFICPILKRIMQDPCIASDGYSYDRVAIEMWLCENDKSPITKSRLPNKDLVPN  766

Query  200  YTILSAITVWKS  165
            + +L AIT WK+
Sbjct  767  HALLCAITSWKA  778



>gb|EAY79520.1| hypothetical protein OsI_34648 [Oryza sativa Indica Group]
Length=782

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 137/192 (71%), Gaps = 0/192 (0%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T  VGT+ Y+DPEY RTG +S KSD YALGMV+LQLLT K  +GL  +VE A++   L 
Sbjct  587  DTDLVGTLFYMDPEYQRTGQVSTKSDTYALGMVLLQLLTGKPPVGLADLVEQAVENGHLV  646

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD  AGKWP +E  ELA L L C E++ K RPDLK  +L  LE+LK +A+   +    
Sbjct  647  DILDKSAGKWPAQEAHELAQLGLSCLEMRSKHRPDLKCKVLVELERLKKIASAVSDPVRP  706

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
                PP++F+CPILK +M+DPC+A+DGY+YDR AIE WL EN+ SP+T   LP+K+L+PN
Sbjct  707  VISGPPSHFICPILKRIMQDPCIASDGYSYDRVAIEMWLCENDMSPITKSRLPNKDLVPN  766

Query  200  YTILSAITVWKS  165
            + +L AIT WK+
Sbjct  767  HALLCAITSWKA  778



>ref|XP_010229351.1| PREDICTED: U-box domain-containing protein 35-like isoform X4 
[Brachypodium distachyon]
Length=795

 Score =   196 bits (497),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 102/193 (53%), Positives = 138/193 (72%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TG  GT+ YIDPEY RTG +S KSD YALGMVILQLLTA+  IGL  +VE A++ D L 
Sbjct  598  KTGLAGTMFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDDQLM  657

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD  AG WP +E  +LA L L C E++ K+RPDLK+ +   LE+LK +A  A     +
Sbjct  658  DVLDEGAGNWPAKEAHDLAQLGLSCLEMRSKNRPDLKNMVSVELERLKGIAIVASGPVQV  717

Query  380  APP-PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
             P   PP++F+CPILK VM+DPC+AADG+TY+R AI  WL E++ SP+T   LP+K ++ 
Sbjct  718  VPGLGPPSHFLCPILKTVMQDPCIAADGHTYERNAILMWLCEHDVSPVTKALLPNKTIVS  777

Query  203  NYTILSAITVWKS  165
            N ++LSAI+ W+S
Sbjct  778  NQSLLSAISSWRS  790



>ref|XP_010229349.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Brachypodium distachyon]
 gb|ACF22761.1| protein kinase [Brachypodium distachyon]
Length=799

 Score =   196 bits (497),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 102/193 (53%), Positives = 138/193 (72%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TG  GT+ YIDPEY RTG +S KSD YALGMVILQLLTA+  IGL  +VE A++ D L 
Sbjct  602  KTGLAGTMFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDDQLM  661

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD  AG WP +E  +LA L L C E++ K+RPDLK+ +   LE+LK +A  A     +
Sbjct  662  DVLDEGAGNWPAKEAHDLAQLGLSCLEMRSKNRPDLKNMVSVELERLKGIAIVASGPVQV  721

Query  380  APP-PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
             P   PP++F+CPILK VM+DPC+AADG+TY+R AI  WL E++ SP+T   LP+K ++ 
Sbjct  722  VPGLGPPSHFLCPILKTVMQDPCIAADGHTYERNAILMWLCEHDVSPVTKALLPNKTIVS  781

Query  203  NYTILSAITVWKS  165
            N ++LSAI+ W+S
Sbjct  782  NQSLLSAISSWRS  794



>emb|CDY16812.1| BnaA09g05700D [Brassica napus]
Length=797

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 133/195 (68%), Gaps = 28/195 (14%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT+CYIDPEY RTG+ISPKSDV++LG+VILQL+TAK AI +TH+VE AI  D   
Sbjct  631  KTSPVGTLCYIDPEYQRTGIISPKSDVFSLGVVILQLITAKPAIAITHMVEEAIGDDA--  688

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
                                      E    DRPDLKD I+P LE+L+ V ++A++  + 
Sbjct  689  --------------------------EFMGLDRPDLKDQIIPALERLRKVVDKAQKSITR  722

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
             P  PP++F+CP+LK +M  PCVAADGYTYDR+AIE WL E + SP+TNLPLP+KNLL N
Sbjct  723  TPSGPPSHFICPLLKGLMNQPCVAADGYTYDREAIEDWLREKDTSPVTNLPLPNKNLLAN  782

Query  200  YTILSAITVWKSGKQ  156
            YT+ SAI  WKS KQ
Sbjct  783  YTLYSAIMEWKSNKQ  797



>ref|XP_007154626.1| hypothetical protein PHAVU_003G134500g [Phaseolus vulgaris]
 gb|ESW26620.1| hypothetical protein PHAVU_003G134500g [Phaseolus vulgaris]
Length=763

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 134/193 (69%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            E+   GT+ Y+DPEY RTG + PKSDVYA G++ LQL+T + A GL  IVE AI   +  
Sbjct  569  ESVLAGTLHYMDPEYQRTGTVRPKSDVYAFGVITLQLITGRHARGLILIVEDAIRNGSFR  628

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            + LD+ AG WP +ET ELA +AL+CT L+ +DRP+L   +LP+LE+  + AN +  +   
Sbjct  629  DFLDSSAGDWPLDETVELAQIALKCTALRCRDRPELDTEVLPLLERFSNAANASARIGRN  688

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            +   P  Y+ CPIL+++M+DP +AADG+TY+ +AI++WL+++  SPMT L L H  L PN
Sbjct  689  SVSAPSQYY-CPILQEIMDDPYIAADGFTYEYRAIKAWLSKHNVSPMTKLKLQHSVLTPN  747

Query  200  YTILSAITVWKSG  162
            +T+ SAI  WKSG
Sbjct  748  HTLRSAIQEWKSG  760



>gb|ABF93478.1| U-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=596

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T   GT+ YIDPEY R+G +S KSD YALGMV+LQLLTA+  IGL  +VE A++   L 
Sbjct  394  KTALAGTLFYIDPEYQRSGQVSVKSDTYALGMVMLQLLTARAPIGLAEVVERAVEDGKLR  453

Query  560  EILDTEAG-KWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
            +ILD  AG  W  EE +E+A LALRC E++ KDRPDLK  +   L++LK  A        
Sbjct  454  DILDENAGWTWAMEEAQEMADLALRCLEMRGKDRPDLKTRVAVDLDRLKRRA--------  505

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +   PPP +F+CPILK VM++PC+A+DGY+Y+R AIE W+ + + SP+TN+ +P+K L+P
Sbjct  506  LPTQPPPEHFICPILKRVMQEPCIASDGYSYERHAIEMWVCDKDVSPVTNVRMPNKTLVP  565

Query  203  NYTILSAITVWKS  165
            N ++L+AIT WKS
Sbjct  566  NRSLLTAITAWKS  578



>ref|XP_010468808.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=207

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = -2

Query  728  VGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILD  549
             GT+ YIDPEY RTG I PKSD+YA G+ ILQLLTA+Q  GL   VE A+   TL E+LD
Sbjct  8    AGTLHYIDPEYHRTGTIRPKSDLYAFGITILQLLTARQPGGLVPAVENAVKKGTLTEMLD  67

Query  548  TEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPP  369
                 WP  ET+ELA + L+C E + +DRPDLK  ++P L++L + AN   +        
Sbjct  68   KSVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPALKRLVETANSKTKKEGSNLRA  127

Query  368  PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTIL  189
            P +YF CPIL+++M++P +AADG+TY+++AI +WL ++  SP+T   L H  L PN+T+ 
Sbjct  128  PSHYF-CPILREIMQEPEIAADGFTYEKQAILAWLEKHNISPVTRQKLDHFKLTPNHTLR  186

Query  188  SAITVWKS  165
            SAI  WKS
Sbjct  187  SAIHDWKS  194



>gb|ABF93477.1| U-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=783

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T   GT+ YIDPEY R+G +S KSD YALGMV+LQLLTA+  IGL  +VE A++   L 
Sbjct  581  KTALAGTLFYIDPEYQRSGQVSVKSDTYALGMVMLQLLTARAPIGLAEVVERAVEDGKLR  640

Query  560  EILDTEAG-KWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
            +ILD  AG  W  EE +E+A LALRC E++ KDRPDLK  +   L++LK  A        
Sbjct  641  DILDENAGWTWAMEEAQEMADLALRCLEMRGKDRPDLKTRVAVDLDRLKRRA--------  692

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +   PPP +F+CPILK VM++PC+A+DGY+Y+R AIE W+ + + SP+TN+ +P+K L+P
Sbjct  693  LPTQPPPEHFICPILKRVMQEPCIASDGYSYERHAIEMWVCDKDVSPVTNVRMPNKTLVP  752

Query  203  NYTILSAITVWKS  165
            N ++L+AIT WKS
Sbjct  753  NRSLLTAITAWKS  765



>ref|NP_001048651.1| Os03g0101200 [Oryza sativa Japonica Group]
 dbj|BAF10565.1| Os03g0101200 [Oryza sativa Japonica Group]
 gb|EAY88172.1| hypothetical protein OsI_09613 [Oryza sativa Indica Group]
 gb|EAZ25251.1| hypothetical protein OsJ_09055 [Oryza sativa Japonica Group]
Length=812

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T   GT+ YIDPEY R+G +S KSD YALGMV+LQLLTA+  IGL  +VE A++   L 
Sbjct  610  KTALAGTLFYIDPEYQRSGQVSVKSDTYALGMVMLQLLTARAPIGLAEVVERAVEDGKLR  669

Query  560  EILDTEAG-KWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMAS  384
            +ILD  AG  W  EE +E+A LALRC E++ KDRPDLK  +   L++LK  A        
Sbjct  670  DILDENAGWTWAMEEAQEMADLALRCLEMRGKDRPDLKTRVAVDLDRLKRRA--------  721

Query  383  IAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllp  204
            +   PPP +F+CPILK VM++PC+A+DGY+Y+R AIE W+ + + SP+TN+ +P+K L+P
Sbjct  722  LPTQPPPEHFICPILKRVMQEPCIASDGYSYERHAIEMWVCDKDVSPVTNVRMPNKTLVP  781

Query  203  NYTILSAITVWKS  165
            N ++L+AIT WKS
Sbjct  782  NRSLLTAITAWKS  794



>gb|KEH32488.1| U-box kinase family protein [Medicago truncatula]
Length=564

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 134/192 (70%), Gaps = 1/192 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            E+   GT+ Y+DPEY RTG + PKSDVYA G++ILQL+TA+ A GL   +E AI   +  
Sbjct  368  ESVLAGTLHYMDPEYQRTGTVRPKSDVYAFGVIILQLITARHARGLITTIEDAITNGSFR  427

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD  AG WP  ET ELA + L+CT L+ +DRP+L   +LP+L++L D+AN + ++   
Sbjct  428  DILDKSAGDWPLNETIELAEIGLKCTSLRCRDRPELDTEVLPLLKRLSDMANASVKIGRS  487

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            +   P  Y+ CPIL+++M++P +AADG+TY+ +AI++WL+++  SP+T   L H  L PN
Sbjct  488  SAHTPSQYY-CPILQEIMDEPYIAADGFTYEHRAIKAWLSKHNVSPVTKHKLQHSELTPN  546

Query  200  YTILSAITVWKS  165
            +T+ SAI  WKS
Sbjct  547  HTLRSAIQEWKS  558



>ref|XP_003550626.1| PREDICTED: U-box domain-containing protein 34-like [Glycine max]
Length=760

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 130/188 (69%), Gaps = 1/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSDVYA G++ LQL+T + A GL   VE AI   +  +ILD 
Sbjct  571  GTLHYMDPEYQRTGTVRPKSDVYAFGVITLQLITGRHARGLIVTVEDAITNGSFRDILDP  630

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
             AG WP +ET ELA +AL+CT L+ +DRP++   +LP+L++  D AN +  M   +   P
Sbjct  631  SAGDWPLDETVELAQVALKCTALRCRDRPEIDTEVLPMLQRFSDAANASARMGRNSVSAP  690

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
              Y+ CPIL+++M+DP +AADG+TY+  AI++WL+++  SPMT L L H  L PN+T+ S
Sbjct  691  SQYY-CPILQEIMDDPYIAADGFTYEYVAIKAWLSKHNVSPMTKLKLQHSVLTPNHTLRS  749

Query  185  AITVWKSG  162
            AI  WKSG
Sbjct  750  AIQEWKSG  757



>gb|KHN17687.1| U-box domain-containing protein 34 [Glycine soja]
Length=755

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 130/188 (69%), Gaps = 1/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSDVYA G++ LQL+T + A GL   VE AI   +  +ILD 
Sbjct  566  GTLHYMDPEYQRTGTVRPKSDVYAFGVITLQLITGRHARGLIVTVEDAITNGSFRDILDP  625

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
             AG WP +ET ELA +AL+CT L+ +DRP++   +LP+L++  D AN +  M   +   P
Sbjct  626  SAGDWPLDETVELAQVALKCTALRCRDRPEIDTEVLPMLQRFSDAANASARMGRNSVSAP  685

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
              Y+ CPIL+++M+DP +AADG+TY+  AI++WL+++  SPMT L L H  L PN+T+ S
Sbjct  686  SQYY-CPILQEIMDDPYIAADGFTYEYVAIKAWLSKHNVSPMTKLKLQHSVLTPNHTLRS  744

Query  185  AITVWKSG  162
            AI  WKSG
Sbjct  745  AIQEWKSG  752



>gb|KEH32487.1| U-box kinase family protein [Medicago truncatula]
Length=764

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSDVYA G++ILQL+TA+ A GL   +E AI   +  +ILD 
Sbjct  573  GTLHYMDPEYQRTGTVRPKSDVYAFGVIILQLITARHARGLITTIEDAITNGSFRDILDK  632

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
             AG WP  ET ELA + L+CT L+ +DRP+L   +LP+L++L D+AN + ++   +   P
Sbjct  633  SAGDWPLNETIELAEIGLKCTSLRCRDRPELDTEVLPLLKRLSDMANASVKIGRSSAHTP  692

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
              Y+ CPIL+++M++P +AADG+TY+ +AI++WL+++  SP+T   L H  L PN+T+ S
Sbjct  693  SQYY-CPILQEIMDEPYIAADGFTYEHRAIKAWLSKHNVSPVTKHKLQHSELTPNHTLRS  751

Query  185  AITVWKS  165
            AI  WKS
Sbjct  752  AIQEWKS  758



>ref|XP_004507961.1| PREDICTED: U-box domain-containing protein 34-like [Cicer arietinum]
Length=764

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 136/193 (70%), Gaps = 1/193 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            E+   GT+ Y+DPEY RTG + PKSDVYA G++ILQL+TA+ A GL   +E AI   +  
Sbjct  568  ESVLAGTLHYMDPEYQRTGTVRPKSDVYAFGVIILQLITARHARGLIMTIEDAITKGSFL  627

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD  AG WP  ET ELA + L+CT L+ +DRP+L   +LP+L++L DVAN + ++   
Sbjct  628  DILDKSAGDWPLNETIELAEIGLKCTALRCRDRPELDTEVLPLLKRLSDVANASAKIGRN  687

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            +   P  Y+ CPIL+++M++P +AADG+TY+ +AI++WL+++  SP+T   L H  L+PN
Sbjct  688  SVCTPSQYY-CPILQEIMDEPYIAADGFTYEYRAIKAWLSKHNVSPVTKHKLLHSELIPN  746

Query  200  YTILSAITVWKSG  162
            +T+ SAI  WKSG
Sbjct  747  HTLRSAIQEWKSG  759



>ref|XP_009102157.1| PREDICTED: U-box domain-containing protein 34 [Brassica rapa]
Length=828

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 133/189 (70%), Gaps = 5/189 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I  KSD+YA G++ILQLLTA+Q  GL H VE A++  TL E+LD 
Sbjct  630  GTLHYIDPEYHRTGTIRLKSDLYAFGIIILQLLTARQPNGLVHAVENAVNKGTLTEMLDK  689

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK+ ++PVL++L + AN    KE +++   
Sbjct  690  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKEEVIPVLKRLVETANSKIKKERSNLR--  747

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY++KAI +WL ++  SP+T   L H  L PN T+
Sbjct  748  -APSHYFCPILREIMEEPEIAADGFTYEKKAILAWLEKHNISPVTRQKLDHFKLTPNNTL  806

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  807  RSAIHDWKS  815



>emb|CDY39152.1| BnaA07g01480D [Brassica napus]
Length=828

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 133/189 (70%), Gaps = 5/189 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I  KSD+YA G++ILQLLTA+Q  GL H VE A++  TL E+LD 
Sbjct  630  GTLHYIDPEYHRTGTIRLKSDLYAFGIIILQLLTARQPNGLVHAVENAVNKGTLTEMLDK  689

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK+ ++PVL++L + AN    KE +++   
Sbjct  690  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKEEVIPVLKRLVETANSKIKKERSNLR--  747

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY++KAI +WL ++  SP+T   L H  L PN T+
Sbjct  748  -APSHYFCPILREIMEEPEIAADGFTYEKKAILAWLEKHNISPVTRQKLDHFKLTPNNTL  806

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  807  RSAIHDWKS  815



>ref|XP_002883993.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60252.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=797

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 132/189 (70%), Gaps = 5/189 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G++ILQL+TA+Q  GL   VE A+   TL E+LD 
Sbjct  599  GTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLVTARQPSGLVPAVENAVKKGTLTEMLDK  658

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK  ++PVL++L + AN    KE +++   
Sbjct  659  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPVLKRLVETANSKIKKEGSNLR--  716

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY+RKAI +WL ++  SP+T   L H  L PN+T+
Sbjct  717  -APSHYFCPILREIMEEPEIAADGFTYERKAILAWLEKHNISPVTRQKLDHFKLTPNHTL  775

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  776  RSAIRDWKS  784



>gb|EMT03132.1| U-box domain-containing protein 52 [Aegilops tauschii]
Length=694

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TG  GT+ Y+DPEY RTG +S KSD YALGMVIL+LLTA+  IGL  +VE A++   + 
Sbjct  498  KTGLAGTLFYLDPEYQRTGQVSVKSDTYALGMVILELLTARCPIGLPEVVERAVEDGQIS  557

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD  AG WP  E  +LA L L C E++ KDRPDL   +L  L +LK +   A  ++ +
Sbjct  558  DVLDESAGDWPVREAHDLAQLGLNCLEMRSKDRPDLNSVVLEELGRLKRI---AASVSGV  614

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A P  P++F CPILK VM DPC+A+DGYTY+R A+E WL + + SP+T   L  K LLPN
Sbjct  615  ALPGSPSHFKCPILKTVMYDPCIASDGYTYERSAMEMWLCDKDVSPVTKARLRDKTLLPN  674

Query  200  YTILSAITVW  171
             ++ SAI  W
Sbjct  675  LSLKSAIMRW  684



>ref|XP_006451528.1| hypothetical protein CICLE_v10007527mg [Citrus clementina]
 gb|ESR64768.1| hypothetical protein CICLE_v10007527mg [Citrus clementina]
Length=769

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 136/192 (71%), Gaps = 1/192 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ET   GT+ Y+DPEY RTG I PKSD+YA G++ILQLLT+    G+   VE+AI   +  
Sbjct  574  ETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGSFA  633

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD     WP  ET+ELA +AL+C+ L+ +DRPDL   ++PVL KLKDVA+   ++ S 
Sbjct  634  DILDKSITDWPLAETEELACIALKCSNLRCRDRPDLDTEVMPVLRKLKDVADACVKLES-  692

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            +    P++F CPIL++VMEDP +AADG+TY+ +AI++WL ++  SP+T L L H +++PN
Sbjct  693  SNVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPN  752

Query  200  YTILSAITVWKS  165
            YT+ SAI  W+S
Sbjct  753  YTLRSAIQQWRS  764



>ref|XP_006475494.1| PREDICTED: U-box domain-containing protein 34-like [Citrus sinensis]
Length=769

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 136/192 (71%), Gaps = 1/192 (1%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            ET   GT+ Y+DPEY RTG I PKSD+YA G++ILQLLT+    G+   VE+AI   +  
Sbjct  574  ETILAGTLHYMDPEYHRTGTIRPKSDLYAFGVIILQLLTSCLPNGVLLKVESAIKNGSFA  633

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            +ILD     WP  ET+ELA +AL+C+ L+ +DRPDL   ++PVL KLKDVA+   ++ S 
Sbjct  634  DILDKSITDWPLAETEELACIALKCSNLRCRDRPDLDTEVMPVLRKLKDVADACVKLES-  692

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            +    P++F CPIL++VMEDP +AADG+TY+ +AI++WL ++  SP+T L L H +++PN
Sbjct  693  SNVYAPSHFFCPILQEVMEDPYIAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPN  752

Query  200  YTILSAITVWKS  165
            YT+ SAI  W+S
Sbjct  753  YTLRSAIQQWRS  764



>ref|XP_002991386.1| ubiquitin-protein ligase, PUB52 [Selaginella moellendorffii]
 gb|EFJ07498.1| ubiquitin-protein ligase, PUB52 [Selaginella moellendorffii]
Length=422

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 131/199 (66%), Gaps = 8/199 (4%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +T PVGT  YIDPEY RTGL  PKSDVYALG+VILQLLT +  +G+  IVE AI+     
Sbjct  221  DTTPVGTFAYIDPEYQRTGLFGPKSDVYALGIVILQLLTGRGPVGVHAIVEEAIECGNFS  280

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQA------  399
             +LD+ AG WP  + +E+A LAL+C E++R+ RP L+  +LP+L+  ++ A         
Sbjct  281  SVLDSSAGDWPVGKAEEVACLALQCAEMRRRQRPMLET-VLPMLDGARNYAENCAAIHAT  339

Query  398  -KEMASIAPPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplp  222
             + +A      PP+ F+CPI ++VM++P VAADGYTY+ +AI  W   ++ SP+TNL L 
Sbjct  340  NRALAGDPKAVPPSIFLCPIFREVMQEPVVAADGYTYEYEAIRQWFQAHDTSPLTNLRLE  399

Query  221  hknllpNYTILSAITVWKS  165
            HK L P++ +   IT WK+
Sbjct  400  HKQLTPHHALNKLITEWKT  418



>gb|EMS53909.1| U-box domain-containing protein 52 [Triticum urartu]
Length=693

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TG  GT+ Y+DPEY RTG +S KSD YALGMVIL+LLTA+  IGL  +VE A++   + 
Sbjct  497  KTGLAGTLFYLDPEYQRTGQVSVKSDTYALGMVILELLTARCPIGLPEVVEQAVEEGQIS  556

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
             +LD  AG WP  E  +LA L L C E++ KDRPDL   +L  L +LK +   A  ++ +
Sbjct  557  NVLDESAGDWPVREAHDLAQLGLNCLEMRSKDRPDLNSVVLEELGRLKRI---AASVSGV  613

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpN  201
            A P  P++F CPILK VM DPC+A+DGYTY+R A+E WL + + SP+T   L  K LLPN
Sbjct  614  ALPGSPSHFKCPILKTVMYDPCIASDGYTYERSAMEMWLCDKDVSPVTKARLRDKTLLPN  673

Query  200  YTILSAITVW  171
             ++ SAI  W
Sbjct  674  LSLKSAIVRW  683



>ref|NP_179531.1| U-box domain-containing protein 34 [Arabidopsis thaliana]
 sp|Q8S8S7.1|PUB34_ARATH RecName: Full=U-box domain-containing protein 34; AltName: Full=Plant 
U-box protein 34; Includes: RecName: Full=E3 ubiquitin 
ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 gb|AAM14871.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC06878.1| U-box domain-containing protein 34 [Arabidopsis thaliana]
Length=801

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G++ILQLLTA+   G+   VE A+   TL E+LD 
Sbjct  607  GTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLLTARNPSGIVPAVENAVKKGTLTEMLDK  666

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK  ++PVL++L + AN    KE +++   
Sbjct  667  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPVLKRLVETANSKVKKEGSNLR--  724

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY+RKAI +WL ++  SP+T   L H  L PN+T+
Sbjct  725  -APSHYFCPILREIMEEPEIAADGFTYERKAILAWLEKHNISPVTRQKLDHFKLTPNHTL  783

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  784  RSAIRDWKS  792



>emb|CDY42871.1| BnaAnng06960D [Brassica napus]
Length=822

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 127/181 (70%), Gaps = 17/181 (9%)
 Frame = -2

Query  698  YTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDT-LEEILDTEAGKWPRE  522
            Y RTG+ISPKSDVY+LG+VILQL+T K AI +TH+VE AI  D     +LD +AG WP  
Sbjct  658  YQRTGIISPKSDVYSLGIVILQLITGKPAIAITHMVEEAIGDDAEFMALLDVKAGPWPIS  717

Query  521  ETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPPPNYFMCPI  342
            ET                 RPDLKD I+P LE+L+ V ++A+ +    P  PP++F+CP+
Sbjct  718  ETH----------------RPDLKDQIIPALERLRKVVDKAQNLIGRTPSGPPSHFICPL  761

Query  341  LKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILSAITVWKSG  162
            LK VM +PCVAADGYTYDR+AI+ WL EN+ SP+TNLPLP+KNLL NYT+ SAI  WKS 
Sbjct  762  LKGVMNEPCVAADGYTYDREAIQDWLRENDTSPVTNLPLPNKNLLANYTLYSAIMEWKSN  821

Query  161  K  159
            K
Sbjct  822  K  822



>ref|XP_010526382.1| PREDICTED: U-box domain-containing protein 34 isoform X1 [Tarenaya 
hassleriana]
Length=790

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G+VILQLLTA+   GL  +VE A+   TL EILD 
Sbjct  592  GTLHYIDPEYHRTGTIRPKSDLYAFGIVILQLLTARPPGGLLSVVENAVKKGTLTEILDK  651

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+EL    L+C+E++ +DRPDL+  ++PVL++L D AN   +    +   P
Sbjct  652  SVTDWPLTETEELVRFGLKCSEIRCRDRPDLEKEVIPVLKRLVDTANLKMKNGRSSLRAP  711

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+++M DP +AADG+TY++KAI +WL ++  SP+T   L H  L PN+T+ S
Sbjct  712  SHYF-CPILREMMGDPQIAADGFTYEKKAILAWLEKHNISPVTRQKLKHFQLTPNHTLRS  770

Query  185  AITVWKS  165
            AI  WKS
Sbjct  771  AIRDWKS  777



>ref|XP_010047530.1| PREDICTED: U-box domain-containing protein 34-like [Eucalyptus 
grandis]
 gb|KCW79468.1| hypothetical protein EUGRSUZ_C00853 [Eucalyptus grandis]
Length=775

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSD+YA G++ILQLL  +   GL    E AI+  +   ILD 
Sbjct  581  GTIYYMDPEYQRTGTLRPKSDLYAFGIIILQLLMGRHPNGLLLKAEEAIERGSFASILDN  640

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA +AL+C++L+ +DRPDL++ +LPVL+KL D A+    +       P
Sbjct  641  TVKDWPVAETEELAQMALKCSKLRCRDRPDLENEVLPVLKKLADFASANARVGRENACAP  700

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL++VM+DPCVAADG+TY+ +AI++WL ++  SP+T   L H  L+PN+T+ S
Sbjct  701  SHYF-CPILQEVMQDPCVAADGFTYEHRAIKAWLEKHSVSPVTRKKLQHMVLIPNHTLRS  759

Query  185  AITVWKS  165
            AI  W+S
Sbjct  760  AIHDWRS  766



>ref|XP_010656166.1| PREDICTED: U-box domain-containing protein 34 [Vitis vinifera]
 emb|CBI27875.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   179 bits (455),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 93/186 (50%), Positives = 128/186 (69%), Gaps = 1/186 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSDVYA G++ILQLL A+   GL   VE AI   T  + LD 
Sbjct  577  GTLFYMDPEYQRTGTIRPKSDVYAFGVIILQLLAARHPNGLILTVENAITNGTFADTLDK  636

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA LAL+C++L+ +DRPDL+  +LPVL++L D A+ +K +  I     
Sbjct  637  SIADWPIAETEELACLALKCSKLRCRDRPDLETEVLPVLKRLADFADASKRV-EINNTSA  695

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
            P ++ CPIL++VMEDP +AADG+TY+ +AI++WL+ ++ SP+T     HK L PN T+ S
Sbjct  696  PKHYFCPILQEVMEDPHIAADGFTYEHRAIKAWLDRHDVSPVTKWTFQHKMLTPNQTLRS  755

Query  185  AITVWK  168
            AI  W+
Sbjct  756  AIQEWR  761



>ref|XP_010526384.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Tarenaya 
hassleriana]
Length=812

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G+VILQLLTA+   GL  +VE A+   TL EILD 
Sbjct  614  GTLHYIDPEYHRTGTIRPKSDLYAFGIVILQLLTARPPGGLLSVVENAVKKGTLTEILDK  673

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+EL    L+C+E++ +DRPDL+  ++PVL++L D AN   +    +   P
Sbjct  674  SVTDWPLTETEELVRFGLKCSEIRCRDRPDLEKEVIPVLKRLVDTANLKMKNGRSSLRAP  733

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+++M DP +AADG+TY++KAI +WL ++  SP+T   L H  L PN+T+ S
Sbjct  734  SHYF-CPILREMMGDPQIAADGFTYEKKAILAWLEKHNISPVTRQKLKHFQLTPNHTLRS  792

Query  185  AITVWKS  165
            AI  WKS
Sbjct  793  AIRDWKS  799



>ref|XP_002864494.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40753.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 131/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+     E++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFEDMLDG  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  E KELA +A++C++LK +DRPDL   +LP L+++ D AN     E A++   
Sbjct  649  SVKDWPIAEAKELARIAIKCSQLKCRDRPDLSTQVLPALKRILDSANSRLKTEQANVR--  706

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYT  195
             PP ++ CPILK++MEDP +AADG+TY+ KAI++W  +++N SP+T   L + +L PN+T
Sbjct  707  -PPTHYYCPILKEIMEDPQIAADGFTYEGKAIKAWFQKHQNVSPVTKHRLKNSDLTPNHT  765

Query  194  ILSAITVWKS  165
            + SAI  W+S
Sbjct  766  LRSAIQEWRS  775



>ref|XP_006409059.1| hypothetical protein EUTSA_v10022572mg [Eutrema salsugineum]
 gb|ESQ50512.1| hypothetical protein EUTSA_v10022572mg [Eutrema salsugineum]
Length=749

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 132/197 (67%), Gaps = 13/197 (7%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G+ ILQLLTA+Q  GL H VE A+   TL E+LD 
Sbjct  543  GTLHYIDPEYHRTGTIRPKSDLYAFGITILQLLTARQPSGLVHAVENAVKRGTLTEMLDK  602

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK  ++PVL++L + AN    KE +++   
Sbjct  603  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKAEVIPVLKRLVETANSKIKKERSNLR--  660

Query  371  PPPNYFMCPILK--------DVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphk  216
              P+++ CPIL+        ++ME+P VAADG+TY++KAI +WL ++  SP+T   L H 
Sbjct  661  -APSHYFCPILRVRKSLPGLEIMEEPEVAADGFTYEKKAILAWLEKHNISPVTRQKLDHF  719

Query  215  nllpNYTILSAITVWKS  165
             L PN+T+ SAI  WKS
Sbjct  720  KLTPNHTLRSAIRDWKS  736



>ref|XP_010443372.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=788

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+     E++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFEDMLDK  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E KELA +A+RC++LK +DRPDL   +LP L+++ + AN +K     A   P
Sbjct  649  SVRDWPIAEAKELARIAIRCSQLKCRDRPDLDTQVLPALKQILESAN-SKLKTEQANVRP  707

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
            P ++ CPILK++MEDP +AADG+TY+ KAI++W+ +++N SP+T   L + +L PN+T+ 
Sbjct  708  PTHYYCPILKEIMEDPQIAADGFTYEGKAIKAWIQKHQNVSPVTKHRLKNSDLTPNHTLK  767

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  768  SAIQEWRS  775



>emb|CDY12864.1| BnaC07g15690D [Brassica napus]
Length=816

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I  KSD+YA G++ILQLLTA++  GL H VE A+   TL E+LD 
Sbjct  618  GTLHYIDPEYHRTGTIRLKSDLYAFGIIILQLLTARRPNGLVHAVENAVKKGTLTEMLDK  677

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
               +WP  ET+ELA + L+C E + +DRPDLK+ ++PVL++L + AN    KE  ++   
Sbjct  678  SVTEWPLAETEELARIGLKCAEFRCRDRPDLKEEVIPVLKRLVETANSKIKKEQCNVR--  735

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY++KAI +W  ++  SP+T   L H  L PN T+
Sbjct  736  -APSHYFCPILRELMEEPEIAADGFTYEKKAILAWFEKHNVSPVTRQKLDHFKLTPNNTL  794

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  795  RSAIRDWKS  803



>emb|CDY01401.1| BnaA07g11740D [Brassica napus]
Length=842

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 126/189 (67%), Gaps = 15/189 (8%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G++ILQLLTA++  GL H VE A+   TL E+LD 
Sbjct  654  GTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLLTARKPNGLVHAVENAVQKGTLTEMLDK  713

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK+ ++PVL++L + AN    KE  ++   
Sbjct  714  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKEEVIPVLKRLVETANSKIKKEQCNVR--  771

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY++KAI +W  ++  SP+T             T+
Sbjct  772  -APSHYFCPILRELMEEPEIAADGFTYEKKAILAWFEKHNVSPLTPNN----------TL  820

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  821  RSAIRDWKS  829



>ref|XP_007012759.1| U-box domain-containing protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007012760.1| U-box domain-containing protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30378.1| U-box domain-containing protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30379.1| U-box domain-containing protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=752

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YALG+  LQLLTA+   GL   VE AI   +L +ILD 
Sbjct  560  GTLYYMDPEYQRTGTIRPKSDLYALGVTTLQLLTARHPNGLLLAVENAITKSSLADILDK  619

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA +AL+C++L+ +DRPDL   ILP+L++L DVA+ + ++       P
Sbjct  620  SVTDWPLAETEELARIALKCSKLRCRDRPDLDTEILPILKRLVDVADASLKLEKNNAYAP  679

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL++VM+DP +AADG+TY+ +AI++WL ++  SP+T   L H  L PN T+ S
Sbjct  680  SHYF-CPILQEVMDDPHIAADGFTYEHRAIKAWLQKHNVSPVTKCRLQHSVLTPNQTLRS  738

Query  185  AITVWKS  165
            AI  WKS
Sbjct  739  AIQEWKS  745



>ref|XP_009361646.1| PREDICTED: U-box domain-containing protein 34 [Pyrus x bretschneideri]
Length=756

 Score =   178 bits (452),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 89/188 (47%), Positives = 132/188 (70%), Gaps = 1/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSD+YA G++ILQ+LT +    L  + E AI   +  EILD 
Sbjct  568  GTLFYMDPEYQRTGTVRPKSDLYAFGVIILQVLTGRHPKRLIFVTENAIASGSFAEILDK  627

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +ELA +ALRC++L+ +DRPDL+  +LPVL++L ++A+ + +     P   
Sbjct  628  SVADWPLAEAEELARVALRCSQLRCRDRPDLETEVLPVLKRLANLADSSLKFDR-NPINA  686

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
            PN+F CPIL+++MEDP VAADG+TY+ +AI++W+ +++ SP+T L L +  L PN+T+ S
Sbjct  687  PNHFFCPILQEIMEDPHVAADGFTYEYRAIKAWIKKHKVSPLTRLRLNNFVLTPNHTLRS  746

Query  185  AITVWKSG  162
            AI  W+SG
Sbjct  747  AIQEWRSG  754



>gb|EMT03130.1| hypothetical protein F775_44103 [Aegilops tauschii]
Length=539

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 116/168 (69%), Gaps = 3/168 (2%)
 Frame = -2

Query  740  ETGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLE  561
            +TG  GT+ Y+DPEY RTG +S KSD YALGMVIL+LLTA+  IGL  +VE A++   + 
Sbjct  221  KTGLAGTLFYLDPEYQRTGQVSVKSDTYALGMVILELLTARCPIGLPEVVERAVEDGQIS  280

Query  560  EILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASI  381
            ++LD  AG WP  E  +LA L L C E++ KDRPDL   +L  L +LK +   A  ++ +
Sbjct  281  DVLDESAGDWPVREAHDLAQLGLNCLEMRSKDRPDLNSVVLEELGRLKRI---AASVSGV  337

Query  380  APPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMT  237
            A P  P++F CPILK VM DPC+A+DGYTY+R A+E WL + + SP+T
Sbjct  338  ALPGSPSHFKCPILKTVMYDPCIASDGYTYERSAMEMWLCDKDVSPVT  385



>ref|XP_006401251.1| hypothetical protein EUTSA_v10012732mg [Eutrema salsugineum]
 gb|ESQ42704.1| hypothetical protein EUTSA_v10012732mg [Eutrema salsugineum]
Length=785

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 129/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+   +  ++LD 
Sbjct  586  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGSFGDMLDG  645

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP EE KELA +A++C++LK +DRPDL   +LP L+++ + AN           PP
Sbjct  646  SVRDWPVEEAKELARIAIKCSQLKCRDRPDLDTQVLPALKRILESANNRLRTEQANARPP  705

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
             +Y+ CPILK++MEDP +AADG+TY+ KAI++W  +++N SP+T   L H +L PN+T+ 
Sbjct  706  AHYY-CPILKEIMEDPQIAADGFTYEGKAIKAWFQKHQNVSPVTKHRLKHSDLTPNHTLK  764

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  765  SAIQEWRS  772



>ref|XP_010451758.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=788

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+     E++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFEDMLDK  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  E KELA +A+RC++LK +DRPDL   +LP L+++ + AN     E A++   
Sbjct  649  SVRDWPIAEAKELARIAIRCSQLKCRDRPDLDTQVLPALKQILESANSRLKTEQANVR--  706

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYT  195
             PP ++ CPILK++MEDP +AADG+TY+ KAI++W+ +++N SP+T   L + +L PN+T
Sbjct  707  -PPTHYYCPILKEIMEDPQIAADGFTYEGKAIKAWIQKHQNVSPVTKHRLKNSDLTPNHT  765

Query  194  ILSAITVWKS  165
            + SAI  W+S
Sbjct  766  LKSAIQEWRS  775



>ref|XP_010489483.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=823

 Score =   179 bits (453),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G+ ILQLLTA+Q  GL   VE A+   TL E+LD 
Sbjct  625  GTLHYIDPEYHRTGTIRPKSDLYAFGITILQLLTARQPGGLVPAVENAVKKGTLTEMLDK  684

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA + L+C E + +DRPDLK  ++P L++L + AN   +        P
Sbjct  685  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPALKRLVETANSKTKKEGSNLRAP  744

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+++M++P +AADG+TY+++AI +WL ++  SP+T   L H  L PN+T+ S
Sbjct  745  SHYF-CPILREIMQEPAIAADGFTYEKQAILAWLEKHNISPVTRQKLDHFKLTPNHTLRS  803

Query  185  AITVWKS  165
            AI  WKS
Sbjct  804  AIHDWKS  810



>ref|XP_010483198.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=788

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+     E++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFEDMLDK  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  E KELA +A+RC++LK +DRPDL   +LP L+++ + AN     E A++   
Sbjct  649  SVRDWPIAEAKELARIAIRCSQLKCRDRPDLDTQVLPALKQILESANSRLKTEQANVR--  706

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYT  195
             PP ++ CPILK++MEDP +AADG+TY+ KAI++W+ +++N SP+T   L H +L PN+T
Sbjct  707  -PPTHYYCPILKEIMEDPQIAADGFTYEGKAIKAWIQKHQNVSPVTKHRLKHSDLTPNHT  765

Query  194  ILSAITVWKS  165
            + SAI  W+S
Sbjct  766  LKSAIQEWRS  775



>ref|NP_680448.2| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED96837.1| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
Length=789

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+     E++LD 
Sbjct  590  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFEDMLDG  649

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E KELA +A+RC++LK +DRPDL   +LP L+++ + AN ++     A    
Sbjct  650  SVKDWPIAEAKELARIAIRCSQLKCRDRPDLSTQVLPALKRILESAN-SRLKTEQANARA  708

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
            P ++ CPILK++MEDP +AADG+TY+RKAI+ W+ ++++ SP+T   L H +L PN+T+ 
Sbjct  709  PTHYYCPILKEIMEDPQIAADGFTYERKAIKEWIQKHQDVSPVTKHRLKHSDLTPNHTLR  768

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  769  SAIREWRS  776



>emb|CDX82677.1| BnaC07g01890D [Brassica napus]
Length=827

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 132/189 (70%), Gaps = 5/189 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I  KSD+YA G++ILQLLTA+Q  GL H VE A++  TL E+LD 
Sbjct  629  GTLHYIDPEYHRTGTIRLKSDLYAFGIIILQLLTARQPNGLIHAVENAVNKGTLTEMLDK  688

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA + L+C E + +DRPDLK+ ++PVL++L + AN    KE +++   
Sbjct  689  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKEEVIPVLKRLVETANSKIKKERSNLR--  746

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTI  192
              P+++ CPIL+++ME+P +AADG+TY++KAI + L ++  SP+T   L H  L PN T+
Sbjct  747  -APSHYFCPILREIMEEPEIAADGFTYEKKAILACLEKHNISPVTRQKLYHFKLTPNNTL  805

Query  191  LSAITVWKS  165
             SAI  WKS
Sbjct  806  RSAIHDWKS  814



>ref|XP_010415320.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=823

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G+ ILQLLTA+Q  GL   VE A+   TL E+LD 
Sbjct  625  GTLHYIDPEYHRTGTIRPKSDLYAFGITILQLLTARQPGGLVPAVENAVKKGTLTEMLDK  684

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA + L+C E + +DRPDLK  ++P L++L + AN   +        P
Sbjct  685  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPALKRLVETANSKTKKEGSNLRAP  744

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+++M++P +AADG+TY+++AI +WL ++  SP+T   L H  L PN+T+ S
Sbjct  745  SHYF-CPILREIMQEPEIAADGFTYEKQAILAWLEKHNISPVTRQKLDHFKLTPNHTLRS  803

Query  185  AITVWKS  165
            AI  WKS
Sbjct  804  AIHDWKS  810



>ref|XP_010696545.1| PREDICTED: U-box domain-containing protein 34 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=697

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG + PKSD+Y+ G+++LQLLTA++  GL  ++E AI   +L  ILD 
Sbjct  505  GTLYYIDPEYQRTGTVRPKSDLYSFGIILLQLLTARRPNGLLLVMENAIASGSLPYILDD  564

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +EL  LAL C +L+ +DRPDL+  +LPVL+KL DVA+ + ++   +   P
Sbjct  565  SIKDWPLAEVEELTKLALDCCKLRCRDRPDLETGVLPVLKKLADVADASMKVERNSIFAP  624

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL +VM+DP VAADG+TY+R+AIE+WL   + SP+T   + H NL PN T+++
Sbjct  625  SHYF-CPILHEVMDDPHVAADGFTYERRAIEAWLERYDVSPVTKQRMTHFNLTPNMTLIT  683

Query  185  AITVWKS  165
            AI  WKS
Sbjct  684  AIQEWKS  690



>ref|XP_010467886.1| PREDICTED: U-box domain-containing protein 34-like isoform X1 
[Camelina sativa]
Length=823

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G+ ILQLLTA+Q  GL   VE A+   TL E+LD 
Sbjct  625  GTLHYIDPEYHRTGTIRPKSDLYAFGITILQLLTARQPGGLVPAVENAVKKGTLTEMLDK  684

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA + L+C E + +DRPDLK  ++P L++L + AN   +        P
Sbjct  685  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKSEVIPALKRLVETANSKTKKEGSNLRAP  744

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+++M++P +AADG+TY+++AI +WL ++  SP+T   L H  L PN+T+ S
Sbjct  745  SHYF-CPILREIMQEPEIAADGFTYEKQAILAWLEKHNISPVTRQKLDHFKLTPNHTLRS  803

Query  185  AITVWKS  165
            AI  WKS
Sbjct  804  AIHDWKS  810



>ref|XP_010696543.1| PREDICTED: U-box domain-containing protein 34 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=767

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG + PKSD+Y+ G+++LQLLTA++  GL  ++E AI   +L  ILD 
Sbjct  575  GTLYYIDPEYQRTGTVRPKSDLYSFGIILLQLLTARRPNGLLLVMENAIASGSLPYILDD  634

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +EL  LAL C +L+ +DRPDL+  +LPVL+KL DVA+ + ++   +   P
Sbjct  635  SIKDWPLAEVEELTKLALDCCKLRCRDRPDLETGVLPVLKKLADVADASMKVERNSIFAP  694

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL +VM+DP VAADG+TY+R+AIE+WL   + SP+T   + H NL PN T+++
Sbjct  695  SHYF-CPILHEVMDDPHVAADGFTYERRAIEAWLERYDVSPVTKQRMTHFNLTPNMTLIT  753

Query  185  AITVWKS  165
            AI  WKS
Sbjct  754  AIQEWKS  760



>emb|CDX82676.1| BnaC07g01900D [Brassica napus]
Length=877

 Score =   177 bits (449),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I  KSD+YA G++ILQLLTA++  GL H VE A+   TL E+LD 
Sbjct  308  GTLHYIDPEYHRTGTIRLKSDLYAFGIIILQLLTARKPNGLVHAVENAVQKGTLTEMLDK  367

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA + L+C E + +DRPDLK+ ++PVL++L + AN   +        P
Sbjct  368  SVTDWPLAETEELARIGLKCAEFRCRDRPDLKEEVIPVLKRLVETANSKIKKEQCNVRAP  427

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+++ME+P +AADG+TY++KAI +W  ++  SP+T   L H  L PN T+ S
Sbjct  428  SHYF-CPILRELMEEPEIAADGFTYEKKAILAWFEKHNVSPVTRQKLDHFKLTPNNTLRS  486

Query  185  AITVWKS  165
            AI  WKS
Sbjct  487  AIRDWKS  493



>ref|XP_010696544.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=766

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG + PKSD+Y+ G+++LQLLTA++  GL  ++E AI   +L  ILD 
Sbjct  574  GTLYYIDPEYQRTGTVRPKSDLYSFGIILLQLLTARRPNGLLLVMENAIASGSLPYILDD  633

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +EL  LAL C +L+ +DRPDL+  +LPVL+KL DVA+ + ++   +   P
Sbjct  634  SIKDWPLAEVEELTKLALDCCKLRCRDRPDLETGVLPVLKKLADVADASMKVERNSIFAP  693

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL +VM+DP VAADG+TY+R+AIE+WL   + SP+T   + H NL PN T+++
Sbjct  694  SHYF-CPILHEVMDDPHVAADGFTYERRAIEAWLERYDVSPVTKQRMTHFNLTPNMTLIT  752

Query  185  AITVWKS  165
            AI  WKS
Sbjct  753  AIQEWKS  759



>gb|EMT16103.1| U-box domain-containing protein 35 [Aegilops tauschii]
Length=878

 Score =   177 bits (448),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 12/192 (6%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            TG  GT+ Y+DPEY R+G +S KSD YALGMVIL+LLTAK  IGL  +VE A++   + +
Sbjct  592  TGLAGTLFYLDPEYQRSGQVSVKSDTYALGMVILELLTAKSPIGLPELVERAVEDGQITD  651

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            +LD  AG WP +E  ELA L L+C E++ KDRPDLK  +   LE+LK          S A
Sbjct  652  VLDKSAGDWPVKEAHELAQLGLKCLEMRSKDRPDLKSVVAVDLERLKH---------STA  702

Query  377  PP---PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknll  207
             P    PP++FMCPILK VM++PC+AADGY+Y+  AI  WL +   SP+T   L  K L+
Sbjct  703  VPGLAGPPSHFMCPILKKVMKNPCLAADGYSYEHDAIVMWLCDQNTSPVTKAQLRDKKLV  762

Query  206  pNYTILSAITVW  171
            PN +++SAI  W
Sbjct  763  PNLSLMSAIASW  774



>ref|XP_006280021.1| hypothetical protein CARUB_v10025897mg, partial [Capsella rubella]
 gb|EOA12919.1| hypothetical protein CARUB_v10025897mg, partial [Capsella rubella]
Length=816

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLT +   GL   VE A+     E++LD 
Sbjct  617  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTGRHPNGLLFCVEDALKRGCFEDMLDK  676

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ETKELA +A+ C++LK +DRPDL   +LP L+++ + AN ++     A   P
Sbjct  677  SVRDWPITETKELARIAVECSQLKCRDRPDLDTQVLPALKQILESAN-SRLKTEQANARP  735

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
            P ++ CPILK++MEDP +AADG+TY+ KAI++W+ +++N SP+T   L H +L PN+T+ 
Sbjct  736  PTHYYCPILKEIMEDPQIAADGFTYEGKAIKAWMQKHQNVSPVTKHRLKHSDLTPNHTLK  795

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  796  SAIQEWRS  803



>ref|XP_009132151.1| PREDICTED: U-box domain-containing protein 34-like [Brassica 
rapa]
Length=788

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 129/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+      ++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFGDMLDG  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +ELA +A++C++LK +DRPDL   +LP L+++ + AN+  ++      PP
Sbjct  649  SVRDWPMAEAEELARIAIKCSQLKCRDRPDLDTQVLPALKRILESANERLKIEQDNVRPP  708

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
             +YF CPILK++MEDP +AADG+TY+ +AI +W+  N+N SP+T   L H +L PN+T+ 
Sbjct  709  SHYF-CPILKEIMEDPYIAADGFTYEGRAIRAWIQHNQNVSPVTKHRLKHCDLTPNHTLK  767

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  768  SAIQEWRS  775



>ref|XP_010540161.1| PREDICTED: U-box domain-containing protein 34 [Tarenaya hassleriana]
Length=764

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+      ++LD 
Sbjct  571  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFPDMLDE  630

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP +E +ELA +AL+C++LK +DRPDL+  +LP L+++ + AN   +       PP
Sbjct  631  SVKGWPMDEVEELASIALKCSQLKCRDRPDLETQVLPALKRILESANNRNKNKQDNVRPP  690

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +Y+ CPILK++MEDP +AADG+TY++KAI++W+ +++ SP+T   L H +L PN+T+ S
Sbjct  691  SHYY-CPILKEIMEDPHIAADGFTYEQKAIKAWIEKHQVSPVTKQRLKHLDLTPNHTLRS  749

Query  185  AITVWKS  165
            AI  W S
Sbjct  750  AIQEWLS  756



>ref|XP_004141173.1| PREDICTED: U-box domain-containing protein 34-like [Cucumis sativus]
 gb|KGN60526.1| hypothetical protein Csa_2G000350 [Cucumis sativus]
Length=727

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSD YALG+ ILQLLT +Q  GL   +E +I   +L +ILD 
Sbjct  535  GTLHYMDPEYQRTGTLRPKSDTYALGVTILQLLTGRQPHGLLLAIENSIASASLADILDK  594

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  + +ELA LAL+C +L+ +DRPDL+  +LP+L++L D A+  +   +    PP
Sbjct  595  SISNWPLAKAEELARLALKCLKLRCRDRPDLESEVLPILKRLVDFADTFQNEDNGFGNPP  654

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL++VMEDP +AADG++Y+  AI++WL +++ SP T L L H   +PNYT+ S
Sbjct  655  SHYF-CPILQEVMEDPYIAADGFSYEYVAIKAWLEKHDVSPATKLKLRHSFFIPNYTLRS  713

Query  185  AITVWKS  165
            AI  W+S
Sbjct  714  AIREWRS  720



>ref|XP_010090090.1| U-box domain-containing protein 34 [Morus notabilis]
 gb|EXB38887.1| U-box domain-containing protein 34 [Morus notabilis]
Length=768

 Score =   174 bits (442),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 89/187 (48%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSDV+A G++ILQLLT++   GL   V+ AI   +L +ILD 
Sbjct  579  GTLFYMDPEYQRTGTIRPKSDVFAFGVIILQLLTSRHPKGLLLTVKNAIRNGSLVDILDK  638

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA LAL+C++L+ +DRPDL+  +LPVL++L D AN A+          
Sbjct  639  SVTDWPLIETEELARLALKCSKLRCRDRPDLETEVLPVLKRLVDKAN-ARAKVERNNTHA  697

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
            P ++ CPIL+++M+DP +AADG+TY+ +AI++WL ++  SP+T   L H  L  ++T+ S
Sbjct  698  PGHYYCPILQEIMDDPHIAADGFTYEYRAIKAWLEKHSVSPVTKRRLQHSMLTTDHTLRS  757

Query  185  AITVWKS  165
            AI  W+S
Sbjct  758  AINDWRS  764



>ref|XP_004157961.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
34-like [Cucumis sativus]
Length=727

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSD YALG+ ILQLLT +Q  GL   +E +I   +L +ILD 
Sbjct  535  GTLHYMDPEYQRTGTLRPKSDTYALGVTILQLLTGRQPHGLLLAIENSIASASLADILDK  594

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  + +ELA LAL+C +L+ +DRPDL+  +LP+L++L D A+  +   +    PP
Sbjct  595  SISNWPLAKAEELARLALKCLKLRCRDRPDLESEVLPILKRLVDFADTFQNEDNGFGNPP  654

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL++VMEDP +AADG++Y+  AI++WL +++ SP T L L H  L PNYT+ S
Sbjct  655  SHYF-CPILQEVMEDPYIAADGFSYEYVAIKAWLEKHDVSPATKLKLRHSFLXPNYTLRS  713

Query  185  AITVWKS  165
            AI  W+S
Sbjct  714  AIREWRS  720



>ref|XP_008459500.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
34-like [Cucumis melo]
Length=729

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSD YALG+ ILQLLT +Q  GL   +E +I   +L +ILD 
Sbjct  537  GTLHYMDPEYQRTGTLRPKSDTYALGVTILQLLTGRQPHGLLLAIENSIASASLADILDK  596

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  + +ELA LAL+C +L+ +DRPDL+  +LPVL++L D A+  ++       PP
Sbjct  597  SISDWPLAKAEELARLALKCLKLRCRDRPDLESEVLPVLKRLVDFADTFQKEDKGFGNPP  656

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL++VMEDP +AADG+TY+  AI++WL +++ SP+T L L H  L PN+T+ S
Sbjct  657  SHYF-CPILQEVMEDPYIAADGFTYEYVAIKAWLEKHDVSPVTKLKLQHSFLXPNHTLRS  715

Query  185  AITVWKS  165
            AI  W+S
Sbjct  716  AIREWRS  722



>ref|XP_006843201.1| hypothetical protein AMTR_s00146p00101260 [Amborella trichopoda]
 gb|ERN04876.1| hypothetical protein AMTR_s00146p00101260 [Amborella trichopoda]
Length=495

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  728  VGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILD  549
            VGT+ Y+DPEY RTG I PKSDVYA G++ILQLLTA    GL  ++  AID     ++LD
Sbjct  303  VGTLSYMDPEYHRTGTIRPKSDVYAFGIIILQLLTAMHPFGLIELIREAIDKQCFRDMLD  362

Query  548  TEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPP  369
                 WP  E +ELA LAL+C +L+ +DRPDL+  ILP L+++K++A+   ++       
Sbjct  363  EAITDWPMREAEELAQLALKCAQLRCRDRPDLELDILPKLQRIKEMADTYFKLCQ-HDNG  421

Query  368  PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTIL  189
             P++++CPIL++VM++P +AADG TY+ +AI++WL  N  SP+  L LPH  ++PNY++ 
Sbjct  422  APSHYLCPILQEVMDNPYIAADGLTYEYRAIKAWLENNNTSPVLQLVLPHSQIIPNYSLR  481

Query  188  SAITVWK  168
            SAI  WK
Sbjct  482  SAIQEWK  488



>emb|CDX88604.1| BnaA03g10450D [Brassica napus]
Length=788

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 129/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+      ++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFGDMLDG  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +ELA +A++C++LK +DRPDL   +LP L+++ + AN+  ++      PP
Sbjct  649  SVRDWPMAEAEELARIAIKCSQLKCRDRPDLDTQVLPALKRILESANERLKIEQDNVRPP  708

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
             +Y+ CPILK++MEDP +AADG+TY+ +AI +W+  N+N SP+T   L H +L PN+T+ 
Sbjct  709  SHYY-CPILKEIMEDPYIAADGFTYEGRAIRAWIQHNQNVSPVTKHRLKHCDLTPNHTLK  767

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  768  SAIQEWRS  775



>emb|CDY11888.1| BnaC03g13140D [Brassica napus]
Length=788

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 131/190 (69%), Gaps = 6/190 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA+   GL   VE A+      ++LD 
Sbjct  589  GTLYYMDPEYQRTGTIRPKSDLYAFGIIILQLLTARHPNGLLFCVEDAVKRGCFGDMLDG  648

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  E +ELA +A++C++LK +DRPDL   +LP L+++ + AN+   +E  ++   
Sbjct  649  SVRDWPMAEVEELARIAIKCSQLKCRDRPDLDTQVLPALKRILESANERLKREQDNVR--  706

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYT  195
             PP+++ CPILK++MEDP +AADG+TY+ +AI +W+  N+N SP+T   L H +L PN+T
Sbjct  707  -PPSHYYCPILKEIMEDPYIAADGFTYEGRAIRAWIQHNQNVSPVTKHRLKHCDLTPNHT  765

Query  194  ILSAITVWKS  165
            + SAI  W+S
Sbjct  766  LKSAIQEWRS  775



>ref|XP_010247373.1| PREDICTED: U-box domain-containing protein 34 [Nelumbo nucifera]
Length=302

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ LQLLTA    GL   VE AI+  +  +ILD 
Sbjct  111  GTLHYMDPEYQRTGTIRPKSDIYAFGIITLQLLTACHPNGLLIKVENAINNGSFADILDN  170

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDV-ANQAKEMASIAPPP  369
                WP  E++ELA +AL+C+ L+ +DRPDL+  +LPVL+KL  + A+  K   +I    
Sbjct  171  SVADWPLAESEELARVALKCSRLRCRDRPDLEAEVLPVLKKLSSIAASSVKLQKNIY---  227

Query  368  PPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTIL  189
             P+++ CPIL+++MEDP +A+DG+TY+ +AI++WL ++  SP+T L  PH  L PN+ + 
Sbjct  228  SPSHYFCPILQEIMEDPYIASDGFTYEYRAIKAWLEKHSISPVTKLKFPHTRLTPNHALR  287

Query  188  SAITVWK  168
            SAI  WK
Sbjct  288  SAIQEWK  294



>ref|XP_002514100.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48054.1| ATP binding protein, putative [Ricinus communis]
Length=778

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD+YA G++ILQLLTA++A GL    E AI    L +ILDT
Sbjct  586  GTLFYMDPEYQRTGTIRPKSDLYAFGVIILQLLTARRANGLVLAAENAIANGCLVDILDT  645

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E ++LA +AL+C+ LK +DRPDL   +LPVL +L +V   + ++   +    
Sbjct  646  SIMDWPLAEAEQLAQIALKCSNLKCRDRPDLDTEVLPVLRRLVEVGPASIKVER-SNTYA  704

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
            P+Y+ CPIL+++M+DP +AADG+TY+ +AI++WL  +  SP+T L L H  L PN+T+ S
Sbjct  705  PSYYFCPILQEIMDDPYIAADGFTYEHRAIKAWLGRHNVSPVTKLRLQHSMLTPNHTLRS  764

Query  185  AITVWKS  165
            AI  W+S
Sbjct  765  AIQEWRS  771



>ref|XP_002309208.2| hypothetical protein POPTR_0006s14900g [Populus trichocarpa]
 gb|EEE92731.2| hypothetical protein POPTR_0006s14900g [Populus trichocarpa]
Length=707

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG + PKSD+YA G+ +LQ+LTA+   GL   VE AI   +  +ILD 
Sbjct  515  GTLNYMDPEYQRTGTVRPKSDLYAFGVTVLQVLTARPPGGLILTVENAIMNGSFTDILDK  574

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  ET+ELA +AL+C+ L+ +DRPDL   +LPVL +L DVA  + E+       P
Sbjct  575  SVKDWPLAETEELAKIALKCSSLRCRDRPDLDAEVLPVLRRLVDVAAASVEVERGNIYAP  634

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +YF CPIL+D+M+DP +AADG+TY+ +AI++WL+ +  SP+T L   H  L PN+T+ S
Sbjct  635  SHYF-CPILQDLMDDPYIAADGFTYEHRAIKAWLDRHNISPVTKLRFQHSILTPNHTLRS  693

Query  185  AITVWKS  165
            AI  W+S
Sbjct  694  AIQEWRS  700



>emb|CDY38258.1| BnaA10g11060D [Brassica napus]
Length=765

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 129/188 (69%), Gaps = 2/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG   PKSD+YA G+++LQLLTA+   GL   VE A+      ++LD 
Sbjct  566  GTLYYLDPEYQRTGTFRPKSDLYAFGIIVLQLLTARHPNGLLFCVEDAVKRGCFGDMLDG  625

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
               +WP  E +ELA +A++C++LK +DRPDL   +LP L+++ + AN ++     A   P
Sbjct  626  SVREWPLAEAEELARIAIQCSQLKCRDRPDLDTQVLPALKRILESAN-SRLKTEQAKARP  684

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENEN-SPMTnlplphknllpNYTIL  189
            P+++ CPILK++MEDP +AADG+TY+ KAI++W+  N+N SP+T   L   +L PN+T+ 
Sbjct  685  PSHYYCPILKEIMEDPQIAADGFTYEGKAIKAWIQNNQNVSPVTKNRLRLCDLTPNHTLK  744

Query  188  SAITVWKS  165
            SAI  W+S
Sbjct  745  SAIQEWRS  752



>gb|KFK40304.1| hypothetical protein AALP_AA3G357700 [Arabis alpina]
Length=1341

 Score =   175 bits (444),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ YIDPEY RTG I PKSD+YA G++ILQLLTA+Q  GL H VE A+   TL E+LD 
Sbjct  627  GTLHYIDPEYHRTGTIRPKSDLYAFGIIILQLLTARQPSGLVHSVEKAVKNGTLTEMLDK  686

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQ--AKEMASIAPP  372
                WP  ET+ELA L L+C E + +DRPDL+  ++PVL++L + AN    KE +++   
Sbjct  687  SVTDWPLAETEELARLGLKCAEFRCRDRPDLESEVIPVLKRLVETANSKIKKEKSNLR--  744

Query  371  PPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMT  237
              P+++ CPIL+++ME+P +AADG+TY++KAI +WL ++  SP+T
Sbjct  745  -APSHYFCPILREIMEEPEIAADGFTYEKKAILAWLEKHNISPVT  788



>emb|CDP03134.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 127/188 (68%), Gaps = 1/188 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+CY+DPEY RTG + PKSD+YALG++ LQLLTA +       VE AI   +L   LD 
Sbjct  584  GTICYMDPEYQRTGTVRPKSDLYALGIIALQLLTACRPNRAILKVENAIKTRSLSAALDK  643

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E KELA +AL+C +L+ +DRPDL+  +LPVLE+L   A+ A++  S   P P
Sbjct  644  SISDWPLAEVKELAQMALKCCKLRCRDRPDLETELLPVLERLARFADVARKAGSGNFPAP  703

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
              Y+ CPIL+++M+DP +AADG+TY+  AI++WL+ ++ SP+T + L  K L PN+ + S
Sbjct  704  SQYY-CPILQEIMDDPHIAADGFTYEHIAIKTWLDRHDVSPVTKVRLQTKMLTPNHILRS  762

Query  185  AITVWKSG  162
            AI  W+S 
Sbjct  763  AIQEWRSS  770



>ref|XP_002983700.1| hypothetical protein SELMODRAFT_33560, partial [Selaginella moellendorffii]
 gb|EFJ15196.1| hypothetical protein SELMODRAFT_33560, partial [Selaginella moellendorffii]
Length=358

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 5/190 (3%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT  YIDPEY R G  + KSDV+A G+++LQLLTA   +G+ H V TA+D   L E
Sbjct  174  TSPVGTFAYIDPEYQREGSFNAKSDVFAFGIILLQLLTATSPVGIIHKVSTAVDQGHLME  233

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILDT AG+WP     +LA + L C E++RK+RP+L++ +L +LE +  +    +   S A
Sbjct  234  ILDTSAGEWPLAAATQLACIGLNCAEVQRKNRPELEN-VLQMLETMNHLFRSEERPKSAA  292

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
                P  F+CPIL++VME P +A+DGYTY+  AI  WL +++ SPMTNLPL +KNL PN 
Sbjct  293  ----PTLFLCPILQEVMEYPVIASDGYTYEYDAIIRWLQKSDASPMTNLPLENKNLTPNR  348

Query  197  TILSAITVWK  168
             + SAI  WK
Sbjct  349  VVRSAICEWK  358



>ref|XP_011460377.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=683

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  725  GTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEEILDT  546
            GT+ Y+DPEY RTG I PKSD++A G++ILQ+LTA+    L +IVE AI   +  +ILD 
Sbjct  494  GTLFYMDPEYQRTGTIRPKSDLFAFGVIILQVLTARHPNRLIYIVENAIANGSFADILDK  553

Query  545  EAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIAPPPP  366
                WP  E +ELA LAL C++L+ +DRPDL+  +LPVL++L ++A+   ++       P
Sbjct  554  TVSDWPVNEAEELARLALMCSKLRCRDRPDLETEVLPVLKRLANIADSNSKIDRNHTDAP  613

Query  365  PNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNYTILS  186
             +Y+ CPIL+++M+DP ++ADG+TY+ +AI++WL+++  SP+T L L H  L PN+T+ S
Sbjct  614  SHYY-CPILQEIMDDPHISADGFTYEYRAIKAWLDKHNVSPVTRLRLQHSELTPNHTLRS  672

Query  185  AITVWKS  165
            AI  W+S
Sbjct  673  AIQEWRS  679



>ref|XP_002989031.1| hypothetical protein SELMODRAFT_23109, partial [Selaginella moellendorffii]
 gb|EFJ09825.1| hypothetical protein SELMODRAFT_23109, partial [Selaginella moellendorffii]
Length=358

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -2

Query  737  TGPVGTVCYIDPEYTRTGLISPKSDVYALGMVILQLLTAKQAIGLTHIVETAIDIDTLEE  558
            T PVGT  YIDPEY R G  + KSDV+A G+++LQLLTA   +G+ H V TA+D   L E
Sbjct  174  TSPVGTFAYIDPEYQREGSFNAKSDVFAFGIILLQLLTATSPVGIIHKVSTAVDQGHLME  233

Query  557  ILDTEAGKWPREETKELAVLALRCTELKRKDRPDLKDHILPVLEKLKDVANQAKEMASIA  378
            ILDT AG+WP     +LA + L C E++RK+RP+L++ +L +LE +  +    +   S A
Sbjct  234  ILDTSAGEWPLAAATQLACIGLNCAEVQRKNRPELEN-VLQMLETMNHLFRSEERPKSAA  292

Query  377  PPPPPNYFMCPILKDVMEDPCVAADGYTYDRKAIESWLNENENSPMTnlplphknllpNY  198
                P  F+CPIL++VME P +A+DGYTY+  AI  WL +++ SPMTNL L +KNL PN 
Sbjct  293  ----PTLFLCPILQEVMEYPVIASDGYTYEYDAIIRWLQKSDASPMTNLRLENKNLTPNR  348

Query  197  TILSAITVWK  168
             + SAI  W+
Sbjct  349  VVRSAICEWR  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210