BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF017A19

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362029.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    197   8e-55   
ref|XP_009606961.1|  PREDICTED: SUMO-activating enzyme subunit 2        196   2e-54   Nicotiana tomentosiformis
ref|XP_010315319.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    192   2e-53   Solanum lycopersicum
ref|XP_004230873.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    192   4e-53   Solanum lycopersicum
gb|EYU37827.1|  hypothetical protein MIMGU_mgv1a002832mg                191   6e-53   Erythranthe guttata [common monkey flower]
ref|XP_009765006.1|  PREDICTED: SUMO-activating enzyme subunit 2        188   9e-52   Nicotiana sylvestris
ref|XP_011088448.1|  PREDICTED: SUMO-activating enzyme subunit 2        184   3e-50   Sesamum indicum [beniseed]
ref|XP_010645393.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    180   2e-49   Vitis vinifera
ref|XP_002283529.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    181   4e-49   Vitis vinifera
emb|CBI37697.3|  unnamed protein product                                181   5e-49   Vitis vinifera
ref|XP_011047920.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    177   8e-48   Populus euphratica
ref|XP_011047900.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    177   9e-48   Populus euphratica
ref|XP_011047909.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    177   1e-47   Populus euphratica
emb|CAJ19271.1|  SUMO activating enzyme 2                               165   5e-47   Solanum commersonii
ref|XP_003627740.1|  SUMO activating enzyme                             162   7e-46   
emb|CDO97017.1|  unnamed protein product                                171   2e-45   Coffea canephora [robusta coffee]
ref|XP_002313776.1|  hypothetical protein POPTR_0009s12300g             167   2e-44   
ref|XP_004289650.1|  PREDICTED: SUMO-activating enzyme subunit 2        167   4e-44   Fragaria vesca subsp. vesca
ref|XP_008382303.1|  PREDICTED: SUMO-activating enzyme subunit 2        167   4e-44   Malus domestica [apple tree]
gb|KCW64019.1|  hypothetical protein EUGRSUZ_G016992                    165   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010066186.1|  PREDICTED: SUMO-activating enzyme subunit 2        165   2e-43   Eucalyptus grandis [rose gum]
ref|XP_011037465.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    164   3e-43   Populus euphratica
ref|XP_011037464.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    164   3e-43   Populus euphratica
ref|XP_009372987.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    163   7e-43   Pyrus x bretschneideri [bai li]
ref|XP_010251621.1|  PREDICTED: SUMO-activating enzyme subunit 2        163   7e-43   Nelumbo nucifera [Indian lotus]
gb|KEH19101.1|  SUMO1 activating enzyme subunit 2                       162   2e-42   Medicago truncatula
ref|XP_008236951.1|  PREDICTED: SUMO-activating enzyme subunit 2        162   3e-42   Prunus mume [ume]
ref|XP_007199741.1|  hypothetical protein PRUPE_ppa002704mg             158   5e-41   Prunus persica
ref|XP_003541605.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    155   6e-40   Glycine max [soybeans]
gb|KDO49455.1|  hypothetical protein CISIN_1g006294mg                   154   1e-39   Citrus sinensis [apfelsine]
gb|KDO49456.1|  hypothetical protein CISIN_1g006294mg                   154   1e-39   Citrus sinensis [apfelsine]
ref|XP_006487357.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    154   1e-39   Citrus sinensis [apfelsine]
ref|XP_002306122.2|  hypothetical protein POPTR_0004s166302g            153   2e-39   
ref|XP_004150065.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    153   3e-39   Cucumis sativus [cucumbers]
ref|XP_004165550.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...    153   4e-39   
ref|XP_003540521.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    152   6e-39   Glycine max [soybeans]
gb|KHN19464.1|  SUMO-activating enzyme subunit 2                        152   8e-39   Glycine soja [wild soybean]
ref|XP_008460981.1|  PREDICTED: SUMO-activating enzyme subunit 2        151   1e-38   Cucumis melo [Oriental melon]
ref|XP_004510996.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    151   2e-38   Cicer arietinum [garbanzo]
ref|XP_009347844.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    148   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_007133804.1|  hypothetical protein PHAVU_011G210500g             148   2e-37   Phaseolus vulgaris [French bean]
ref|XP_009347843.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    147   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_010107832.1|  SUMO-activating enzyme subunit 2                   145   1e-36   
ref|XP_010942467.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    145   1e-36   Elaeis guineensis
ref|XP_008357172.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    145   2e-36   Malus domestica [apple tree]
ref|XP_010429058.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    144   5e-36   Camelina sativa [gold-of-pleasure]
gb|KJB32552.1|  hypothetical protein B456_005G246300                    144   5e-36   Gossypium raimondii
gb|KJB32553.1|  hypothetical protein B456_005G246300                    144   6e-36   Gossypium raimondii
gb|KHG12220.1|  SUMO-activating enzyme subunit 2 -like protein          142   2e-35   Gossypium arboreum [tree cotton]
gb|KHG16253.1|  SUMO-activating enzyme subunit 2 -like protein          142   2e-35   Gossypium arboreum [tree cotton]
ref|XP_010690827.1|  PREDICTED: SUMO-activating enzyme subunit 2        142   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007042097.1|  SUMO-activating enzyme 2 isoform 1                 140   9e-35   Theobroma cacao [chocolate]
gb|KDP41752.1|  hypothetical protein JCGZ_26770                         140   1e-34   Jatropha curcas
ref|XP_008777003.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    139   2e-34   Phoenix dactylifera
gb|KJB47535.1|  hypothetical protein B456_008G030900                    138   5e-34   Gossypium raimondii
gb|KJB47538.1|  hypothetical protein B456_008G030900                    138   6e-34   Gossypium raimondii
ref|XP_008777005.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    138   6e-34   
gb|KJB47537.1|  hypothetical protein B456_008G030900                    138   9e-34   Gossypium raimondii
ref|XP_008777001.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    135   3e-33   
ref|XP_008797038.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   1e-32   
ref|XP_008797039.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   1e-32   
ref|XP_008797037.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    134   2e-32   Phoenix dactylifera
gb|EPS74543.1|  hypothetical protein M569_00206                         133   3e-32   Genlisea aurea
ref|XP_009399955.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    133   6e-32   
ref|XP_002512954.1|  ubiquitin-activating enzyme E1b, putative          132   8e-32   Ricinus communis
ref|XP_006838625.1|  hypothetical protein AMTR_s00002p00233990          131   2e-31   Amborella trichopoda
ref|XP_010938778.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    130   2e-31   Elaeis guineensis
ref|XP_006293831.1|  hypothetical protein CARUB_v10022825mg             131   3e-31   Capsella rubella
ref|XP_010938777.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    130   3e-31   
ref|XP_010938776.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    130   3e-31   Elaeis guineensis
gb|EMS58354.1|  SUMO-activating enzyme subunit 2                        130   7e-31   Triticum urartu
gb|EMT21367.1|  SUMO-activating enzyme subunit 2                        130   7e-31   
ref|XP_009140282.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    130   7e-31   Brassica rapa
emb|CDY15890.1|  BnaA04g12210D                                          129   1e-30   Brassica napus [oilseed rape]
ref|XP_009412808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    129   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416892.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    127   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010236228.1|  PREDICTED: SUMO-activating enzyme subunit 2        127   7e-30   Brachypodium distachyon [annual false brome]
ref|XP_010472141.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    126   1e-29   
emb|CDX99589.1|  BnaC04g33460D                                          124   1e-28   
gb|KFK32895.1|  hypothetical protein AALP_AA6G302000                    123   1e-28   Arabis alpina [alpine rockcress]
tpg|DAA41263.1|  TPA: hypothetical protein ZEAMMB73_736183              118   2e-28   
ref|XP_006657898.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    122   3e-28   
emb|CDX82033.1|  BnaC08g35680D                                          122   3e-28   
ref|NP_179742.2|  SUMO-activating enzyme subunit 2                      121   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189570.1|  SUMO-activating enzyme subunit 2                   121   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404595.1|  hypothetical protein EUTSA_v10000089mg             120   1e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010531451.1|  PREDICTED: SUMO-activating enzyme subunit 2        120   1e-27   Tarenaya hassleriana [spider flower]
emb|CDY13814.1|  BnaA09g43160D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_009117402.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    120   2e-27   Brassica rapa
ref|XP_008670523.1|  PREDICTED: SUMO-activating enzyme subunit 2        118   1e-26   
dbj|BAD95040.1|  ubiquitin activating enzyme like protein               108   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002460940.1|  hypothetical protein SORBIDRAFT_02g037850          111   2e-24   Sorghum bicolor [broomcorn]
ref|XP_002992493.1|  SUMO activating enzyme 2                           109   9e-24   
gb|EEE67493.1|  hypothetical protein OsJ_24922                          108   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82353.1|  hypothetical protein OsI_26664                          108   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_004958165.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    107   5e-23   Setaria italica
ref|XP_002990197.1|  SUMO activating enzyme 2                           106   1e-22   
gb|KCW64020.1|  hypothetical protein EUGRSUZ_G016992                    105   1e-22   Eucalyptus grandis [rose gum]
gb|AAN03851.1|  SUMO activating enzyme 2                                102   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423380.1|  hypothetical protein CICLE_v100281692mg          98.6    1e-20   
ref|NP_973506.1|  SUMO-activating enzyme subunit 2                    95.5    9e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAD67688.1|  putative ubiquitin activating enzyme                 95.5    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001775802.1|  predicted protein                                95.1    1e-18   
ref|XP_002878554.1|  sumo-activating enzyme 2                         94.0    3e-18   
ref|XP_009399956.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  87.0    4e-16   
ref|XP_003078790.1|  SUMO activating enzyme 2 (ISS)                   72.4    3e-11   
emb|CEF97583.1|  Molybdenum cofactor biosynthesis, MoeB               72.0    4e-11   Ostreococcus tauri
ref|XP_001762389.1|  predicted protein                                66.6    2e-09   
ref|XP_001417248.1|  predicted protein                                63.5    2e-08   Ostreococcus lucimarinus CCE9901
ref|XP_007042099.1|  SUMO-activating enzyme 2 isoform 3               52.8    4e-08   
ref|XP_007042098.1|  SUMO-activating enzyme 2 isoform 2               52.4    1e-04   
gb|KJB32554.1|  hypothetical protein B456_005G246300                  51.6    2e-04   Gossypium raimondii
gb|KJB47539.1|  hypothetical protein B456_008G030900                  51.6    3e-04   Gossypium raimondii
gb|KDO49457.1|  hypothetical protein CISIN_1g006294mg                 51.2    3e-04   Citrus sinensis [apfelsine]



>ref|XP_006362029.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Solanum tuberosum]
Length=652

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 131/189 (69%), Gaps = 19/189 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G ALLYEVGDDL+E  V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C
Sbjct  467  MSLPLIMHGVALLYEVGDDLEEDEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKC  526

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PDGMVLSGWTP LA+E     T DNG SSS ASQT PL++ ++D+
Sbjct  527  SINIKHREEFDEEKEPDGMVLSGWTPALAAEKTK--TSDNGPSSSNASQTVPLESEDNDE  584

Query  353  LE-ILPTGTAISPGKKRKLCDTN---------------PDRKVEELDDDGDGFVTLDGNS  222
            +E IL     ++ GKKRK  D +                 RKVEE DD  +  V +DGN 
Sbjct  585  IEIILKDPEILAAGKKRKSSDVSVAVDSEMFSVTGEMLTKRKVEE-DDSHNDIVMVDGNL  643

Query  221  DGSKKQRVQ  195
            D +KK+RVQ
Sbjct  644  DPNKKKRVQ  652



>ref|XP_009606961.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana tomentosiformis]
Length=652

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 128/188 (68%), Gaps = 16/188 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G ALLYEVGDDL+E  V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C
Sbjct  465  MSLPLIMHGVALLYEVGDDLEEDEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PD MVLSGWTP LA+E   KT+ DNG SSS ASQT  L+  +DD+
Sbjct  525  NINIKHREEFDEEKEPDEMVLSGWTPALATEKKTKTS-DNGPSSSNASQTVQLEPEDDDE  583

Query  353  LE-ILPTGTAISPGKKRKLCDTN--PDRKVE------------ELDDDGDGFVTLDGNSD  219
            LE IL     +S G KRKL D +   D +V             E DD       LDGNSD
Sbjct  584  LEIILKDPEILSAGNKRKLSDISVTADSEVSRVTGEMQTKSHAEADDTHTDTAMLDGNSD  643

Query  218  GSKKQRVQ  195
             SKK+RVQ
Sbjct  644  ISKKKRVQ  651



>ref|XP_010315319.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Solanum 
lycopersicum]
Length=607

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 130/189 (69%), Gaps = 19/189 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G ALLYEVGDDL+E  V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C
Sbjct  422  MSLPLIMHGVALLYEVGDDLEEDEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKC  481

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PDGMVLSGWTP LA+E     T DNG SSS ASQT PL++ ++D+
Sbjct  482  SINIKHREEFDEEKEPDGMVLSGWTPALAAEKTK--TLDNGPSSSNASQTVPLESEDNDE  539

Query  353  LE-ILPTGTAISPGKKRKLCDTN---------------PDRKVEELDDDGDGFVTLDGNS  222
            +E IL     ++ GKKRK  D +                 +KVEE DD  +  V +DG  
Sbjct  540  IEIILKDPEILAAGKKRKSSDVSVAVDPEIFSVTGAMLTKKKVEE-DDSNNDIVMVDGKL  598

Query  221  DGSKKQRVQ  195
            D +KK+RVQ
Sbjct  599  DLNKKKRVQ  607



>ref|XP_004230873.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Solanum 
lycopersicum]
Length=650

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 130/189 (69%), Gaps = 19/189 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G ALLYEVGDDL+E  V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C
Sbjct  465  MSLPLIMHGVALLYEVGDDLEEDEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PDGMVLSGWTP LA+E     T DNG SSS ASQT PL++ ++D+
Sbjct  525  SINIKHREEFDEEKEPDGMVLSGWTPALAAEKTK--TLDNGPSSSNASQTVPLESEDNDE  582

Query  353  LE-ILPTGTAISPGKKRKLCDTN---------------PDRKVEELDDDGDGFVTLDGNS  222
            +E IL     ++ GKKRK  D +                 +KVEE DD  +  V +DG  
Sbjct  583  IEIILKDPEILAAGKKRKSSDVSVAVDPEIFSVTGAMLTKKKVEE-DDSNNDIVMVDGKL  641

Query  221  DGSKKQRVQ  195
            D +KK+RVQ
Sbjct  642  DLNKKKRVQ  650



>gb|EYU37827.1| hypothetical protein MIMGU_mgv1a002832mg [Erythranthe guttata]
Length=633

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 129/186 (69%), Gaps = 16/186 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ALLYEVGDDL+E  V NYAANL+KVL EL  PV GGTI+ VEDLQQEL C
Sbjct  450  MNLPLIMHGSALLYEVGDDLEEDEVANYAANLEKVLSELPSPVMGGTILTVEDLQQELKC  509

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKT-THDNGASSSTASQTAPLDANEDD  357
            +INIKHREEFDEEK+PDGM+LSGWTP LA+E N  T T +NGAS+S  SQ   L   EDD
Sbjct  510  SINIKHREEFDEEKEPDGMILSGWTPALAAEKNGSTSTTENGASTSGVSQATSLMTEEDD  569

Query  356  DLEILPTGTAISPGKKRKLCDTNP-----------DRKVEELDDDGDG-FVTLDGNSDGS  213
            DL+I+PT      GKKRK+ D +            D K++  D DG+   V LD  S G+
Sbjct  570  DLQIIPTQPG---GKKRKISDLSSAATSDFSSVAKDTKIQRKDVDGNNDVVMLDDGSLGN  626

Query  212  KKQRVQ  195
             K++++
Sbjct  627  SKKKIE  632



>ref|XP_009765006.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana sylvestris]
Length=651

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 127/188 (68%), Gaps = 16/188 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G ALLYEVGDDL+E  V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C
Sbjct  465  MSLPLIMHGVALLYEVGDDLEEDEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PD MVLSGWTP LA+E   KT+ DNG SSS ASQ    +  +DD+
Sbjct  525  SINIKHREEFDEEKEPDEMVLSGWTPALAAEKKTKTS-DNGPSSSNASQAVQPEPEDDDE  583

Query  353  LE-ILPTGTAISPGKKRKLCDTN--PDRKVEEL------------DDDGDGFVTLDGNSD  219
            LE IL     +S G KRKL D +   D +V  +            DD     + +DGNSD
Sbjct  584  LEIILKDPEILSAGNKRKLSDISNTADSEVSRVTGEMQTKSHVEEDDTHTDTIMIDGNSD  643

Query  218  GSKKQRVQ  195
             SKK+RVQ
Sbjct  644  ISKKKRVQ  651



>ref|XP_011088448.1| PREDICTED: SUMO-activating enzyme subunit 2 [Sesamum indicum]
Length=648

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 126/188 (67%), Gaps = 19/188 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G++LLYEVGDDL+E  V NYAANL+KVL EL  PV GGTI+ VEDLQQEL C
Sbjct  465  MNLPLIMHGSSLLYEVGDDLEEDEVANYAANLEKVLSELPSPVIGGTILTVEDLQQELKC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +IN+KHREEFDEEK+PDGMVLSGWT  LA E N K + DNGAS+S  S+T  L   +DD+
Sbjct  525  SINVKHREEFDEEKEPDGMVLSGWTQPLAVEKNGKGSTDNGASTSRVSETTSLVMEDDDE  584

Query  353  LEILPTGTAISPGKKRKLC---------------DTNPDRKVEELDDDGDGFVTLDGNSD  219
            L+I+P   A    KKRKL                +    RK EE D++ D  +   G+S+
Sbjct  585  LQIIPAQIA----KKRKLSDISSAASSDASSFRNEAKFKRKAEEADNNNDVVMLDGGSSE  640

Query  218  GSKKQRVQ  195
             SKK+R Q
Sbjct  641  NSKKKREQ  648



>ref|XP_010645393.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Vitis 
vinifera]
Length=521

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 15/179 (8%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G ALLYEVGDDLD+ M  NYAANL+KVL EL  PV GGT++ VEDLQQE TC
Sbjct  352  MNCPLIMHGPALLYEVGDDLDKDMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTC  411

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGM+LSGWT     E ++NKT  + G+S+S AS   P++A EDD
Sbjct  412  NINIKHREEFDEEKEPDGMLLSGWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDD  471

Query  356  DLEILPTGTAISPGKKRKLCD----TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  195
            D+E +PT      GKKRK+ +    TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  472  DIEFVPT------GKKRKVGEISKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  521



>ref|XP_002283529.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Vitis 
vinifera]
Length=634

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 15/179 (8%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G ALLYEVGDDLD+ M  NYAANL+KVL EL  PV GGT++ VEDLQQE TC
Sbjct  465  MNCPLIMHGPALLYEVGDDLDKDMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGM+LSGWT     E ++NKT  + G+S+S AS   P++A EDD
Sbjct  525  NINIKHREEFDEEKEPDGMLLSGWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDD  584

Query  356  DLEILPTGTAISPGKKRKLCD----TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  195
            D+E +PT      GKKRK+ +    TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  585  DIEFVPT------GKKRKVGEISKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  634



>emb|CBI37697.3| unnamed protein product [Vitis vinifera]
Length=618

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 15/179 (8%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G ALLYEVGDDLD+ M  NYAANL+KVL EL  PV GGT++ VEDLQQE TC
Sbjct  449  MNCPLIMHGPALLYEVGDDLDKDMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTC  508

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGM+LSGWT     E ++NKT  + G+S+S AS   P++A EDD
Sbjct  509  NINIKHREEFDEEKEPDGMLLSGWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDD  568

Query  356  DLEILPTGTAISPGKKRKLCD----TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  195
            D+E +PT      GKKRK+ +    TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  569  DIEFVPT------GKKRKVGEISKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  618



>ref|XP_011047920.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X3 [Populus 
euphratica]
Length=614

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (69%), Gaps = 19/191 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  G+ALLYEVGDDL+E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TC
Sbjct  425  MNSPLIMCGSALLYEVGDDLEEDMIANYTANLEKVLSELPSPVIGGKMLTVEDLQQEFTC  484

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI IKHREEFDEEK+PDGMVLSGWT  L  + ++KT+  NGAS+S +  T P+DA +D +
Sbjct  485  NIYIKHREEFDEEKEPDGMVLSGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIE  544

Query  353  LEILPTGTAISPGKKRKL------C---------DTNPDRKVEEL--DDDGDGFVTLD-G  228
            ++ +  GTA SPGKKRKL      C         +T  D+K+++L  DDD D  V LD  
Sbjct  545  VKEISDGTA-SPGKKRKLPEFSEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHW  603

Query  227  NSDGSKKQRVQ  195
              D SKKQR+Q
Sbjct  604  GKDTSKKQRLQ  614



>ref|XP_011047900.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Populus 
euphratica]
Length=657

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (69%), Gaps = 19/191 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  G+ALLYEVGDDL+E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TC
Sbjct  468  MNSPLIMCGSALLYEVGDDLEEDMIANYTANLEKVLSELPSPVIGGKMLTVEDLQQEFTC  527

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI IKHREEFDEEK+PDGMVLSGWT  L  + ++KT+  NGAS+S +  T P+DA +D +
Sbjct  528  NIYIKHREEFDEEKEPDGMVLSGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIE  587

Query  353  LEILPTGTAISPGKKRKL------C---------DTNPDRKVEEL--DDDGDGFVTLD-G  228
            ++ +  GTA SPGKKRKL      C         +T  D+K+++L  DDD D  V LD  
Sbjct  588  VKEISDGTA-SPGKKRKLPEFSEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHW  646

Query  227  NSDGSKKQRVQ  195
              D SKKQR+Q
Sbjct  647  GKDTSKKQRLQ  657



>ref|XP_011047909.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Populus 
euphratica]
Length=652

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (69%), Gaps = 19/191 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  G+ALLYEVGDDL+E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TC
Sbjct  463  MNSPLIMCGSALLYEVGDDLEEDMIANYTANLEKVLSELPSPVIGGKMLTVEDLQQEFTC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI IKHREEFDEEK+PDGMVLSGWT  L  + ++KT+  NGAS+S +  T P+DA +D +
Sbjct  523  NIYIKHREEFDEEKEPDGMVLSGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIE  582

Query  353  LEILPTGTAISPGKKRKL------C---------DTNPDRKVEEL--DDDGDGFVTLD-G  228
            ++ +  GTA SPGKKRKL      C         +T  D+K+++L  DDD D  V LD  
Sbjct  583  VKEISDGTA-SPGKKRKLPEFSEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHW  641

Query  227  NSDGSKKQRVQ  195
              D SKKQR+Q
Sbjct  642  GKDTSKKQRLQ  652



>emb|CAJ19271.1| SUMO activating enzyme 2 [Solanum commersonii]
Length=172

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G ALLYEVGDDL+E  V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C
Sbjct  58   MSLPLIMHGVALLYEVGDDLEEDEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKC  117

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDAN  366
            +INIKHREEFDEEK+PDGMVLSGWTP LA+E     T DNG SSS ASQT P +  
Sbjct  118  SINIKHREEFDEEKEPDGMVLSGWTPALAAEKTK--TSDNGPSSSNASQTVPAEVR  171



>ref|XP_003627740.1| SUMO activating enzyme [Medicago truncatula]
Length=175

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 118/182 (65%), Gaps = 18/182 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP + N + LLYE GD +++ MV  Y ANL+KVL EL  PV GGT++ VED QQEL C
Sbjct  1    MSLPLVMNASNLLYEAGD-IEDDMVAIYNANLEKVLAELPSPVTGGTMLTVEDFQQELKC  59

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGA++S A  T    +  DD
Sbjct  60   NINIKHREEFDEEKEPDGMVLSGWTQPVAAAENEDKSVS-NGANTSDAPITEVEKSENDD  118

Query  356  DLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
            D+ I      ISP KKRKL          D     K  ++ DD D  V LDGN DG KK+
Sbjct  119  DVGI------ISPVKKRKLPDDSDKSNTADDERHHKKLQVIDDEDDLVMLDGNLDGFKKR  172

Query  203  RV  198
            RV
Sbjct  173  RV  174



>emb|CDO97017.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 122/185 (66%), Gaps = 18/185 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I +G ALLYEVGD L+E M   YAANL+KVL +L  PV GGT++ VEDLQQELTC
Sbjct  465  MSQPMIMHGHALLYEVGDGLEEDMATTYAANLEKVLAQLPSPVTGGTVIMVEDLQQELTC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFD EK+PDGM+LSG T  L  + N++ + +NGAS+S  SQT  ++A EDD+
Sbjct  525  TINIKHREEFDGEKEPDGMILSGLTEALV-QKNDEASKENGASTSNVSQTVSVEAEEDDE  583

Query  353  LEILPTGTAISPGKKRKLCD---------------TNPDRKVEELDDDGDGFVTLDGNSD  219
            L+ILP  + ++ GKKRKL D               T   RK  +  +D +  V LDGN +
Sbjct  584  LQILPAVSGLA-GKKRKLPDNANSSNSDLSGVIDETKIPRKAID-REDSEAVVVLDGNGE  641

Query  218  GSKKQ  204
              KK+
Sbjct  642  RKKKR  646



>ref|XP_002313776.1| hypothetical protein POPTR_0009s12300g [Populus trichocarpa]
 gb|EEE87731.1| hypothetical protein POPTR_0009s12300g [Populus trichocarpa]
Length=662

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  G ALLYEVGDDL+E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TC
Sbjct  474  MNSPLIMCGLALLYEVGDDLEEDMIANYTANLEKVLSELPSPVTGGKMLTVEDLQQEFTC  533

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI IKHREEFDEEK+PDGMVLSGWT     + ++KT+  NGAS+S +  T P+DA +D  
Sbjct  534  NIYIKHREEFDEEKEPDGMVLSGWTQAPPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIK  593

Query  353  LEILPTGTAISPGKKRKL  300
            ++ +  GTA SPGKKRKL
Sbjct  594  VKEISDGTA-SPGKKRKL  610



>ref|XP_004289650.1| PREDICTED: SUMO-activating enzyme subunit 2 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GAALLYEVGDDLDE M+ NYAANLDKVL E   PV  GT++ +EDLQQEL+C
Sbjct  465  MNSPLIMHGAALLYEVGDDLDEAMIRNYAANLDKVLSEFPSPVTSGTMLTIEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGMVLSGWTP  +   ++K ++ N  S+S+AS+   L+A+++++
Sbjct  525  NINIKHREEFDEEKEPDGMVLSGWTPATSVVKDDKKSNANAGSTSSASE---LEADKNNE  581

Query  353  LEILPTGTAISPGKKRKLCDTN  288
             E        +PGKKRKL + +
Sbjct  582  AE-------TAPGKKRKLSEVS  596



>ref|XP_008382303.1| PREDICTED: SUMO-activating enzyme subunit 2 [Malus domestica]
Length=644

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 123/189 (65%), Gaps = 25/189 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G+ALLYEVGDDLDE MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C
Sbjct  465  MSLPLIMHGSALLYEVGDDLDEDMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGMVLSGWT   A   ++K +  N  S+S AS +  ++A   DD
Sbjct  525  KINIKHREEFDEEKEPDGMVLSGWTQSPAVAQDDKKSTANAGSTSNASSS--MEAERTDD  582

Query  353  LEILPTGTAISPGKKRKLCD----TNPD------------RKVEELDDDGDGFVTLDGNS  222
            +E        +PG+KRKL +     NPD             K+E +DDD +  +  + +S
Sbjct  583  VE-------TTPGRKRKLSEVSEAVNPDIPSVAGSSTRNPEKLELVDDDDELVIFDNWDS  635

Query  221  DGSKKQRVQ  195
              SKK ++Q
Sbjct  636  VTSKKIKLQ  644



>gb|KCW64019.1| hypothetical protein EUGRSUZ_G016992, partial [Eucalyptus grandis]
Length=609

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 122/189 (65%), Gaps = 18/189 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ALLYEVGDDL+E MV NYAANL+KVL EL  PV  GT++ VEDLQQELTC
Sbjct  423  MNLPLIMHGSALLYEVGDDLEEDMVTNYAANLEKVLSELPSPVTSGTLLTVEDLQQELTC  482

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGA-SSSTASQTAPLDANEDD  357
            NI+IKHREEFDEEK+PDGMVLSGWTP  A E  ++   DNG  +S   +    ++ NE  
Sbjct  483  NISIKHREEFDEEKEPDGMVLSGWTPAPAVEKKDENHVDNGVGTSKNITNAEQVETNE--  540

Query  356  DLEILPTGTAISPGKKRKLCD---------------TNPDRKVEELDDDGDGFVTLDGNS  222
            DLEI+P        KKRKL +                N   KV++LDDD D      G+S
Sbjct  541  DLEIVPADIETPAEKKRKLSEISNNDGLGTSRVAAKANNHSKVQDLDDDDDVVFISGGDS  600

Query  221  DGSKKQRVQ  195
            D SKK+++ 
Sbjct  601  DPSKKRKLH  609



>ref|XP_010066186.1| PREDICTED: SUMO-activating enzyme subunit 2 [Eucalyptus grandis]
Length=650

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 120/188 (64%), Gaps = 16/188 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ALLYEVGDDL+E MV NYAANL+KVL EL  PV  GT++ VEDLQQELTC
Sbjct  464  MNLPLIMHGSALLYEVGDDLEEDMVTNYAANLEKVLSELPSPVTSGTLLTVEDLQQELTC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI+IKHREEFDEEK+PDGMVLSGWTP  A E  ++   DNG  +S     A      ++D
Sbjct  524  NISIKHREEFDEEKEPDGMVLSGWTPAPAVEKKDENHVDNGVGTSKNITNAE-QVETNED  582

Query  353  LEILPTGTAISPGKKRKLCD---------------TNPDRKVEELDDDGDGFVTLDGNSD  219
            LEI+P        KKRKL +                N   KV++LDDD D      G+SD
Sbjct  583  LEIVPADIETPAEKKRKLSEISNNDGLGTSRVAAKANNHSKVQDLDDDDDVVFISGGDSD  642

Query  218  GSKKQRVQ  195
             SKK+++ 
Sbjct  643  PSKKRKLH  650



>ref|XP_011037465.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Populus 
euphratica]
Length=605

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 123/187 (66%), Gaps = 18/187 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +  ALLYE+GDDL+E  + NY ANL+KVL EL PPV  GT++ VEDLQQE TC
Sbjct  419  MNSPLIMHATALLYEIGDDLEENEIANYTANLEKVLSELPPPVTDGTVLTVEDLQQEFTC  478

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI+IKHREEFDEEK+PDGMVLSGWT   + + ++KT+  NGAS+S +  T       D +
Sbjct  479  NIHIKHREEFDEEKEPDGMVLSGWTQAPSEKKDDKTSIGNGASTSKSLPTKLGITEIDIE  538

Query  353  LEILPTGTAISPGKKRKLCD---------------TNPDRKVEELDDDGDGFVTLD-GNS  222
            ++ +  GT +SPG KRKL +               T  ++K ++ DDDG G V LD  +S
Sbjct  539  VKEISGGT-VSPGTKRKLSEFSDGSTVDQSSDVDQTRNNKKTQKHDDDG-GLVMLDHWDS  596

Query  221  DGSKKQR  201
            + SKKQR
Sbjct  597  NMSKKQR  603



>ref|XP_011037464.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Populus 
euphratica]
Length=648

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 123/187 (66%), Gaps = 18/187 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +  ALLYE+GDDL+E  + NY ANL+KVL EL PPV  GT++ VEDLQQE TC
Sbjct  462  MNSPLIMHATALLYEIGDDLEENEIANYTANLEKVLSELPPPVTDGTVLTVEDLQQEFTC  521

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI+IKHREEFDEEK+PDGMVLSGWT   + + ++KT+  NGAS+S +  T       D +
Sbjct  522  NIHIKHREEFDEEKEPDGMVLSGWTQAPSEKKDDKTSIGNGASTSKSLPTKLGITEIDIE  581

Query  353  LEILPTGTAISPGKKRKLCD---------------TNPDRKVEELDDDGDGFVTLD-GNS  222
            ++ +  GT +SPG KRKL +               T  ++K ++ DDDG G V LD  +S
Sbjct  582  VKEISGGT-VSPGTKRKLSEFSDGSTVDQSSDVDQTRNNKKTQKHDDDG-GLVMLDHWDS  639

Query  221  DGSKKQR  201
            + SKKQR
Sbjct  640  NMSKKQR  646



>ref|XP_009372987.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Pyrus x bretschneideri]
Length=643

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 122/189 (65%), Gaps = 26/189 (14%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G+ALLYEVGDDLDE MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C
Sbjct  465  MSLPLIMHGSALLYEVGDDLDEDMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGMVLSGWT   A   ++K +  N  S+S AS  A  +A + DD
Sbjct  525  KINIKHREEFDEEKEPDGMVLSGWTQSPAVAQDDKKSTANAGSTSNAS--ASTEAEKTDD  582

Query  353  LEILPTGTAISPGKKRKLCD----TNPD------------RKVEELDDDGDGFVTLDGNS  222
            +E        + G+KRKL +     NPD             K+E +DDD +  +  + +S
Sbjct  583  VE--------TTGRKRKLSEASEAVNPDIPSVAGSSTRNPEKLELVDDDDELVIFDNWDS  634

Query  221  DGSKKQRVQ  195
              SKK ++Q
Sbjct  635  VTSKKIKLQ  643



>ref|XP_010251621.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nelumbo nucifera]
Length=647

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 121/188 (64%), Gaps = 20/188 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ LLYEVGDDLDE MV NY++NL+KVL EL  PV GGT++ VEDLQQELTC
Sbjct  465  MNLPLIMHGSTLLYEVGDDLDEDMVANYSSNLEKVLAELPSPVTGGTVLTVEDLQQELTC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGM+LSGW      +  N    DN  S+S  SQ   ++  + ++
Sbjct  525  NINIKHREEFDEEKEPDGMLLSGWVQSPQMKKVNHKQVDNEDSTSIVSQPVHVETEDVNE  584

Query  353  LEILPTGTAISPGKKRK--------------LCDTNPDRKVEELD-DDGDGFVTLDGNSD  219
             EI+     +S G KRK                 T  ++K EE++ DD D  V LDG+SD
Sbjct  585  TEIV-----VSTGTKRKSSEISSTSSIASAASVGTRSNQKPEEINDDDDDDLVILDGHSD  639

Query  218  GSKKQRVQ  195
              KK+R+Q
Sbjct  640  TLKKKRLQ  647



>gb|KEH19101.1| SUMO1 activating enzyme subunit 2 [Medicago truncatula]
Length=635

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 118/182 (65%), Gaps = 18/182 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP + N + LLYE GD +++ MV  Y ANL+KVL EL  PV GGT++ VED QQEL C
Sbjct  461  MSLPLVMNASNLLYEAGD-IEDDMVAIYNANLEKVLAELPSPVTGGTMLTVEDFQQELKC  519

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGA++S A  T    +  DD
Sbjct  520  NINIKHREEFDEEKEPDGMVLSGWTQPVAAAENEDKSV-SNGANTSDAPITEVEKSENDD  578

Query  356  DLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
            D+ I      ISP KKRKL          D     K  ++ DD D  V LDGN DG KK+
Sbjct  579  DVGI------ISPVKKRKLPDDSDKSNTADDERHHKKLQVIDDEDDLVMLDGNLDGFKKR  632

Query  203  RV  198
            RV
Sbjct  633  RV  634



>ref|XP_008236951.1| PREDICTED: SUMO-activating enzyme subunit 2 [Prunus mume]
Length=642

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 127/191 (66%), Gaps = 31/191 (16%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G+ALLYEVGDDLDE+MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C
Sbjct  465  MSLPLIMHGSALLYEVGDDLDEEMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWT--PVLASENNNKTTHDNGASSSTASQTAPLDANED  360
             INIKHREEFDEEK+PDGMVLSGWT  P +  ++N     ++ A++ + S   P++A ++
Sbjct  525  QINIKHREEFDEEKEPDGMVLSGWTQAPSVVKDDN-----ESIANAGSTSNEPPVEAEKN  579

Query  359  DDLEILPTGTAISPGKKRKLCDT----------------NPDRKVEELDDDGDGFVTLDG  228
            D++E       I P KKR+L +                 NPD K++ LDDD +  +  + 
Sbjct  580  DEIE-------IPPEKKRRLSEVSEAVDPDLSSVDGDTRNPD-KLQVLDDDDELMIFDNW  631

Query  227  NSDGSKKQRVQ  195
            +S  +KK+R+Q
Sbjct  632  DSVPNKKKRMQ  642



>ref|XP_007199741.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
 gb|EMJ00940.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
Length=642

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 121/189 (64%), Gaps = 27/189 (14%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I +G+ALLYE+GDDLDE+MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C
Sbjct  465  MSLPLIMHGSALLYEIGDDLDEEMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGMVLSGWT   +   ++K +  N  S+S       ++A ++D+
Sbjct  525  QINIKHREEFDEEKEPDGMVLSGWTQAPSVVKDDKESIANAGSTSNEPS---VEAEKNDE  581

Query  353  LEILPTGTAISPGKKRKLCDT----------------NPDRKVEELDDDGDGFVTLDGNS  222
            +E       I P KKRKL +                 NPD K++ LDDD +  +  + +S
Sbjct  582  IE-------IPPEKKRKLSEISEAVYPDLSSVDGDTRNPD-KLQVLDDDDELMIFDNWDS  633

Query  221  DGSKKQRVQ  195
               KK R+Q
Sbjct  634  VTDKKIRMQ  642



>ref|XP_003541605.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
 gb|KHN37632.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=638

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 122/182 (67%), Gaps = 19/182 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I   + LLYE GD +++ MV  Y ANL+K L EL  PV GGT++ VED+QQE  C
Sbjct  465  MNLPLIMCASNLLYEAGD-VEDDMVAIYEANLEKALAELPSPVTGGTMLTVEDMQQEFVC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGAS+S A  TA +++ +DD
Sbjct  524  NINIKHREEFDEEKEPDGMVLSGWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDD  581

Query  356  DLEILPTGTAISPGKKRKLCD---------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
            ++      T +S  KKRKL D          + ++K  E+ +D D  V LDG+SD  KK+
Sbjct  582  EI------TIVSTLKKRKLPDESDISNSAAESKNQKQLEVIEDEDDLVMLDGDSDSVKKR  635

Query  203  RV  198
            R+
Sbjct  636  RL  637



>gb|KDO49455.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=622

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            +N P I +G+ LLYEVGDDLDE  V NYAANL+KVL +L  PV  GT++ VEDLQQELTC
Sbjct  433  INFPLIMHGSNLLYEVGDDLDEVEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTC  492

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHD-----NGASSSTASQTAPLDA  369
            NINIKHREEFDEEK+PDGM+LSGWT    ++++ ++ +D     NG  SS A QT P DA
Sbjct  493  NINIKHREEFDEEKEPDGMLLSGWTQAPPAKDDKQSMNDKQSIGNGGDSSNALQTEPADA  552

Query  368  NEDDDLEILPTGTAISPGKKRKLCD  294
             +D ++E +   +    GKKRKL +
Sbjct  553  VKDGEMEEISEPS----GKKRKLSE  573



>gb|KDO49456.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=652

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            +N P I +G+ LLYEVGDDLDE  V NYAANL+KVL +L  PV  GT++ VEDLQQELTC
Sbjct  463  INFPLIMHGSNLLYEVGDDLDEVEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHD-----NGASSSTASQTAPLDA  369
            NINIKHREEFDEEK+PDGM+LSGWT    ++++ ++ +D     NG  SS A QT P DA
Sbjct  523  NINIKHREEFDEEKEPDGMLLSGWTQAPPAKDDKQSMNDKQSIGNGGDSSNALQTEPADA  582

Query  368  NEDDDLEILPTGTAISPGKKRKLCD  294
             +D ++E +   +    GKKRKL +
Sbjct  583  VKDGEMEEISEPS----GKKRKLSE  603



>ref|XP_006487357.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Citrus sinensis]
Length=651

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 9/145 (6%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            +N P I +G+ LLYEVGDDLDE  V NYAANL+KVL +L  PV  GT++ VEDLQQELTC
Sbjct  464  INFPLIMHGSNLLYEVGDDLDEVEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHD-----NGASSSTASQTAPLDA  369
            NINIKHREEFDEEK+PDGM+LSGWT    ++++ ++ +D     NG  SS A QT P DA
Sbjct  524  NINIKHREEFDEEKEPDGMLLSGWTQAPPAKDDKQSMNDKQSIGNGGDSSNALQTEPADA  583

Query  368  NEDDDLEILPTGTAISPGKKRKLCD  294
             +D ++E +   +    GKKRKL +
Sbjct  584  VKDGEMEEISEPS----GKKRKLSE  604



>ref|XP_002306122.2| hypothetical protein POPTR_0004s166302g, partial [Populus trichocarpa]
 gb|EEE86633.2| hypothetical protein POPTR_0004s166302g, partial [Populus trichocarpa]
Length=589

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +  ALLYEVGDDL+E  + NY ANL+KVL EL PPV  GT++ VEDLQQE TC
Sbjct  401  MNSPLIMHATALLYEVGDDLEENEIANYTANLEKVLSELPPPVIDGTVLTVEDLQQEFTC  460

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI+IKHREEFDEEK+PDGMVLSGWT     + + KT+  NGAS+S +  T       D++
Sbjct  461  NIHIKHREEFDEEKEPDGMVLSGWTQAPPEKKDGKTSIGNGASTSKSLPTKLGITEIDNE  520

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELDD  258
            ++ +  GT +SPG KRKL + +    V++  D
Sbjct  521  VKEISDGT-VSPGMKRKLSEFSDGSTVDQSSD  551



>ref|XP_004150065.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cucumis sativus]
 gb|KGN61828.1| hypothetical protein Csa_2G249830 [Cucumis sativus]
Length=641

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 111/172 (65%), Gaps = 23/172 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GAALLYEVGDDLDE MV NY ANL+KVL EL  PV  GTI++VEDLQQEL+C
Sbjct  465  MNFPLIMHGAALLYEVGDDLDEDMVANYTANLEKVLSELPSPVVSGTILSVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHR+EFDEEK+PDGMVLSGW      +++   T  NG S+S    +AP DA++ DD
Sbjct  525  SINIKHRDEFDEEKEPDGMVLSGWQQTPLEKDDCNKTLGNGESTSKTLPSAP-DADKYDD  583

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  198
             ++      ++ G+KRKL                D  V + G ++ SKK  V
Sbjct  584  SDM------VASGRKRKL----------------DEAVNISGEANSSKKPEV  613



>ref|XP_004165550.1| PREDICTED: LOW QUALITY PROTEIN: SUMO-activating enzyme subunit 
2-like [Cucumis sativus]
Length=641

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 111/172 (65%), Gaps = 23/172 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GAALLYEVGDDLDE MV NY ANL+KVL EL  PV  GTI++VEDLQQEL+C
Sbjct  465  MNFPLIMHGAALLYEVGDDLDEDMVANYTANLEKVLSELPSPVVSGTILSVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHR+EFDEEK+PDGMVLSGW      +++   T  NG S+S    +AP DA++ DD
Sbjct  525  SINIKHRDEFDEEKEPDGMVLSGWQQTPLEKDDCNKTLGNGESTSKTLPSAP-DADKYDD  583

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  198
             ++      ++ G+KRKL                D  V + G ++ SKK  V
Sbjct  584  SDM------VASGRKRKL----------------DEAVNISGEANSSKKPEV  613



>ref|XP_003540521.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
Length=636

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 121/182 (66%), Gaps = 19/182 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I   + LLYE GD +++ M+  Y ANL+K L EL  PV GGT++ VED+QQE  C
Sbjct  463  MNLPLIMCASNLLYEAGD-VEDDMIAIYEANLEKALAELPSPVTGGTMLTVEDMQQEFVC  521

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGAS+S A  TA +++ +DD
Sbjct  522  NINIKHREEFDEEKEPDGMVLSGWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDD  579

Query  356  DLEILPTGTAISPGKKRKLCDTN---------PDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
            ++      T +S  KKRKL D +          ++K  E+ DD D  V LDG+ +  KK+
Sbjct  580  EI------TIVSALKKRKLPDESDISNSAAEAKNQKQLEVIDDEDDLVMLDGDLNSVKKR  633

Query  203  RV  198
            R+
Sbjct  634  RL  635



>gb|KHN19464.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=636

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 121/182 (66%), Gaps = 19/182 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I   + LLYE GD +++ M+  Y ANL+K L EL  PV GGT++ VED+QQE  C
Sbjct  463  MNLPLIMCASNLLYEAGD-VEDDMIAIYEANLEKALAELPSPVTGGTMLTVEDMQQEFVC  521

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGAS+S A  TA +++ +DD
Sbjct  522  NINIKHREEFDEEKEPDGMVLSGWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDD  579

Query  356  DLEILPTGTAISPGKKRKLCDTN---------PDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
            ++      T +S  KKRKL D +          ++K  E+ DD D  V LDG+ +  KK+
Sbjct  580  EI------TIVSTLKKRKLPDESDISNSAAEAKNQKQLEVIDDEDDLVMLDGDLNSVKKR  633

Query  203  RV  198
            R+
Sbjct  634  RL  635



>ref|XP_008460981.1| PREDICTED: SUMO-activating enzyme subunit 2 [Cucumis melo]
Length=641

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 111/172 (65%), Gaps = 23/172 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GAALLYEVGDDLDE MV NY ANL+KVL EL  PV  GTI++VEDLQQEL+C
Sbjct  465  MNFPLIMHGAALLYEVGDDLDEDMVANYTANLEKVLSELPSPVVSGTILSVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHR+EF+EEK+PDGMVLSGW      +++   T  NG S+S    +AP DA++ DD
Sbjct  525  SINIKHRDEFNEEKEPDGMVLSGWQQTPLEKDDCSKTLGNGESTSKTLPSAP-DADKYDD  583

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  198
             ++      ++ G+KRKL                D  V + G ++ SKK  V
Sbjct  584  SDM------VASGRKRKL----------------DEAVNISGEANSSKKPEV  613



>ref|XP_004510996.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cicer arietinum]
Length=628

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 119/182 (65%), Gaps = 28/182 (15%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+LP I N + LLYE GD +++ MV  Y ANL+KVL EL  PV GGT++ VED QQEL C
Sbjct  464  MSLPLIMNASNLLYEAGD-IEDDMVAIYNANLEKVLAELPSPVTGGTMLTVEDFQQELKC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGA++S          + +D
Sbjct  523  NINIKHREEFDEEKEPDGMVLSGWTQPVSAAENEDKSV-SNGANTS----------DNND  571

Query  356  DLEILPTGTAISPGKKRKLCD-------TNPDRKVEELD--DDGDGFVTLDGNSDGSKKQ  204
            ++ I      +SP KKRKL D       T+  R  ++L   DD D  V LDG+ DG KK+
Sbjct  572  EIGI------VSPLKKRKLPDDSDKSNTTDDARHNKQLQVIDDEDDLVMLDGDLDGFKKR  625

Query  203  RV  198
            RV
Sbjct  626  RV  627



>ref|XP_009347844.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=571

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 104/149 (70%), Gaps = 15/149 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M LP I +G+ALLYEVGDDLDE MV NYAANLDKVL E   PV  GT++ +ED QQEL+C
Sbjct  392  MGLPLIMHGSALLYEVGDDLDEDMVANYAANLDKVLSEFPTPVTSGTMLTIEDFQQELSC  451

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLA-SENNNKTTHDNGASSSTASQTAPLDANEDD  357
             INIKHREEFDEEK+PDGMVLSGWT   A ++++ K+T + G+SS+ +S   P    + D
Sbjct  452  KINIKHREEFDEEKEPDGMVLSGWTQAPAVAQDDKKSTANAGSSSNASSSMEP---EKTD  508

Query  356  DLEILPTGTAISPGKKRKLCD----TNPD  282
            D+E        +P KKRKL D     NPD
Sbjct  509  DIE-------TTPEKKRKLSDLSESANPD  530



>ref|XP_007133804.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
 gb|ESW05798.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
Length=642

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 121/186 (65%), Gaps = 24/186 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN+P I   + LLYE GD +++ M+  Y +NL+KVL EL  PV GGT++ VED+QQE  C
Sbjct  466  MNIPLIMCASNLLYEAGD-VEDDMIAIYESNLEKVLAELPSPVTGGTMLTVEDMQQEFVC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PD MVLSGW  PV A+EN +K+   NG S+S A+ TA +++ +DD
Sbjct  525  NINIKHREEFDEEKEPDEMVLSGWIQPVSAAENKDKSV-GNGGSTSDAAVTA-VESEKDD  582

Query  356  DLEILPTGTAISPGKKRKL-------------CDTNPDRKVEELDDDGDGFVTLDGNSDG  216
            ++      T +S  KKRKL              DT   +++E +DD+ D  V LDG+ D 
Sbjct  583  EI------TIVSTLKKRKLPDETDISSATTADADTKHQKQLEVIDDE-DDLVMLDGDLDS  635

Query  215  SKKQRV  198
             KK+R+
Sbjct  636  FKKRRL  641



>ref|XP_009347843.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=644

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 104/149 (70%), Gaps = 15/149 (10%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M LP I +G+ALLYEVGDDLDE MV NYAANLDKVL E   PV  GT++ +ED QQEL+C
Sbjct  465  MGLPLIMHGSALLYEVGDDLDEDMVANYAANLDKVLSEFPTPVTSGTMLTIEDFQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLA-SENNNKTTHDNGASSSTASQTAPLDANEDD  357
             INIKHREEFDEEK+PDGMVLSGWT   A ++++ K+T + G+SS+ +S   P    + D
Sbjct  525  KINIKHREEFDEEKEPDGMVLSGWTQAPAVAQDDKKSTANAGSSSNASSSMEP---EKTD  581

Query  356  DLEILPTGTAISPGKKRKLCD----TNPD  282
            D+E        +P KKRKL D     NPD
Sbjct  582  DIE-------TTPEKKRKLSDLSESANPD  603



>ref|XP_010107832.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
 gb|EXC17232.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
Length=601

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 100/145 (69%), Gaps = 11/145 (8%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I +G  +LYE GDDLDE ++ +YAA  DKVL EL  PV GGT++ V DL QEL C
Sbjct  424  MSSPSIMHGTEILYETGDDLDEDLLASYAAKADKVLSELNCPVVGGTMLTVNDLYQELRC  483

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLAS-ENNNKTTHDNGASSSTASQTAPLDANEDD  357
            NINIKHREEFDEEK+PDG+VLSGWT   +S ENN   + DN  S+S  S    ++A ++D
Sbjct  484  NINIKHREEFDEEKEPDGIVLSGWTQAPSSVENNGTKSVDNAGSTSEGST---MEAEKND  540

Query  356  DLEILPTGTAISPGKKRKLCDTNPD  282
            ++EI+       PGKKRKL + + D
Sbjct  541  EIEIV-------PGKKRKLSEVSED  558



>ref|XP_010942467.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Elaeis guineensis]
Length=644

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 118/193 (61%), Gaps = 32/193 (17%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ L++E GDDL+E +  NYA NLDK L EL PPV  GT++ VEDL+QEL+C
Sbjct  464  MNLPLIMHGSTLIFEAGDDLEEDVAANYALNLDKALAELPPPVTSGTVLTVEDLRQELSC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGMVLSGW  V  +E + +    NG S+STA       A + D+
Sbjct  524  NINIKHREEFDEEKEPDGMVLSGW--VTPTEKDTRVV-SNGESTSTAQL-----AEKSDE  575

Query  353  LEILPTGTAISPGKKRKLC----------DTNPDRKV--------EELDDDG--DGFVTL  234
            +E  P  +    G KRKL           DT P   +        +E++D+G  D  V L
Sbjct  576  VETAPDRS----GTKRKLSEMSEMMDNIHDTKPCSSLDIGDQLNPQEVEDNGDDDDIVVL  631

Query  233  DGNSDGSKKQRVQ  195
            D +   SK++++Q
Sbjct  632  DESPGPSKRKKLQ  644



>ref|XP_008357172.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Malus domestica]
Length=644

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 9/142 (6%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M LP I +G+ALLYEVGDDLDE MV NYAANLDKVL EL  PV  GT++ +ED  QEL+C
Sbjct  465  MGLPLIMHGSALLYEVGDDLDEDMVANYAANLDKVLSELPTPVTSGTMLTIEDFLQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGMVLSGWT   A   ++K +     + S++S ++ ++  + DD
Sbjct  525  KINIKHREEFDEEKEPDGMVLSGWTQAPAVAQDDKKS--TANAGSSSSASSSMEPEKTDD  582

Query  353  LEILPTGTAISPGKKRKLCDTN  288
            +E        +PGKKRKL + +
Sbjct  583  IE-------TTPGKKRKLSEVS  597



>ref|XP_010429058.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=625

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 114/177 (64%), Gaps = 20/177 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKPLSELPSPIVNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFD+EK+P+GMVLSGWT V A+         NG S+ST++   P D  E   
Sbjct  525  KINVKHREEFDDEKEPEGMVLSGWTQVPAT---------NGESASTSNNEKPADVTESS-  574

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  195
                 +G+  +  KKR+L +  P    ++ E ++ D D  + ++     SKK+ RV+
Sbjct  575  -----SGSE-TASKKRRLSEIEPSNHKKETENVESDDDDIMEVENPMIVSKKKIRVE  625



>gb|KJB32552.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=632

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 113/187 (60%), Gaps = 15/187 (8%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  GA++LYEVG+DL+E MV  YAANL+K L EL  PV  G+++ VEDLQQE +C
Sbjct  446  MNFPLIMQGASILYEVGEDLEEDMVAIYAANLEKALSELPSPVTSGSVLTVEDLQQEFSC  505

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PDGM+LSGW      ++NNK   ++ ++S+       L+  +DD+
Sbjct  506  SINIKHREEFDEEKEPDGMLLSGWVEAPVDKDNNKPIGNDESTSNALPSGETLEGEKDDE  565

Query  353  LEILPTGTAISPGKKRKLCD----TNPD-----------RKVEELDDDGDGFVTLDGNSD  219
            ++          GKKRKL +    T PD            K  ++DD+ D  +  D    
Sbjct  566  IQETSEVVEAFTGKKRKLSEVSEVTAPDPSGPSSINQNKPKKLDIDDEADELIISDDWES  625

Query  218  GSKKQRV  198
             +KK+++
Sbjct  626  LTKKKKL  632



>gb|KJB32553.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=648

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 113/187 (60%), Gaps = 15/187 (8%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  GA++LYEVG+DL+E MV  YAANL+K L EL  PV  G+++ VEDLQQE +C
Sbjct  462  MNFPLIMQGASILYEVGEDLEEDMVAIYAANLEKALSELPSPVTSGSVLTVEDLQQEFSC  521

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PDGM+LSGW      ++NNK   ++ ++S+       L+  +DD+
Sbjct  522  SINIKHREEFDEEKEPDGMLLSGWVEAPVDKDNNKPIGNDESTSNALPSGETLEGEKDDE  581

Query  353  LEILPTGTAISPGKKRKLCD----TNPD-----------RKVEELDDDGDGFVTLDGNSD  219
            ++          GKKRKL +    T PD            K  ++DD+ D  +  D    
Sbjct  582  IQETSEVVEAFTGKKRKLSEVSEVTAPDPSGPSSINQNKPKKLDIDDEADELIISDDWES  641

Query  218  GSKKQRV  198
             +KK+++
Sbjct  642  LTKKKKL  648



>gb|KHG12220.1| SUMO-activating enzyme subunit 2 -like protein [Gossypium arboreum]
Length=620

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  GA++LYEVG+DL+E MV  YAANL+K L EL  PV  G+++ VEDLQQE +C
Sbjct  434  MNFPLIMQGASILYEVGEDLEEDMVVIYAANLEKALSELPSPVASGSVLTVEDLQQEFSC  493

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PDGM+LSGW      ++NNK   ++ ++S+       L+  +DD+
Sbjct  494  SINIKHREEFDEEKEPDGMLLSGWVEAPVDKDNNKPIGNDESTSNALPSMETLEGEKDDE  553

Query  353  LEILPTGTAISPGKKRKLCDTN  288
            ++          GKKRKL + +
Sbjct  554  IQETSEVVEAFSGKKRKLSEVS  575



>gb|KHG16253.1| SUMO-activating enzyme subunit 2 -like protein [Gossypium arboreum]
Length=623

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 4/144 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GA+++YE+G+DL+E MV  YAANL++ L EL  PV  GT++ +EDLQQE +C
Sbjct  434  MNFPVIMSGASIIYEIGEDLEEDMVAIYAANLERALSELPSPVISGTVLTIEDLQQEFSC  493

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEE++PDGM+LSGW      +NNNK+   NG S+S+A     +   E  D
Sbjct  494  RINIKHREEFDEEREPDGMLLSGWVEAPVDKNNNKSI-GNGESTSSALSMEEIQEGE-KD  551

Query  353  LEILPTGTAIS--PGKKRKLCDTN  288
            +EI  T  +     GKKRKL + +
Sbjct  552  VEIQGTSESAENVTGKKRKLSEVS  575



>ref|XP_010690827.1| PREDICTED: SUMO-activating enzyme subunit 2 [Beta vulgaris subsp. 
vulgaris]
Length=643

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 108/187 (58%), Gaps = 22/187 (12%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G +L+YEVGDDLDE    NY ANL+KVL EL  PV GGT + VEDLQQEL+C
Sbjct  463  MNLPMVMTGHSLIYEVGDDLDEDEKRNYEANLEKVLSELPSPVTGGTTIVVEDLQQELSC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIK REEFDEEK+PDGMVL GW+    S   N T   NG S+S  ++   LD  E  +
Sbjct  523  EINIKQREEFDEEKEPDGMVLIGWSQAPTSTEKNGTVQ-NGESTSGTAEVMHLDIAEVGE  581

Query  353  LEILPTGTAISPGKKRKLC--------------DTNPDRKVEELDDDGDGFVTLDG-NSD  219
             E      A +  KKRK                D     K   L+DDGD  + L+  NS+
Sbjct  582  AE------ANTASKKRKSSDPSNSSGFHPTSGNDIRSKNKEVILEDDGDDLIVLENLNSE  635

Query  218  GSKKQRV  198
             +KK+R+
Sbjct  636  PAKKKRL  642



>ref|XP_007042097.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
 gb|EOX97928.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
Length=649

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I  GA++LYEVG+DL+E MV  YAANL+K L EL  PV  GT++ VEDLQQE + 
Sbjct  461  MNFPLIMQGASILYEVGEDLEEDMVAIYAANLEKALSELPSPVTSGTVLTVEDLQQEFSR  520

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGM+LSGW      ++ NK   +  ++S+       L+A +D  
Sbjct  521  NINIKHREEFDEEKEPDGMLLSGWVEPPVDKDKNKPIGNGESTSNALPAEESLEAKKDVT  580

Query  353  LEILPTGTAISPGKKRKLCD----TNPDR  279
            ++ +   T I+ G KRKL +    T PD 
Sbjct  581  IQEISEVTEIATGTKRKLSEVSKGTTPDH  609



>gb|KDP41752.1| hypothetical protein JCGZ_26770 [Jatropha curcas]
Length=628

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 108/190 (57%), Gaps = 43/190 (23%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G+ LLYEVGDDL+E M  NY ANL+KVL EL   + GGT++ VEDLQQE TC
Sbjct  465  MNSPLIMHGSTLLYEVGDDLEEDMEANYTANLEKVLFELPSSITGGTMLTVEDLQQEFTC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANED--  360
            NI+IKHREEFDEEK+PDGMVL GWT                         APL+  ED  
Sbjct  525  NIHIKHREEFDEEKEPDGMVLFGWT------------------------QAPLEKKEDSK  560

Query  359  ---DDLEILPTGTAISPGKKRKLCD---------TNPDRKVEEL---DDDGDGFVTLDGN  225
               +D+EI   GT IS GKKRK  D         +N   KV++L   DD+ D  + LD  
Sbjct  561  PAGNDVEI-SEGTEIS-GKKRKQPDMDVSTVSDESNNHNKVQKLNVVDDEDDDLIVLDHR  618

Query  224  SDGSKKQRVQ  195
              G  K  +Q
Sbjct  619  DIGCSKNSLQ  628



>ref|XP_008777003.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Phoenix 
dactylifera]
Length=536

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 111/195 (57%), Gaps = 29/195 (15%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G+ L++E GDDL+E +  NYA N+DK L EL  PV  GT++ VEDL+QEL+C
Sbjct  349  MNSPMIMHGSTLIFEAGDDLEEDVAANYALNIDKALAELPAPVTSGTVLTVEDLRQELSC  408

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDG+VL+GW   +A    +     NG S+STA       A   D+
Sbjct  409  NINIKHREEFDEEKEPDGLVLAGW---IAPTQKDTRLVSNGESTSTAHPAVAEMAENSDE  465

Query  353  LEILPTGTAISPGKKRKLCD----------------------TNPDRKVEELDDDGDGFV  240
            + I P      PG KRKL +                       NP    ++ DDDGD  V
Sbjct  466  VGIAPA----KPGTKRKLSEMSEIIDNVHDITPRSSRDVNDQVNPQEVEDDDDDDGDDIV  521

Query  239  TLDGNSDGSKKQRVQ  195
             LD N +  KK+R+Q
Sbjct  522  ILDENPETRKKKRLQ  536



>gb|KJB47535.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=621

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GA+++YEVG+DL+E MV  YAANL+K L EL  PV  GT++ VEDLQQE +C
Sbjct  432  MNFPVIMSGASIIYEVGEDLEEDMVAIYAANLEKALSELPSPVISGTVLTVEDLQQEFSC  491

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGM+LSG       +N+NK    NG S+S+A  T  +   E  D
Sbjct  492  RINIKHREEFDEEKEPDGMLLSGRVEAPVDKNSNKPI-GNGESTSSALSTEEIQEGE-RD  549

Query  353  LEILPTGTAIS--PGKKRKLCDTN  288
            +EI  T  +     GKKRKL + +
Sbjct  550  VEIQETSESAENVTGKKRKLSEVS  573



>gb|KJB47538.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=593

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GA+++YEVG+DL+E MV  YAANL+K L EL  PV  GT++ VEDLQQE +C
Sbjct  404  MNFPVIMSGASIIYEVGEDLEEDMVAIYAANLEKALSELPSPVISGTVLTVEDLQQEFSC  463

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGM+LSG       +N+NK    NG S+S+A  T  +   E  D
Sbjct  464  RINIKHREEFDEEKEPDGMLLSGRVEAPVDKNSNKPI-GNGESTSSALSTEEIQEGE-RD  521

Query  353  LEILPTGTAIS--PGKKRKLCDTN  288
            +EI  T  +     GKKRKL + +
Sbjct  522  VEIQETSESAENVTGKKRKLSEVS  545



>ref|XP_008777005.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
Length=655

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 111/195 (57%), Gaps = 29/195 (15%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G+ L++E GDDL+E +  NYA N+DK L EL  PV  GT++ VEDL+QEL+C
Sbjct  468  MNSPMIMHGSTLIFEAGDDLEEDVAANYALNIDKALAELPAPVTSGTVLTVEDLRQELSC  527

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDG+VL+GW   +A    +     NG S+STA       A   D+
Sbjct  528  NINIKHREEFDEEKEPDGLVLAGW---IAPTQKDTRLVSNGESTSTAHPAVAEMAENSDE  584

Query  353  LEILPTGTAISPGKKRKLCD----------------------TNPDRKVEELDDDGDGFV  240
            + I P      PG KRKL +                       NP    ++ DDDGD  V
Sbjct  585  VGIAPA----KPGTKRKLSEMSEIIDNVHDITPRSSRDVNDQVNPQEVEDDDDDDGDDIV  640

Query  239  TLDGNSDGSKKQRVQ  195
             LD N +  KK+R+Q
Sbjct  641  ILDENPETRKKKRLQ  655



>gb|KJB47537.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=651

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +GA+++YEVG+DL+E MV  YAANL+K L EL  PV  GT++ VEDLQQE +C
Sbjct  462  MNFPVIMSGASIIYEVGEDLEEDMVAIYAANLEKALSELPSPVISGTVLTVEDLQQEFSC  521

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+PDGM+LSG       +N+NK    NG S+S+A  T  +   E  D
Sbjct  522  RINIKHREEFDEEKEPDGMLLSGRVEAPVDKNSNKPI-GNGESTSSALSTEEIQEGE-RD  579

Query  353  LEILPTGTAIS--PGKKRKLCDTN  288
            +EI  T  +     GKKRKL + +
Sbjct  580  VEIQETSESAENVTGKKRKLSEVS  603



>ref|XP_008777001.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008777002.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
Length=538

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 112/197 (57%), Gaps = 31/197 (16%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKV--LCELRPPVNGGTIVNVEDLQQEL  540
            MN P I +G+ L++E GDDL+E +  NYA N+DKV  L EL  PV  GT++ VEDL+QEL
Sbjct  349  MNSPMIMHGSTLIFEAGDDLEEDVAANYALNIDKVMALAELPAPVTSGTVLTVEDLRQEL  408

Query  539  TCNINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANED  360
            +CNINIKHREEFDEEK+PDG+VL+GW   +A    +     NG S+STA       A   
Sbjct  409  SCNINIKHREEFDEEKEPDGLVLAGW---IAPTQKDTRLVSNGESTSTAHPAVAEMAENS  465

Query  359  DDLEILPTGTAISPGKKRKLCD----------------------TNPDRKVEELDDDGDG  246
            D++ I P      PG KRKL +                       NP    ++ DDDGD 
Sbjct  466  DEVGIAPA----KPGTKRKLSEMSEIIDNVHDITPRSSRDVNDQVNPQEVEDDDDDDGDD  521

Query  245  FVTLDGNSDGSKKQRVQ  195
             V LD N +  KK+R+Q
Sbjct  522  IVILDENPETRKKKRLQ  538



>ref|XP_008797038.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008775122.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Phoenix 
dactylifera]
Length=572

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 21/188 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ L++E GDDL+E +  NYA NLDK L EL  PV  GT++ VEDLQQEL+C
Sbjct  391  MNLPLIMHGSTLIFEAGDDLEEDVAANYALNLDKALAELPAPVTSGTVLTVEDLQQELSC  450

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGM+LSGW  V  +E + +    NG S+S A+Q A  + +++D 
Sbjct  451  NINIKHREEFDEEKEPDGMLLSGW--VAPTEKDARLV-SNGESTS-AAQLA--EKSDEDG  504

Query  353  LEILPTGTAISPGKKRKLCDTNPDRK---------------VEELDDDGDGFVTLDGNSD  219
            +    +GT     +  ++ D   D K               VE+ DDD D  V LD N  
Sbjct  505  IAPARSGTKRKQSEMSEMIDNIDDMKPCSSLDIGDQLNPQEVEDNDDDDDDIVMLDENPG  564

Query  218  GSKKQRVQ  195
             SK++++Q
Sbjct  565  PSKRKKLQ  572



>ref|XP_008797039.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008775123.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
Length=544

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 114/188 (61%), Gaps = 21/188 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ L++E GDDL+E +  NYA NLDK L EL  PV  GT++ VEDLQQEL+C
Sbjct  363  MNLPLIMHGSTLIFEAGDDLEEDVAANYALNLDKALAELPAPVTSGTVLTVEDLQQELSC  422

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGM+LSGW   +A    +     NG S+S A+Q A  + +++D 
Sbjct  423  NINIKHREEFDEEKEPDGMLLSGW---VAPTEKDARLVSNGESTS-AAQLA--EKSDEDG  476

Query  353  LEILPTGTAISPGKKRKLCDTNPDRK---------------VEELDDDGDGFVTLDGNSD  219
            +    +GT     +  ++ D   D K               VE+ DDD D  V LD N  
Sbjct  477  IAPARSGTKRKQSEMSEMIDNIDDMKPCSSLDIGDQLNPQEVEDNDDDDDDIVMLDENPG  536

Query  218  GSKKQRVQ  195
             SK++++Q
Sbjct  537  PSKRKKLQ  544



>ref|XP_008797037.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008775121.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
Length=645

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 21/188 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ L++E GDDL+E +  NYA NLDK L EL  PV  GT++ VEDLQQEL+C
Sbjct  464  MNLPLIMHGSTLIFEAGDDLEEDVAANYALNLDKALAELPAPVTSGTVLTVEDLQQELSC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGM+LSGW  V  +E + +    NG S+S A+Q A  + +++D 
Sbjct  524  NINIKHREEFDEEKEPDGMLLSGW--VAPTEKDARLV-SNGESTS-AAQLA--EKSDEDG  577

Query  353  LEILPTGTAISPGKKRKLCDTNPDRK---------------VEELDDDGDGFVTLDGNSD  219
            +    +GT     +  ++ D   D K               VE+ DDD D  V LD N  
Sbjct  578  IAPARSGTKRKQSEMSEMIDNIDDMKPCSSLDIGDQLNPQEVEDNDDDDDDIVMLDENPG  637

Query  218  GSKKQRVQ  195
             SK++++Q
Sbjct  638  PSKRKKLQ  645



>gb|EPS74543.1| hypothetical protein M569_00206 [Genlisea aurea]
Length=600

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 10/144 (7%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G++LLYE GDDL E  V +Y  NL+K+L EL  PV GGTI+ VEDLQQEL C
Sbjct  446  MNLPMIMHGSSLLYEAGDDLAEDEVAHYETNLEKILSELPCPVIGGTILTVEDLQQELKC  505

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            ++NIKHREEFDEEK+PDG++L GWT  +A+  + + +H+N     T++         DDD
Sbjct  506  SVNIKHREEFDEEKEPDGLILLGWTQPVAAPVDEQPSHENNGVKMTSA---------DDD  556

Query  353  LEILPTGTAISPGKKRKLCDTNPD  282
            + I+ +       KKRKL D + D
Sbjct  557  V-IVASPQPGGKKKKRKLSDESGD  579



>ref|XP_009399955.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 108/190 (57%), Gaps = 25/190 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I  GA L++E GDDL+E +  NYA NLDKVL  L  PV  G+++ VEDLQQEL+C
Sbjct  464  MSFPLIMQGAILIFEGGDDLEEDIAANYALNLDKVLTALPAPVTSGSMLTVEDLQQELSC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDEEK+PD MVL GWT    +         NG +++ A   +P   N+ ++
Sbjct  524  HINIKHREEFDEEKEPDRMVLLGWT----TPEKESQGVSNGENTAAAIPASPEAINKSEE  579

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELDDDGDG-----------------FVTLDGN  225
            +E+    TA     KRKL +    +++ ++  D D                   + LD N
Sbjct  580  VEV----TAEISRTKRKLSEMTEVQEIFQILPDTDANNSMDPQEVEDNDYDNDLIVLDEN  635

Query  224  SDGSKKQRVQ  195
             + SKK+R+Q
Sbjct  636  PEASKKRRLQ  645



>ref|XP_002512954.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
 gb|EEF49457.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
Length=644

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 4/152 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MN P I +G  LLYEVGDDL+E MV NY ANL+K L EL   V GG+++ VEDLQQE TC
Sbjct  465  MNSPLIMHGPTLLYEVGDDLEEDMVANYNANLEKALSELPSSVTGGSMLTVEDLQQEFTC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NI IKHREEFDEEK+PDGMVLSGW      +  +  +  NG S+   S T P +A +D +
Sbjct  525  NIYIKHREEFDEEKEPDGMVLSGWIQAPPEKKVDNNSIGNGGST---SNTLPTEAQQDIE  581

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELDD  258
            +E + +   I   KKRK  + + D  V+E ++
Sbjct  582  IEQI-SEEIIISEKKRKRPEVSTDTAVDETNN  612



>ref|XP_006838625.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
 gb|ERN01194.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
Length=652

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            +NLP I +G+ L++E GDDL+E MV NYA NL+K LC+L  PV  GT++ VED QQE TC
Sbjct  464  VNLPIIMHGSTLIFETGDDLEEDMVANYALNLEKALCDLPSPVTSGTVLTVEDFQQEFTC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANE-DD  357
            +INI HREEFD+EK+P+GMVL G TP L  + +   T +   S+S A Q  P   ++ DD
Sbjct  524  SINITHREEFDDEKEPEGMVLLGLTPDLYEKPSKVATTEE--STSMAPQEKPATVSDSDD  581

Query  356  DLEILPTGTA-ISPGKKRKLCDTN  288
            ++EI+    +    G KRKL +T+
Sbjct  582  EIEIVVLEESNRFAGSKRKLVETS  605



>ref|XP_010938778.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Elaeis 
guineensis]
Length=618

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I +G+ L++E GD L+E +V NYA  LDK L EL  PV  GT++ VEDL QE +C
Sbjct  433  MHSPLIMHGSTLIFEAGDGLEEDVVANYALILDKALAELPAPVTSGTVLTVEDLHQEFSC  492

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGMVL+GW   +A    +     NG S+S A         + DD
Sbjct  493  NINIKHREEFDEEKEPDGMVLAGW---IAPTQKDARIVSNGESTSAAHPAVTEMVEKSDD  549

Query  353  LEILPTGTAISPGKKRKLCDTN  288
            +EI        PG KRKL + +
Sbjct  550  VEIARE----KPGTKRKLSEMS  567



>ref|XP_006293831.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
 gb|EOA26729.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
Length=624

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 19/176 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+KVL EL  P+  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKVLSELPSPIVNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWTP  A+         NG S+ST++   P+D  E   
Sbjct  525  KINVKHREEFDEEKEPEGMVLSGWTPSPAT---------NGESASTSNNEIPVDVTESS-  574

Query  353  LEILPTGTAISPGKKRKLCDTNP---DRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  195
                 +G+  +  KKR+L +  P    ++ E ++ + D  + ++     SKK RV+
Sbjct  575  -----SGSE-TASKKRRLSEIEPCNHKKETENVESEDDDIMEIENPMIVSKKIRVE  624



>ref|XP_010938777.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Elaeis 
guineensis]
Length=631

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I +G+ L++E GD L+E +V NYA  LDK L EL  PV  GT++ VEDL QE +C
Sbjct  446  MHSPLIMHGSTLIFEAGDGLEEDVVANYALILDKALAELPAPVTSGTVLTVEDLHQEFSC  505

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGMVL+GW   +A    +     NG S+S A         + DD
Sbjct  506  NINIKHREEFDEEKEPDGMVLAGW---IAPTQKDARIVSNGESTSAAHPAVTEMVEKSDD  562

Query  353  LEILPTGTAISPGKKRKLCDTN  288
            +EI        PG KRKL + +
Sbjct  563  VEIARE----KPGTKRKLSEMS  580



>ref|XP_010938776.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Elaeis 
guineensis]
Length=648

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I +G+ L++E GD L+E +V NYA  LDK L EL  PV  GT++ VEDL QE +C
Sbjct  463  MHSPLIMHGSTLIFEAGDGLEEDVVANYALILDKALAELPAPVTSGTVLTVEDLHQEFSC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            NINIKHREEFDEEK+PDGMVL+GW   +A    +     NG S+S A         + DD
Sbjct  523  NINIKHREEFDEEKEPDGMVLAGW---IAPTQKDARIVSNGESTSAAHPAVTEMVEKSDD  579

Query  353  LEILPTGTAISPGKKRKLCDTN  288
            +EI        PG KRKL + +
Sbjct  580  VEIARE----KPGTKRKLSEMS  597



>gb|EMS58354.1| SUMO-activating enzyme subunit 2 [Triticum urartu]
Length=639

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 26/183 (14%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G+ L++E GD L+E    NYA NL+KVL EL  PV  GT + VED QQEL+C
Sbjct  473  MNLPLVMIGSTLVFEDGDGLEEDEAANYALNLEKVLAELPAPVINGTKLTVEDFQQELSC  532

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            +INIKHREEFDEEK+PDGMVLSGW+ PV    N+N    +N +++S++S  A  D  ED 
Sbjct  533  SINIKHREEFDEEKEPDGMVLSGWSAPVEKQINSNG---ENKSAASSSSAHATDDTVEDP  589

Query  356  DLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
                        PG KRKL         CD +   +V E DDD      LDGN    KK+
Sbjct  590  S----------KPGMKRKLDELLETKENCDASSSAQVVEDDDDC---TMLDGNPALIKKK  636

Query  203  RVQ  195
            R+Q
Sbjct  637  RLQ  639



>gb|EMT21367.1| SUMO-activating enzyme subunit 2 [Aegilops tauschii]
Length=629

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 111/183 (61%), Gaps = 26/183 (14%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G+ L++E GD L+E    NYA NL+KVL EL  PV  GT + VED QQEL+C
Sbjct  463  MNLPLVMIGSTLVFEDGDGLEEDEAANYALNLEKVLAELPAPVINGTKLTVEDFQQELSC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            +INIKHREEFDEEK+PDGMVLSGW+ PV    N+N    +N +++S++S  A  D  ED 
Sbjct  523  SINIKHREEFDEEKEPDGMVLSGWSAPVEKQINSNG---ENKSAASSSSARATDDTVED-  578

Query  356  DLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
                 P+     PG KRKL         CD +   +V E DDD      LDGN    KK+
Sbjct  579  -----PS----KPGMKRKLDELLETKENCDASSSAQVVEDDDDC---TMLDGNPALIKKK  626

Query  203  RVQ  195
            R+Q
Sbjct  627  RLQ  629



>ref|XP_009140282.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=627

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 116/176 (66%), Gaps = 20/176 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  467  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSC  526

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT   A+         NG S+ST++  + +D  E   
Sbjct  527  KINVKHREEFDEEKEPEGMVLSGWTQSPAT---------NGESASTSNNESAVDVTESS-  576

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELD-DDGDGFVTLDGNSDGSKKQRV  198
                 +G  I+  KKRKL +T P+   R+ E ++ +D D  V ++     SKK+RV
Sbjct  577  -----SGPEIA-SKKRKLSETQPENHKRETENVESEDDDDLVEIENPMTVSKKKRV  626



>emb|CDY15890.1| BnaA04g12210D [Brassica napus]
Length=627

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 116/176 (66%), Gaps = 20/176 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  467  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSC  526

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT   A+         NG S+ST++  + +D  E   
Sbjct  527  KINVKHREEFDEEKEPEGMVLSGWTQSPAT---------NGESASTSNNESAVDVTESS-  576

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELD-DDGDGFVTLDGNSDGSKKQRV  198
                 +G  I+  KKRKL +T P+   R+ E ++ +D D  V ++     SKK+RV
Sbjct  577  -----SGPEIA-SKKRKLSETQPENHKRETENVESEDDDDLVEIENPMTVSKKKRV  626



>ref|XP_009412808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412809.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412810.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 92/140 (66%), Gaps = 8/140 (6%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I  GA L++EVGDDL+E +  NYA NLDKVL EL  PV+ GT++ VEDLQQEL+C
Sbjct  463  MSFPLIMQGATLIFEVGDDLEEDVAANYALNLDKVLVELPTPVSSGTMLTVEDLQQELSC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
            +INIKHREEFDE+K+PD MVL GWT   A E  ++    NG S+S A   A     + ++
Sbjct  523  HINIKHREEFDEDKEPDKMVLLGWT---AREKESQVV-SNGNSTSAAVPAAAEATMKSEE  578

Query  353  LEILPTGTAISPGKKRKLCD  294
             E+     A   G KRKL +
Sbjct  579  AEV----NAEISGTKRKLSE  594



>ref|XP_010416892.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=624

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 113/176 (64%), Gaps = 19/176 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKPLSELPSPIVNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT V A+         NG S+ST++   P D  E   
Sbjct  525  KINVKHREEFDEEKEPEGMVLSGWTQVPAT---------NGESASTSNNEKPADVTESS-  574

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  195
                 +G+  +  KKR+L +  P    ++ E ++ D D  + ++     SKK RV+
Sbjct  575  -----SGSE-TASKKRRLSEIEPSNHKKETENVESDDDDIMEVENPMIVSKKIRVE  624



>ref|XP_010236228.1| PREDICTED: SUMO-activating enzyme subunit 2 [Brachypodium distachyon]
Length=623

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 106/187 (57%), Gaps = 37/187 (20%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G+ L++E GD L+E    NYA NL+KVL EL  PV  GT + VED QQEL+C
Sbjct  460  MNLPLVMIGSTLVFEDGDGLEEDEAANYALNLEKVLAELPAPVINGTKLTVEDFQQELSC  519

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNG----ASSSTASQTAPLDA  369
            +INIKHREEFDEEK+PDGMVLSGW+ PV       K    NG    ASSS+A  T   DA
Sbjct  520  SINIKHREEFDEEKEPDGMVLSGWSAPV------EKQVTSNGGKLAASSSSAHDTVG-DA  572

Query  368  NEDDDLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDG  216
            + +             PG KRKL         CD +   +V E DDD    + LD +   
Sbjct  573  SAN-------------PGTKRKLDEVLESKENCDASSSAQVIEDDDDT---IMLDEDPTL  616

Query  215  SKKQRVQ  195
             KK+R Q
Sbjct  617  LKKKRSQ  623



>ref|XP_010472141.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=628

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 20/177 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  468  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKPLSELPSPIVNGSILTVEDLQQELSC  527

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT V A+         NG S+ST++   P+D  E   
Sbjct  528  KINVKHREEFDEEKEPEGMVLSGWTQVPAT---------NGESASTSNNEKPVDVTESS-  577

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  195
                 +G+  +  KKR+L +  P    ++ E ++ D D  + ++     SKK+ RV+
Sbjct  578  -----SGSE-TASKKRRLSEIEPSNHKKETENVESDDDDIMEVENPMIASKKKIRVE  628



>emb|CDX99589.1| BnaC04g33460D [Brassica napus]
Length=629

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 20/176 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY +NL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  469  MNLPLIMHGASLLYEVGDDLDDIMVANYNSNLEKSLSELPSPVINGSILTVEDLQQELSC  528

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT   A++         G S+ST++  + ++  E   
Sbjct  529  KINVKHREEFDEEKEPEGMVLSGWTQSPATK---------GESASTSNNESAVEVTESS-  578

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELD-DDGDGFVTLDGNSDGSKKQRV  198
                 +G  I+  KKRKL +T P+   R+ E ++ +D D  + ++     SKK+RV
Sbjct  579  -----SGPEIA-SKKRKLSETQPENHKRETENVESEDDDDLMEIENPMTVSKKKRV  628



>gb|KFK32895.1| hypothetical protein AALP_AA6G302000 [Arabis alpina]
Length=624

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 113/174 (65%), Gaps = 19/174 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKYLSELPSPVVNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+ MVLSGWT   A+         NG ++ST++    +D  E   
Sbjct  525  KINVKHREEFDEEKEPEEMVLSGWTQSPAT---------NGDNASTSNNENAIDVTESSS  575

Query  353  LEILPTGTAISPGKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  201
            +  +PT       KKR+L +  P+   +++E+++ + D  + ++     SKK++
Sbjct  576  VAEIPT-------KKRRLSEFQPENHKKEIEKVESEDDDLMEIENPMVMSKKKK  622



>tpg|DAA41263.1| TPA: hypothetical protein ZEAMMB73_736183 [Zea mays]
Length=236

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 111/194 (57%), Gaps = 37/194 (19%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I  GA L++E G+DL+E  + NYA NL+KVL EL  PV  GT+V VEDL QEL C
Sbjct  59   MNLPLIMVGATLVFEDGEDLEEDEIANYALNLEKVLAELPAPVLNGTMVTVEDLHQELKC  118

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSS--TASQTAPLDANE  363
            +INIKHR+EFDEEK+PD MVL GW+ PV      +K T  NG + S  ++S T  +D   
Sbjct  119  SINIKHRDEFDEEKEPDRMVLVGWSGPV------DKQTTSNGETKSVPSSSNTEDVDGTA  172

Query  362  DDDLEILPTGTAISPGKKRKL------------------CDTNPDRKVEELDDDGDGFVT  237
            +D         + + G KRKL                   D++  + VE  DD+ DG + 
Sbjct  173  ED--------ISATSGMKRKLNEILETKENFDALENLSGVDSSSAQVVE--DDNDDGLLM  222

Query  236  LDGNSDGSKKQRVQ  195
             D +   SKK+R+Q
Sbjct  223  FDEDPRQSKKKRLQ  236



>ref|XP_006657898.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Oryza brachyantha]
Length=613

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 106/183 (58%), Gaps = 23/183 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G+ L++E GD L+E    NYA NL+K+L EL  PV  GT + VED QQE +C
Sbjct  444  MNLPLVMIGSTLVFEDGDGLEEDEAANYALNLEKILAELPAPVINGTKITVEDFQQEFSC  503

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            +INIKHR+EFD EK+PDGMVLSGW+ PV       K    NG + S AS +       D 
Sbjct  504  SINIKHRDEFDAEKEPDGMVLSGWSAPV------EKQVTSNGGNQSVASSSG--TDYPDG  555

Query  356  DLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  204
             +E + T     PG KRKL         CD +   +V E DDD D  V LD +   +KK+
Sbjct  556  IVEDMST----KPGMKRKLDEILESKENCDASSSAQVVE-DDDDDDIVMLDEDPKLAKKK  610

Query  203  RVQ  195
            R+Q
Sbjct  611  RLQ  613



>emb|CDX82033.1| BnaC08g35680D [Brassica napus]
Length=628

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 23/177 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  466  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSC  525

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT   A+         NG S+ST        +N++++
Sbjct  526  KINVKHREEFDEEKEPEGMVLSGWTQSPAT---------NGESAST--------SNDENE  568

Query  353  LEILPTGTAISP---GKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  201
              +  T ++  P    KKR+L +T P+   +K E ++ D D  + ++     SKK++
Sbjct  569  KAVDVTESSSGPEMASKKRRLSETQPENDKKKTENVESDDDELMEIENPVMVSKKKK  625



>ref|NP_179742.2| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 dbj|BAC42380.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|ACI31306.1| At2g21470 [Arabidopsis thaliana]
 gb|AEC07181.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=625

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 22/178 (12%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGNSLLYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWTP  A+         NG S+ST++   P+D  E   
Sbjct  525  KINVKHREEFDEEKEPEGMVLSGWTPSPAT---------NGESASTSNNENPVDVTE---  572

Query  353  LEILPTGTAISPG-KKRKLCDT---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  195
                 + +   P  KKR+L +T   N  ++ E ++ + D  + ++     SKK+ RV+
Sbjct  573  -----SSSGSEPASKKRRLSETEASNHKKETENVESEDDDIMEVENPMMVSKKKIRVE  625



>ref|NP_001189570.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 gb|AEC07183.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=628

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 22/178 (12%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  468  MNLPLIMHGNSLLYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSC  527

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWTP  A+         NG S+ST++   P+D  E   
Sbjct  528  KINVKHREEFDEEKEPEGMVLSGWTPSPAT---------NGESASTSNNENPVDVTE---  575

Query  353  LEILPTGTAISPG-KKRKLCDT---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  195
                 + +   P  KKR+L +T   N  ++ E ++ + D  + ++     SKK+ RV+
Sbjct  576  -----SSSGSEPASKKRRLSETEASNHKKETENVESEDDDIMEVENPMMVSKKKIRVE  628



>ref|XP_006404595.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
 gb|ESQ46048.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
Length=626

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 112/175 (64%), Gaps = 20/175 (11%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKHLSELPSPVVNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             INIKHREEFDEEK+P+GMVLSGWT   A+         NG S+ST++    +DA +   
Sbjct  525  KINIKHREEFDEEKEPEGMVLSGWTQSPAT---------NGESASTSNNENAIDATDSS-  574

Query  353  LEILPTGTAISPGKKRKLCDTNPDRKVEELD----DDGDGFVTLDGNSDGSKKQR  201
                 +G  I   KKR+L +T P+   +E +    ++ D  V ++     SKK++
Sbjct  575  -----SGPEIV-TKKRRLSETKPENHKKEAENVESEEDDDLVEIENPMMVSKKKK  623



>ref|XP_010531451.1| PREDICTED: SUMO-activating enzyme subunit 2 [Tarenaya hassleriana]
Length=647

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 114/189 (60%), Gaps = 26/189 (14%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLDE MV NY ANL+KVL EL  P+  G+I+ VEDLQQEL+C
Sbjct  469  MNLPLIMHGTSLLYEVGDDLDEAMVANYNANLEKVLSELPSPIVSGSILTVEDLQQELSC  528

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVL GW+   A+         NG SSST++   P   N  + 
Sbjct  529  KINVKHREEFDEEKEPEGMVLYGWSESPAA---------NGESSSTSTARPPDSENAIEA  579

Query  353  LEILPTGTAISPGKKRKL-----CDTNPDRKVEE----------LD-DDGDGFVTLDGNS  222
             E   +   I+ GKKRKL      +TN  +K  E          +D DD D  V  D + 
Sbjct  580  PE-SSSRPEIATGKKRKLTEETEMETNNQKKPPENNTSFSMEKGIDIDDEDIVVVEDPDI  638

Query  221  DGSKKQRVQ  195
              SKK+R Q
Sbjct  639  VVSKKKRAQ  647



>emb|CDY13814.1| BnaA09g43160D [Brassica napus]
Length=630

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 23/177 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  468  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSC  527

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT   A+         NG S+ST        +N +++
Sbjct  528  KINVKHREEFDEEKEPEGMVLSGWTQSPAT---------NGESAST--------SNNENE  570

Query  353  LEILPTGTAISP---GKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  201
              +  T ++  P    KKR+L +T P+   ++ E ++ D D  + ++     SKK++
Sbjct  571  KAVDVTESSSGPEMASKKRRLSETQPENDKKETENVESDDDEIMEIENPVMVSKKKK  627



>ref|XP_009117402.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=630

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 23/177 (13%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +GA+LLYEVGDDLD+ MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C
Sbjct  468  MNLPLIMHGASLLYEVGDDLDDIMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSC  527

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWT   A+         NG S+ST        +N +++
Sbjct  528  KINVKHREEFDEEKEPEGMVLSGWTQSPAT---------NGESAST--------SNNENE  570

Query  353  LEILPTGTAISP---GKKRKLCDTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  201
              +  T ++  P    KKR+L +T P+   ++ E ++ D D  + ++     SKK++
Sbjct  571  KAVDVTESSSGPEMASKKRRLSETQPENDKKETENVESDDDEIMEIENPVMVSKKKK  627



>ref|XP_008670523.1| PREDICTED: SUMO-activating enzyme subunit 2 [Zea mays]
Length=671

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 111/194 (57%), Gaps = 37/194 (19%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I  GA L++E G+DL+E  + NYA NL+KVL EL  PV  GT+V VEDL QEL C
Sbjct  494  MNLPLIMVGATLVFEDGEDLEEDEIANYALNLEKVLAELPAPVLNGTMVTVEDLHQELKC  553

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSS--TASQTAPLDANE  363
            +INIKHR+EFDEEK+PD MVL GW+ PV      +K T  NG + S  ++S T  +D   
Sbjct  554  SINIKHRDEFDEEKEPDRMVLVGWSGPV------DKQTTSNGETKSVPSSSNTEDVDGTA  607

Query  362  DDDLEILPTGTAISPGKKRKL------------------CDTNPDRKVEELDDDGDGFVT  237
            +D         + + G KRKL                   D++  + VE  DD+ DG + 
Sbjct  608  ED--------ISATSGMKRKLNEILETKENFDALENLSGVDSSSAQVVE--DDNDDGLLM  657

Query  236  LDGNSDGSKKQRVQ  195
             D +   SKK+R+Q
Sbjct  658  FDEDPRQSKKKRLQ  671



>dbj|BAD95040.1| ubiquitin activating enzyme like protein [Arabidopsis thaliana]
Length=149

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 105/166 (63%), Gaps = 22/166 (13%)
 Frame = -1

Query  677  LYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDE  498
            LYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDE
Sbjct  1    LYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHREEFDE  60

Query  497  EKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISP  318
            EK+P+GMVLSGWTP  A+         NG S+ST++   P+D  E        + +   P
Sbjct  61   EKEPEGMVLSGWTPSPAT---------NGESASTSNNENPVDVTE--------SSSGSEP  103

Query  317  G-KKRKLCDT---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  195
              +KR+L +T   N  ++ E ++ + D  + ++     SKK+ RV+
Sbjct  104  ASRKRRLSETEASNHKKETENVESEDDDIMEVENPMMVSKKKIRVE  149



>ref|XP_002460940.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
 gb|EER97461.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
Length=641

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 88/139 (63%), Gaps = 13/139 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I  GA L++E G+DL+E  + NYA NL+KVL EL  PV  GT + VED  QEL C
Sbjct  464  MNLPLIMVGATLVFEDGEDLEEDEIANYALNLEKVLAELPAPVLNGTTLTVEDFHQELKC  523

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            +INIKHR+EFDEEK+PDGMVL+GW+ PV    +   T++    S  ++S T  +D   +D
Sbjct  524  SINIKHRDEFDEEKEPDGMVLAGWSGPV----DKQITSNGENRSVPSSSNTEDVDGTAED  579

Query  356  DLEILPTGTAISPGKKRKL  300
                     +  PG KRKL
Sbjct  580  --------ISAKPGMKRKL  590



>ref|XP_002992493.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ06431.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 83/134 (62%), Gaps = 13/134 (10%)
 Frame = -1

Query  704  PXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNIN  525
            P I +G +LL+E GDDL ++ ++ Y +N +KVL EL  PV  G +++VEDLQQE  C+I+
Sbjct  453  PVIMHGTSLLFETGDDLGKEEIQLYTSNSEKVLAELPTPVTNGGVLSVEDLQQEFKCSIH  512

Query  524  IKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEI  345
            I+HR+ FDEEK+PDGMVL GW+  +A +  +K           A+  A  +  +DDD+  
Sbjct  513  IRHRDNFDEEKEPDGMVLIGWSSSVAEQEKDK-------GKPIAAPAASAEVIDDDDI--  563

Query  344  LPTGTAISPGKKRK  303
                T I P  K++
Sbjct  564  ----TLIEPAAKKR  573



>gb|EEE67493.1| hypothetical protein OsJ_24922 [Oryza sativa Japonica Group]
Length=634

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 87/139 (63%), Gaps = 13/139 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G+ L++E G+ L+E    NYA NL+KVL EL  PV   T + VED QQEL+C
Sbjct  465  MNLPLVMIGSTLVFEDGEGLEEDEAANYALNLEKVLAELPAPVVNDTKLTVEDFQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            +INIKHR+EFDEEK+PDGMVLSGW+ PV       K    NG + S AS +    A  D 
Sbjct  525  SINIKHRDEFDEEKEPDGMVLSGWSAPV------EKQVTSNGGNQSVASSSGADYA--DG  576

Query  356  DLEILPTGTAISPGKKRKL  300
             +E + T     PG KRKL
Sbjct  577  IVEDIST----KPGMKRKL  591



>gb|EEC82353.1| hypothetical protein OsI_26664 [Oryza sativa Indica Group]
Length=634

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 87/139 (63%), Gaps = 13/139 (9%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  G+ L++E G+ L+E    NYA NL+KVL EL  PV   T + VED QQEL+C
Sbjct  465  MNLPLVMIGSTLVFEDGEGLEEDEAANYALNLEKVLAELPAPVVNDTKLTVEDFQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  357
            +INIKHR+EFDEEK+PDGMVLSGW+ PV       K    NG + S AS +    A  D 
Sbjct  525  SINIKHRDEFDEEKEPDGMVLSGWSAPV------EKQVTSNGGNQSVASSSGADYA--DG  576

Query  356  DLEILPTGTAISPGKKRKL  300
             +E + T     PG KRKL
Sbjct  577  IVEDIST----KPGMKRKL  591



>ref|XP_004958165.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Setaria italica]
Length=638

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP +  GA L++E G+ L+    ENYA NLDKVL EL  PV   T + VED QQEL C
Sbjct  463  MNLPLVMVGATLVFEDGEGLEPDEAENYALNLDKVLAELPAPVVNDTKLTVEDFQQELKC  522

Query  533  NINIKHREEFDEEKDPDGMVLSGWT  459
            +INIK R+EFD+EK+PDGMVL+GWT
Sbjct  523  SINIKQRDEFDKEKEPDGMVLAGWT  547



>ref|XP_002990197.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ08757.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -1

Query  704  PXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNIN  525
            P I +G +LL+E GDDL ++ ++ Y +N +KVL EL  PV  G +++VEDLQQE  C+I+
Sbjct  453  PVIMHGTSLLFETGDDLGKEEIQLYTSNSEKVLAELPTPVTNGGVLSVEDLQQEFKCSIH  512

Query  524  IKHREEFDEEKDPDGMVLSGWTPVLASENNNK  429
            I+HR+ FDEEK+PDGMVL GW+  +A +  +K
Sbjct  513  IRHRDNFDEEKEPDGMVLIGWSSSVAEQEKDK  544



>gb|KCW64020.1| hypothetical protein EUGRSUZ_G016992, partial [Eucalyptus grandis]
Length=521

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G+ALLYEVGDDL+E MV NYAANL+KVL EL  PV  GT++ VEDLQQELTC
Sbjct  423  MNLPLIMHGSALLYEVGDDLEEDMVTNYAANLEKVLSELPSPVTSGTLLTVEDLQQELTC  482

Query  533  NINIKHR  513
            NI+IKHR
Sbjct  483  NISIKHR  489



>gb|AAN03851.1| SUMO activating enzyme 2 [Arabidopsis thaliana]
Length=599

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 107/178 (60%), Gaps = 30/178 (17%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLD+ MV          L EL  P+  G+I+ VEDLQQEL+C
Sbjct  447  MNLPLIMHGNSLLYEVGDDLDDIMV--------AYLSELPSPILNGSILTVEDLQQELSC  498

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  354
             IN+KHREEFDEEK+P+GMVLSGWTP  A+         NG S+ST++   P+D  E   
Sbjct  499  KINVKHREEFDEEKEPEGMVLSGWTPSPAT---------NGESASTSNNENPVDVTE---  546

Query  353  LEILPTGTAISPG-KKRKLCDT---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  195
                 + +   P  KKR+L +T   N  ++ E ++ + D  + ++     SKK+ RV+
Sbjct  547  -----SSSGSEPASKKRRLSETEASNHKKETENVESEDDDIMEVENPMMVSKKKIRVE  599



>ref|XP_006423380.1| hypothetical protein CICLE_v100281692mg, partial [Citrus clementina]
 gb|ESR36620.1| hypothetical protein CICLE_v100281692mg, partial [Citrus clementina]
Length=360

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            +N P I +G+ LLYEVGDDLDE  V NYAANL+KVL +L  PV  GT++ VEDLQQELTC
Sbjct  287  INFPLIMHGSNLLYEVGDDLDEVEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTC  346

Query  533  NINIKHR  513
            NINIKHR
Sbjct  347  NINIKHR  353



>ref|NP_973506.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 sp|Q9SJT1.1|SAE2_ARATH RecName: Full=SUMO-activating enzyme subunit 2; AltName: Full=Protein 
EMBRYO DEFECTIVE 2764; AltName: Full=Ubiquitin-like 
1-activating enzyme E1B [Arabidopsis thaliana]
 gb|AAD23691.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|AEC07182.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=700

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  465  MNLPLIMHGNSLLYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSC  524

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTH  420
             IN+KHR  F E  +P  ++ S W  ++      K  H
Sbjct  525  KINVKHR-FFSEILNP--VLNSVWFLIILPSTFPKLFH  559



>emb|CAD67688.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
Length=657

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  422  MNLPLIMHGNSLLYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSC  481

Query  533  NINIKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTH  420
             IN+KHR  F E  +P  ++ S W  ++      K  H
Sbjct  482  KINVKHR-FFSEILNP--VLNSVWFLIILPSTFPKLFH  516



>ref|XP_001775802.1| predicted protein [Physcomitrella patens]
 gb|EDQ59341.1| predicted protein, partial [Physcomitrella patens]
Length=618

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = -1

Query  704  PXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNIN  525
            P I   + LL+E GDD++E MV  Y   LDK   +   P+  G ++ +ED  Q+  C+++
Sbjct  468  PVIMQSSTLLHEAGDDIEEDMVAYYTTLLDKKFQDYPTPITTGVVLTIEDYHQDFRCSLH  527

Query  524  IKHREEFDEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDAN------E  363
            +KHRE FD+EK+P+GMVLSG    LAS N  +T     A+ ST++  A L A       E
Sbjct  528  VKHRETFDQEKEPEGMVLSG---DLASLNTTET-----AAESTSTLNASLKAENGHTEVE  579

Query  362  DDDLEILPTG-TAISPGKKRKL  300
            DDD+ ++     A + G KR++
Sbjct  580  DDDVVMVELAPKAATAGTKRRI  601



>ref|XP_002878554.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54813.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
Length=678

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            MNLP I +G +LLYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C
Sbjct  454  MNLPLIMHGNSLLYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSC  513

Query  533  NINIKHR  513
             IN+KHR
Sbjct  514  KINVKHR  520



>ref|XP_009399956.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=555

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  534
            M+ P I  GA L++E GDDL+E +  NYA NLDKVL  L  PV  G+++ VEDLQQEL+C
Sbjct  464  MSFPLIMQGAILIFEGGDDLEEDIAANYALNLDKVLTALPAPVTSGSMLTVEDLQQELSC  523

Query  533  NINIKHR  513
            +INIKHR
Sbjct  524  HINIKHR  530



>ref|XP_003078790.1| SUMO activating enzyme 2 (ISS), partial [Ostreococcus tauri]
Length=540

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPP--VNGGTIVNVEDLQQEL  540
            ++ P +  G++ ++E GDDLDE  VE+Y A LDK      P   V  GTI+ V+D  QE 
Sbjct  400  VHAPSVMFGSSQIHETGDDLDEDEVEHYEA-LDKRTLSALPGGGVVNGTILAVDDFSQEF  458

Query  539  TCNINIKHREEFDEEKDPDGMVLSG  465
            T  + + HREE+DEE DPDG ++ G
Sbjct  459  TFELMVTHREEWDEENDPDGFIIRG  483



>emb|CEF97583.1| Molybdenum cofactor biosynthesis, MoeB [Ostreococcus tauri]
Length=582

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPP--VNGGTIVNVEDLQQEL  540
            ++ P +  G++ ++E GDDLDE  VE+Y A LDK      P   V  GTI+ V+D  QE 
Sbjct  442  VHAPSVMFGSSQIHETGDDLDEDEVEHYEA-LDKRTLSALPGGGVVNGTILAVDDFSQEF  500

Query  539  TCNINIKHREEFDEEKDPDGMVLSG  465
            T  + + HREE+DEE DPDG ++ G
Sbjct  501  TFELMVTHREEWDEENDPDGFIIRG  525



>ref|XP_001762389.1| predicted protein [Physcomitrella patens]
 gb|EDQ72856.1| predicted protein [Physcomitrella patens]
Length=524

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -1

Query  704  PXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNIN  525
            P I  GA LL+E G+D++E MV  Y A LDK   +   P+  G ++ VED  Q+  C+++
Sbjct  451  PVIMQGATLLHEAGEDIEEDMVAYYRALLDKKFVDYPTPITTGVVLTVEDYHQDFRCSLH  510

Query  524  IKHREE  507
            +KHRE 
Sbjct  511  VKHRER  516



>ref|XP_001417248.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95541.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=518

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 13/90 (14%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAA----NLDKVLCELRPPVNG---GTIVNVED  555
            +N P +  G  LL+E G+DLDE  VE+YA+     LDK+      P  G   GTI+ +ED
Sbjct  435  VNEPTVQFGGNLLHETGEDLDEDEVEHYASLDPRTLDKL------PGGGVVNGTILLIED  488

Query  554  LQQELTCNINIKHREEFDEEKDPDGMVLSG  465
              Q+    + + HRE++D+EK+PDG ++ G
Sbjct  489  YSQDFKFELMVTHREDWDDEKEPDGFIVRG  518



>ref|XP_007042099.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
 gb|EOX97930.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
Length=578

 Score = 52.8 bits (125),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVLCEL  597
            MN P I  GA++LYEVG+DL+E MV  YAANL+K+L  L
Sbjct  461  MNFPLIMQGASILYEVGEDLEEDMVAIYAANLEKLLVGL  499


 Score = 32.3 bits (72),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  559  RIFSRSLPAISTLNIGKSLMRRRIPMAWFYRDGLQFWRVKTTIRQHMTTGQVRLLLPKLP  380
            RIFSRS  AIS  +IGK+LMRRR  M  F  DGL    ++T I          +L  +  
Sbjct  504  RIFSRSSHAISISSIGKNLMRRRNLMECFSLDGLNLLLIRTRISLLEMVKVHPMLYQQRR  563

Query  379  LWMPTRMTTWKFFQ  338
            +W P R   ++ FQ
Sbjct  564  VWRPRRTLQFRKFQ  577



>ref|XP_007042098.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
 gb|EOX97929.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
Length=525

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKVL  606
            MN P I  GA++LYEVG+DL+E MV  YAANL+KV 
Sbjct  461  MNFPLIMQGASILYEVGEDLEEDMVAIYAANLEKVF  496



>gb|KJB32554.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=523

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKV  609
            MN P I  GA++LYEVG+DL+E MV  YAANL+KV
Sbjct  462  MNFPLIMQGASILYEVGEDLEEDMVAIYAANLEKV  496



>gb|KJB47539.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
 gb|KJB47541.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=539

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKV  609
            MN P I +GA+++YEVG+DL+E MV  YAANL+KV
Sbjct  462  MNFPVIMSGASIIYEVGEDLEEDMVAIYAANLEKV  496



>gb|KDO49457.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=563

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  713  MNLPXIXNGAALLYEVGDDLDEKMVENYAANLDKV  609
            +N P I +G+ LLYEVGDDLDE  V NYAANL+KV
Sbjct  463  INFPLIMHGSNLLYEVGDDLDEVEVANYAANLEKV  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380