BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF017A16

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN78777.1|  hypothetical protein VITISV_029751                   81.6    3e-14   Vitis vinifera
emb|CBI19264.3|  unnamed protein product                              80.9    7e-14   Vitis vinifera
ref|XP_010664405.1|  PREDICTED: probable ubiquitin-like-specific ...  81.3    7e-14   Vitis vinifera
ref|XP_010664404.1|  PREDICTED: probable ubiquitin-like-specific ...  81.3    7e-14   Vitis vinifera
emb|CDP19104.1|  unnamed protein product                              80.9    9e-14   Coffea canephora [robusta coffee]
ref|XP_009777668.1|  PREDICTED: probable ubiquitin-like-specific ...  69.3    5e-10   Nicotiana sylvestris
ref|XP_009777670.1|  PREDICTED: probable ubiquitin-like-specific ...  68.9    6e-10   Nicotiana sylvestris
ref|XP_009777667.1|  PREDICTED: probable ubiquitin-like-specific ...  68.9    6e-10   Nicotiana sylvestris
ref|XP_009777669.1|  PREDICTED: probable ubiquitin-like-specific ...  68.9    7e-10   Nicotiana sylvestris
ref|XP_009629816.1|  PREDICTED: probable ubiquitin-like-specific ...  67.8    1e-09   Nicotiana tomentosiformis
ref|XP_009629819.1|  PREDICTED: probable ubiquitin-like-specific ...  67.8    1e-09   Nicotiana tomentosiformis
ref|XP_009629818.1|  PREDICTED: probable ubiquitin-like-specific ...  67.8    2e-09   Nicotiana tomentosiformis
ref|XP_009629817.1|  PREDICTED: probable ubiquitin-like-specific ...  67.8    2e-09   Nicotiana tomentosiformis
ref|XP_009629815.1|  PREDICTED: probable ubiquitin-like-specific ...  67.8    2e-09   Nicotiana tomentosiformis
ref|XP_010312819.1|  PREDICTED: probable ubiquitin-like-specific ...  56.2    1e-05   
ref|XP_004250369.1|  PREDICTED: probable ubiquitin-like-specific ...  55.8    1e-05   Solanum lycopersicum
ref|XP_010312818.1|  PREDICTED: probable ubiquitin-like-specific ...  55.8    1e-05   Solanum lycopersicum
ref|XP_010312817.1|  PREDICTED: probable ubiquitin-like-specific ...  55.8    1e-05   Solanum lycopersicum
ref|XP_006351167.1|  PREDICTED: uncharacterized protein LOC102593146  52.8    4e-05   
ref|XP_006351213.1|  PREDICTED: probable ubiquitin-like-specific ...  53.5    9e-05   Solanum tuberosum [potatoes]



>emb|CAN78777.1| hypothetical protein VITISV_029751 [Vitis vinifera]
Length=540

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 103/223 (46%), Gaps = 35/223 (16%)
 Frame = -2

Query  754  TGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGSSPA  575
            TG   VY  S  TG   L  ++ EA    YSSRD  ++ASW P   V  A  E + SSP 
Sbjct  328  TGEQFVYLPSCETGLQRLAGISHEARAVQYSSRDFRADASWNPGTSVEQAGHEEVDSSPE  387

Query  574  TICHDQND-LEVGVD-GKCMA--VGEESLDCVDQLASTVEENTECFTESLPAATSNMMFD  407
            T      D LEVGVD G  +   +    ++  D+  S   ENTECFT+ L  A+   +  
Sbjct  388  TSTGTSEDSLEVGVDNGNTVRDDMDPSQIEKTDEPGSPSMENTECFTQGLACASGEFLEI  447

Query  406  VAAEPQNGVEPHSQSGIVDSL--------SASQNLTELSQIEFHD------NTNIVSRNL  269
             AAE          +G +D+         S  +N   L    FH+      N +I  +++
Sbjct  448  SAAESSQ------DTGKLDNCNEREAPLPSYEENPLRL----FHEKSDIEGNRDITCKDV  497

Query  268  DAIN----SDVVVQHAAKKMRLMTPV---EREVELNLSNDLHL  161
              I+    SD   Q A+K++RL  P    ER++  +LS DLHL
Sbjct  498  QMIDHDLESDPDEQPASKRLRLTPPPYEGERKLNRSLSKDLHL  540



>emb|CBI19264.3| unnamed protein product [Vitis vinifera]
Length=617

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 103/223 (46%), Gaps = 35/223 (16%)
 Frame = -2

Query  754  TGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGSSPA  575
            TG   VY  S  TG   L  ++ EA    YSSRD  ++ASW P   V  A  E + SSP 
Sbjct  405  TGEQFVYLPSCETGLQRLAGISHEARAVQYSSRDFRADASWNPGTSVEQAGHEEVDSSPE  464

Query  574  TICHDQND-LEVGVD-GKCMA--VGEESLDCVDQLASTVEENTECFTESLPAATSNMMFD  407
            T      D LEVGVD G  +   +    ++  D+  S   ENTECFT+ L  A+   +  
Sbjct  465  TSTGTSEDSLEVGVDNGNTVRDDMDPSQIEKTDEPGSPSMENTECFTQGLACASGEFLEI  524

Query  406  VAAEPQNGVEPHSQSGIVDSL--------SASQNLTELSQIEFHD------NTNIVSRNL  269
             AAE          +G +D+         S  +N   L    FH+      N +I  +++
Sbjct  525  SAAESSQ------DTGKLDNCNEREAPLPSYEENPLRL----FHEKSDIEGNRDITCKDV  574

Query  268  DAIN----SDVVVQHAAKKMRLMTPV---EREVELNLSNDLHL  161
              I+    SD   Q A+K++RL  P    ER++  +LS DLHL
Sbjct  575  QMIDHDLESDPDEQPASKRLRLTPPPYEGERKLNRSLSKDLHL  617



>ref|XP_010664405.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Vitis vinifera]
Length=944

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 102/219 (47%), Gaps = 27/219 (12%)
 Frame = -2

Query  754  TGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGSSPA  575
            TG   VY  S  TG   L  ++ EA    YSSRD  ++ASW P   V  A  E + SSP 
Sbjct  732  TGEQFVYLPSCETGLQRLAGISHEARAVQYSSRDFRADASWNPGTSVEQAGHEEVDSSPE  791

Query  574  TICHDQND-LEVGVD-GKCMA--VGEESLDCVDQLASTVEENTECFTESLPAATSNMMFD  407
            T      D LEVGVD G  +   +    ++  D+  S   ENTECFT+ L  A+   +  
Sbjct  792  TSTGTSEDSLEVGVDNGNTVRDDMDPSQIEKTDEPGSPSMENTECFTQGLACASGEFLEI  851

Query  406  VAAEPQNGVEPHSQSGIVDSL--------SASQNLTEL--SQIEFHDNTNIVSRNLDAIN  257
             AAE          +G +D+         S  +N   L   + +   N +I  +++  I+
Sbjct  852  SAAESSQ------DTGKLDNCNEREAPLPSYEENPLRLFHEKSDIEGNRDITCKDVQMID  905

Query  256  ----SDVVVQHAAKKMRLMTPV---EREVELNLSNDLHL  161
                SD   Q A+K++RL  P    ER++  +LS DLHL
Sbjct  906  HDLESDPDEQPASKRLRLTPPPYEGERKLNRSLSKDLHL  944



>ref|XP_010664404.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Vitis vinifera]
Length=945

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 102/219 (47%), Gaps = 27/219 (12%)
 Frame = -2

Query  754  TGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGSSPA  575
            TG   VY  S  TG   L  ++ EA    YSSRD  ++ASW P   V  A  E + SSP 
Sbjct  733  TGEQFVYLPSCETGLQRLAGISHEARAVQYSSRDFRADASWNPGTSVEQAGHEEVDSSPE  792

Query  574  TICHDQND-LEVGVD-GKCMA--VGEESLDCVDQLASTVEENTECFTESLPAATSNMMFD  407
            T      D LEVGVD G  +   +    ++  D+  S   ENTECFT+ L  A+   +  
Sbjct  793  TSTGTSEDSLEVGVDNGNTVRDDMDPSQIEKTDEPGSPSMENTECFTQGLACASGEFLEI  852

Query  406  VAAEPQNGVEPHSQSGIVDSL--------SASQNLTEL--SQIEFHDNTNIVSRNLDAIN  257
             AAE          +G +D+         S  +N   L   + +   N +I  +++  I+
Sbjct  853  SAAESSQ------DTGKLDNCNEREAPLPSYEENPLRLFHEKSDIEGNRDITCKDVQMID  906

Query  256  ----SDVVVQHAAKKMRLMTPV---EREVELNLSNDLHL  161
                SD   Q A+K++RL  P    ER++  +LS DLHL
Sbjct  907  HDLESDPDEQPASKRLRLTPPPYEGERKLNRSLSKDLHL  945



>emb|CDP19104.1| unnamed protein product [Coffea canephora]
Length=816

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 93/199 (47%), Gaps = 15/199 (8%)
 Frame = -2

Query  733  ASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGSSP-ATICHDQ  557
            AS    G   LG +++EA  +P  SRD  +E SW  ++P+H    E+  S P A+IC  +
Sbjct  625  ASLQEDGLQHLGGISTEACNYPCPSRDFKNEVSWDQEIPMHQTLQENHDSVPVASICGTE  684

Query  556  NDLEVGVDGKCMAVGEESLDCVDQLASTVEENTECFTESLPAATSNMMFDVAAEPQNGVE  377
              L+  VD       E S D    L +   EN +  T+ L +A SNM+    A+P++  +
Sbjct  685  TSLDGRVDENFQVTRELSFDNEGNLTNKSTENVQELTDRLASAQSNML--EIADPRSSFQ  742

Query  376  PHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAINSDVV-------VQHAAKKMR  218
               Q    D L A   +      E  +  N V RN    ++DV        V+HAAKK+R
Sbjct  743  SFDQHDNSDPLKACAKIL----YESFNGGNGVDRNGGTTSNDVDDLALESHVEHAAKKLR  798

Query  217  LMTPVEREVELNLSNDLHL  161
            L TP+  EV   L  D  L
Sbjct  799  L-TPISEEVTKGLPEDFCL  816



>ref|XP_009777668.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Nicotiana sylvestris]
Length=897

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 97/211 (46%), Gaps = 22/211 (10%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VYAS+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  699  EVEAREHLVYASTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  756

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP T  HD +N LEV V   C       S D ++   S    N +C  +    A S  + 
Sbjct  757  SPTTSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EAASGELL  814

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----NSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L  I     S+   
Sbjct  815  DITLA-QCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLIGSGPGSEADA  868

Query  241  QHAAKKMRLMTPVEREVEL----NLSNDLHL  161
            QH  K++RL TP++ E EL    NL +DLHL
Sbjct  869  QHNVKRIRL-TPLD-EGELACRSNLLDDLHL  897



>ref|XP_009777670.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X4 [Nicotiana sylvestris]
Length=892

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 97/211 (46%), Gaps = 22/211 (10%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VYAS+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  694  EVEAREHLVYASTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  751

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP T  HD +N LEV V   C       S D ++   S    N +C  +    A S  + 
Sbjct  752  SPTTSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EAASGELL  809

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----NSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L  I     S+   
Sbjct  810  DITLA-QCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLIGSGPGSEADA  863

Query  241  QHAAKKMRLMTPVEREVEL----NLSNDLHL  161
            QH  K++RL TP++ E EL    NL +DLHL
Sbjct  864  QHNVKRIRL-TPLD-EGELACRSNLLDDLHL  892



>ref|XP_009777667.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Nicotiana sylvestris]
Length=901

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 97/211 (46%), Gaps = 22/211 (10%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VYAS+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  703  EVEAREHLVYASTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  760

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP T  HD +N LEV V   C       S D ++   S    N +C  +    A S  + 
Sbjct  761  SPTTSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EAASGELL  818

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----NSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L  I     S+   
Sbjct  819  DITLA-QCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLIGSGPGSEADA  872

Query  241  QHAAKKMRLMTPVEREVEL----NLSNDLHL  161
            QH  K++RL TP++ E EL    NL +DLHL
Sbjct  873  QHNVKRIRL-TPLD-EGELACRSNLLDDLHL  901



>ref|XP_009777669.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X3 [Nicotiana sylvestris]
Length=896

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 97/211 (46%), Gaps = 22/211 (10%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VYAS+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  698  EVEAREHLVYASTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  755

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP T  HD +N LEV V   C       S D ++   S    N +C  +    A S  + 
Sbjct  756  SPTTSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EAASGELL  813

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----NSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L  I     S+   
Sbjct  814  DITLA-QCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLIGSGPGSEADA  867

Query  241  QHAAKKMRLMTPVEREVEL----NLSNDLHL  161
            QH  K++RL TP++ E EL    NL +DLHL
Sbjct  868  QHNVKRIRL-TPLD-EGELACRSNLLDDLHL  896



>ref|XP_009629816.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Nicotiana tomentosiformis]
Length=901

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 91/209 (44%), Gaps = 18/209 (9%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VY S+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  703  EVEARDHLVYTSTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  760

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP    HD +N LEV V   C       S D ++   S    N +C  +    ATS  + 
Sbjct  761  SPTNSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EATSGELL  818

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNL----DAINSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L        S+   
Sbjct  819  DITL-AQCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLMGSGPGSEADA  872

Query  241  QHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            QH  K++RL    E EV    NL +DLHL
Sbjct  873  QHNVKRIRLTPLDEGEVAFRSNLLDDLHL  901



>ref|XP_009629819.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X5 [Nicotiana tomentosiformis]
Length=892

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 91/209 (44%), Gaps = 18/209 (9%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VY S+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  694  EVEARDHLVYTSTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  751

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP    HD +N LEV V   C       S D ++   S    N +C  +    ATS  + 
Sbjct  752  SPTNSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EATSGELL  809

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNL----DAINSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L        S+   
Sbjct  810  DITL-AQCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLMGSGPGSEADA  863

Query  241  QHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            QH  K++RL    E EV    NL +DLHL
Sbjct  864  QHNVKRIRLTPLDEGEVAFRSNLLDDLHL  892



>ref|XP_009629818.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X4 [Nicotiana tomentosiformis]
Length=897

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 91/209 (44%), Gaps = 18/209 (9%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VY S+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  699  EVEARDHLVYTSTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  756

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP    HD +N LEV V   C       S D ++   S    N +C  +    ATS  + 
Sbjct  757  SPTNSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EATSGELL  814

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNL----DAINSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L        S+   
Sbjct  815  DITL-AQCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLMGSGPGSEADA  868

Query  241  QHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            QH  K++RL    E EV    NL +DLHL
Sbjct  869  QHNVKRIRLTPLDEGEVAFRSNLLDDLHL  897



>ref|XP_009629817.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X3 [Nicotiana tomentosiformis]
Length=901

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 91/209 (44%), Gaps = 18/209 (9%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VY S+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  703  EVEARDHLVYTSTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  760

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP    HD +N LEV V   C       S D ++   S    N +C  +    ATS  + 
Sbjct  761  SPTNSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EATSGELL  818

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNL----DAINSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L        S+   
Sbjct  819  DITL-AQCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLMGSGPGSEADA  872

Query  241  QHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            QH  K++RL    E EV    NL +DLHL
Sbjct  873  QHNVKRIRLTPLDEGEVAFRSNLLDDLHL  901



>ref|XP_009629815.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Nicotiana tomentosiformis]
Length=906

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 91/209 (44%), Gaps = 18/209 (9%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            EVE   + VY S+ T G   LG   SE     YSS  + +EASW P V V  A DE   S
Sbjct  708  EVEARDHLVYTSTET-GLQHLGGSGSEPCALSYSSGSLTAEASWIPGVSVVEAVDEE-DS  765

Query  583  SPATICHD-QNDLEVGVDGKCMA-VGEESLDCVDQLASTVEENTECFTESLPAATSNMMF  410
            SP    HD +N LEV V   C       S D ++   S    N +C  +    ATS  + 
Sbjct  766  SPTNSVHDSENPLEVEVVEPCRVDQNMNSDDKINHPKSASVNNIDCLVDG--EATSGELL  823

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNL----DAINSDVVV  242
            D+    Q   E H  S      S  +NL ++     H N N+  + L        S+   
Sbjct  824  DITL-AQCSAETHDNSDTGPVTSCQENLYDI-----HGNGNLACKRLLLMGSGPGSEADA  877

Query  241  QHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            QH  K++RL    E EV    NL +DLHL
Sbjct  878  QHNVKRIRLTPLDEGEVAFRSNLLDDLHL  906



>ref|XP_010312819.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X4 [Solanum lycopersicum]
Length=865

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 91/214 (43%), Gaps = 31/214 (14%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            E+E G +  Y ++       LG   SE   F YSS  + +  SW P V V    DE   S
Sbjct  670  EMEAGDHLAYTAT-DRDLLHLGGNGSEPCAFSYSSGSLVAGTSWIPDVSVVQDVDEQFDS  728

Query  583  SPATICHD-QNDLEVGVDGKCMAVGEESLDCVDQLASTVEE------NTECFTESLPAAT  425
            SP T   D +  LEV V           L  VDQ  ST E+      + +C  +    AT
Sbjct  729  SPTTSVRDTEKQLEVEV---------AELRKVDQNMSTDEKIDQPKSSIDCLVDG--HAT  777

Query  424  SNMMFDVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----N  257
               + D+    Q+ +E H  SG     S  +N  ++     H N N+  ++L  I     
Sbjct  778  PGELLDITLA-QSSIETHDNSGTGPVTSGQENPYDM-----HGNVNLACKSLLLIGNGSG  831

Query  256  SDVVVQHAAKKMRLMTPVEREVELN--LSNDLHL  161
            S+   +H  K+ RL T  + EV     +++DLHL
Sbjct  832  SEADAEHNVKRRRLTTLDDEEVAFRSSVTHDLHL  865



>ref|XP_004250369.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X3 [Solanum lycopersicum]
Length=889

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 92/214 (43%), Gaps = 31/214 (14%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            E+E G +  Y ++       LG   SE   F YSS  + +  SW P V V    DE   S
Sbjct  694  EMEAGDHLAYTAT-DRDLLHLGGNGSEPCAFSYSSGSLVAGTSWIPDVSVVQDVDEQFDS  752

Query  583  SPATICHD-QNDLEVGVDGKCMAVGEESLDCVDQLASTVEE------NTECFTESLPAAT  425
            SP T   D +  LEV V           L  VDQ  ST E+      + +C  +    AT
Sbjct  753  SPTTSVRDTEKQLEVEV---------AELRKVDQNMSTDEKIDQPKSSIDCLVDG--HAT  801

Query  424  SNMMFDVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----N  257
               + D+    Q+ +E H  SG     S  +N  ++     H N N+  ++L  I     
Sbjct  802  PGELLDITL-AQSSIETHDNSGTGPVTSGQENPYDM-----HGNVNLACKSLLLIGNGSG  855

Query  256  SDVVVQHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            S+   +H  K+ RL T  + EV    ++++DLHL
Sbjct  856  SEADAEHNVKRRRLTTLDDEEVAFRSSVTHDLHL  889



>ref|XP_010312818.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Solanum lycopersicum]
Length=890

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 92/214 (43%), Gaps = 31/214 (14%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            E+E G +  Y ++       LG   SE   F YSS  + +  SW P V V    DE   S
Sbjct  695  EMEAGDHLAYTAT-DRDLLHLGGNGSEPCAFSYSSGSLVAGTSWIPDVSVVQDVDEQFDS  753

Query  583  SPATICHD-QNDLEVGVDGKCMAVGEESLDCVDQLASTVEE------NTECFTESLPAAT  425
            SP T   D +  LEV V           L  VDQ  ST E+      + +C  +    AT
Sbjct  754  SPTTSVRDTEKQLEVEV---------AELRKVDQNMSTDEKIDQPKSSIDCLVDG--HAT  802

Query  424  SNMMFDVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----N  257
               + D+    Q+ +E H  SG     S  +N  ++     H N N+  ++L  I     
Sbjct  803  PGELLDITLA-QSSIETHDNSGTGPVTSGQENPYDM-----HGNVNLACKSLLLIGNGSG  856

Query  256  SDVVVQHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            S+   +H  K+ RL T  + EV    ++++DLHL
Sbjct  857  SEADAEHNVKRRRLTTLDDEEVAFRSSVTHDLHL  890



>ref|XP_010312817.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Solanum lycopersicum]
Length=891

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 92/214 (43%), Gaps = 31/214 (14%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            E+E G +  Y ++       LG   SE   F YSS  + +  SW P V V    DE   S
Sbjct  696  EMEAGDHLAYTAT-DRDLLHLGGNGSEPCAFSYSSGSLVAGTSWIPDVSVVQDVDEQFDS  754

Query  583  SPATICHD-QNDLEVGVDGKCMAVGEESLDCVDQLASTVEE------NTECFTESLPAAT  425
            SP T   D +  LEV V           L  VDQ  ST E+      + +C  +    AT
Sbjct  755  SPTTSVRDTEKQLEVEV---------AELRKVDQNMSTDEKIDQPKSSIDCLVDG--HAT  803

Query  424  SNMMFDVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----N  257
               + D+    Q+ +E H  SG     S  +N  ++     H N N+  ++L  I     
Sbjct  804  PGELLDITLA-QSSIETHDNSGTGPVTSGQENPYDM-----HGNVNLACKSLLLIGNGSG  857

Query  256  SDVVVQHAAKKMRLMTPVEREVEL--NLSNDLHL  161
            S+   +H  K+ RL T  + EV    ++++DLHL
Sbjct  858  SEADAEHNVKRRRLTTLDDEEVAFRSSVTHDLHL  891



>ref|XP_006351167.1| PREDICTED: uncharacterized protein LOC102593146 [Solanum tuberosum]
Length=190

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 84/197 (43%), Gaps = 36/197 (18%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            E+E G +  Y ++ T     LG   SE   F YSS  +A+  SW P V V    DE + S
Sbjct  22   EMEAGDHLAYTATDTDLL-HLGGNGSEPCAFSYSSGSLAAGTSWIPDVSVVQDVDEELDS  80

Query  583  SPATICHDQNDLEVGVDGKCMAVGEESLDCVDQLASTVEENTECFTESLPAATSNMMFDV  404
            SP T   D +        K + V + S+DC      +V+ +          AT   + D+
Sbjct  81   SPTTSVRDTD--------KQLEVPKSSIDC------SVDGD----------ATPGELLDI  116

Query  403  AAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNL----DAINSDVVVQH  236
                Q+ +E    SG     S  +N       + H N N+  ++L    +   S+   +H
Sbjct  117  TLA-QSSIETRDNSGTGPVTSGQEN-----PYDIHGNVNLSCKSLLLFGNGSGSEADPEH  170

Query  235  AAKKMRLMTPVEREVEL  185
              K+ RL TP+ R++ L
Sbjct  171  NVKRRRL-TPLARKIVL  186



>ref|XP_006351213.1| PREDICTED: probable ubiquitin-like-specific protease 2B-like 
[Solanum tuberosum]
Length=888

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 95/210 (45%), Gaps = 23/210 (11%)
 Frame = -2

Query  763  EVETGGNXVYASSHTTGFGDLGAVASEAFVFPYSSRDVASEASWKPQVPVHHAADEHIGS  584
            E+E G +  Y ++ T     LG   SE   F YSS  +A+  SW P V V    DE + S
Sbjct  693  EMEAGDHLAYTATDTDLL-HLGGNGSEPCAFSYSSGSLAAGTSWIPDVSVVQDVDEELDS  751

Query  583  SPATICHD-QNDLEVGVDGKCMAVGEESLD-CVDQLASTVEENTECFTESLPAATSNMMF  410
            SP T   D +  LEV V   C      S D  +D+  S++    +C  +     T+  + 
Sbjct  752  SPTTSVRDTEKQLEVEVVELCKVDQNMSSDEKIDRPKSSI----DCLVDG--DDTAGELL  805

Query  409  DVAAEPQNGVEPHSQSGIVDSLSASQNLTELSQIEFHDNTNIVSRNLDAI----NSDVVV  242
            D+    Q+ +E    SG     S  +N  ++     H N N+  ++L  I     S+   
Sbjct  806  DITLA-QSSIETRDNSGTGPVTSGQENPYDI-----HGNVNLACKSLLLIGNGSGSEADP  859

Query  241  QHAAKKMRLMTPVERE---VELNLSNDLHL  161
            +H  K+ RL TP++ E      ++++DLHL
Sbjct  860  EHNVKRRRL-TPLDDEEVAFRSSVTHDLHL  888



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680