BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF017A12

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02934.1|  unnamed protein product                                164   4e-44   Coffea canephora [robusta coffee]
ref|XP_006343545.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    158   3e-42   Solanum tuberosum [potatoes]
ref|NP_001234448.1|  CONSTANS-like protein                              155   8e-41   Solanum lycopersicum
ref|XP_009799762.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   5e-40   Nicotiana sylvestris
ref|XP_011069877.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   1e-39   Sesamum indicum [beniseed]
ref|XP_009608073.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     148   2e-38   Nicotiana tomentosiformis
ref|XP_011012685.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   5e-37   Populus euphratica
ref|XP_004507812.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   9e-37   Cicer arietinum [garbanzo]
ref|XP_002309640.2|  hypothetical protein POPTR_0006s18760g             143   9e-37   
ref|XP_004507813.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   1e-36   Cicer arietinum [garbanzo]
ref|XP_003610187.1|  CONSTANS-like zinc finger protein                  143   1e-36   Medicago truncatula
ref|XP_010246902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   4e-36   
ref|XP_011079319.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   5e-36   Sesamum indicum [beniseed]
ref|XP_002277953.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     141   6e-36   Vitis vinifera
ref|XP_007154800.1|  hypothetical protein PHAVU_003G149000g             139   3e-35   Phaseolus vulgaris [French bean]
ref|NP_001240941.1|  zinc finger protein CONSTANS-LIKE 5-like           139   4e-35   Glycine max [soybeans]
ref|XP_011018162.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     139   5e-35   Populus euphratica
gb|KHN17564.1|  Zinc finger protein CONSTANS-LIKE 5                     139   5e-35   Glycine soja [wild soybean]
ref|NP_001239972.1|  zinc finger protein CONSTANS-LIKE 5-like           139   7e-35   Glycine max [soybeans]
gb|KDP43803.1|  hypothetical protein JCGZ_23011                         137   2e-34   Jatropha curcas
dbj|BAB09583.1|  CONSTANS-like B-box zinc finger protein-like           137   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014105.1|  Zinc finger protein CONSTANS-LIKE 5, putative      136   7e-34   
ref|NP_568863.1|  zinc finger protein CONSTANS-LIKE 5                   135   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65968.1|  CONSTANS-like B-box zinc finger protein-like            135   7e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146352.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   1e-33   
ref|XP_010047014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     135   1e-33   Eucalyptus grandis [rose gum]
ref|XP_004167377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   2e-33   
dbj|BAJ33765.1|  unnamed protein product                                130   3e-33   Eutrema halophilum
ref|XP_008453645.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   4e-33   Cucumis melo [Oriental melon]
ref|XP_006401182.1|  hypothetical protein EUTSA_v10013919mg             133   5e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010259762.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    132   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002533687.1|  zinc finger protein, putative                      132   1e-32   Ricinus communis
ref|XP_008453644.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    132   2e-32   Cucumis melo [Oriental melon]
ref|XP_002324491.1|  hypothetical protein POPTR_0018s10510g             132   2e-32   
ref|XP_004146297.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   3e-32   Cucumis sativus [cucumbers]
ref|XP_006474138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   3e-32   Citrus sinensis [apfelsine]
emb|CDY58843.1|  BnaA02g35200D                                          130   4e-32   Brassica napus [oilseed rape]
ref|NP_001288998.1|  zinc finger protein CONSTANS-LIKE 5                130   4e-32   Brassica rapa
emb|CDY49730.1|  BnaA10g11600D                                          127   5e-32   Brassica napus [oilseed rape]
ref|XP_010102982.1|  Zinc finger protein CONSTANS-LIKE 5                130   6e-32   Morus notabilis
ref|XP_006453443.1|  hypothetical protein CICLE_v10008366mg             131   6e-32   
ref|XP_006280689.1|  hypothetical protein CARUB_v10026653mg             130   7e-32   Capsella rubella
ref|XP_006372098.1|  hypothetical protein POPTR_0018s10510g             130   7e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002864524.1|  hypothetical protein ARALYDRAFT_495863             129   1e-31   
ref|XP_009120283.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     129   2e-31   Brassica rapa
ref|XP_008789696.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    128   3e-31   Phoenix dactylifera
ref|XP_010443467.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   3e-31   Camelina sativa [gold-of-pleasure]
emb|CDY25892.1|  BnaC09g32640D                                          128   3e-31   Brassica napus [oilseed rape]
ref|XP_010452640.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008789698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   1e-30   
ref|XP_010536937.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   4e-30   Tarenaya hassleriana [spider flower]
gb|AHI45076.1|  COL domain class transcription factor                   125   4e-30   Boehmeria nivea [Chinese silk-plant]
gb|AGS32266.1|  CONSTANS-like protein                                   124   1e-29   Litchi chinensis [litchi]
gb|EYU34282.1|  hypothetical protein MIMGU_mgv1a020062mg                123   4e-29   Erythranthe guttata [common monkey flower]
gb|KJB23517.1|  hypothetical protein B456_004G102000                    122   6e-29   Gossypium raimondii
ref|XP_010108302.1|  Zinc finger protein CONSTANS-LIKE 4                121   9e-29   Morus notabilis
gb|AJR28929.1|  CONSTANS-like 7 protein                                 122   9e-29   Gossypium hirsutum var. marie-galante
gb|AJR28919.1|  CONSTANS-like 7 protein                                 122   9e-29   Gossypium hirsutum [American cotton]
gb|AJR28935.1|  CONSTANS-like 7 protein                                 121   1e-28   Gossypium barbadense [Egyptian cotton]
gb|AJR28931.1|  CONSTANS-like 7 protein                                 121   1e-28   Gossypium hirsutum subsp. latifolium
gb|AJR28953.1|  CONSTANS-like 7 protein                                 121   1e-28   Gossypium tomentosum
gb|AJR28921.1|  CONSTANS-like 7 protein                                 121   1e-28   Gossypium hirsutum var. punctatum
gb|AJR28923.1|  CONSTANS-like 7 protein                                 121   1e-28   Gossypium hirsutum [American cotton]
gb|AJR28913.1|  CONSTANS-like 7 protein                                 121   2e-28   Gossypium hirsutum [American cotton]
ref|XP_011462636.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     119   6e-28   Fragaria vesca subsp. vesca
ref|XP_006845571.1|  hypothetical protein AMTR_s00019p00192190          119   8e-28   Amborella trichopoda
gb|AJR28936.1|  CONSTANS-like 7 protein                                 119   1e-27   Gossypium barbadense [Egyptian cotton]
gb|KHG03714.1|  Zinc finger CONSTANS-LIKE 5 -like protein               119   1e-27   Gossypium arboreum [tree cotton]
gb|ADB93871.1|  CCT domain protein                                      118   1e-27   
gb|AJR28910.1|  CONSTANS-like 7 protein                                 119   1e-27   Gossypium herbaceum subsp. africanum
gb|AJR28956.1|  CONSTANS-like 7 protein                                 118   2e-27   Gossypium darwinii
ref|XP_009590370.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    118   2e-27   Nicotiana tomentosiformis
gb|AJR28920.1|  CONSTANS-like 7 protein                                 118   2e-27   Gossypium hirsutum var. punctatum
ref|XP_010483296.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009758697.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   3e-27   Nicotiana sylvestris
ref|XP_010539452.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   3e-27   Tarenaya hassleriana [spider flower]
gb|KDP33477.1|  hypothetical protein JCGZ_07048                         117   3e-27   Jatropha curcas
gb|ACS94258.1|  CONSTANS-like protein                                   116   6e-27   Phalaenopsis hybrid cultivar
ref|XP_010541548.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   7e-27   Tarenaya hassleriana [spider flower]
gb|KFK27307.1|  constans-like zinc finger protein                       115   1e-26   Arabis alpina [alpine rockcress]
gb|AHM25240.1|  CO                                                      115   1e-26   Paeonia suffruticosa [moutan peony]
ref|XP_008220621.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     115   1e-26   Prunus mume [ume]
ref|XP_007222404.1|  hypothetical protein PRUPE_ppa008143mg             114   3e-26   Prunus persica
ref|XP_007011648.1|  CONSTANS-like 4                                    114   3e-26   
ref|XP_002515382.1|  Salt-tolerance protein, putative                   114   3e-26   Ricinus communis
gb|ADN97077.1|  CONSTANS-like protein                                   114   5e-26   Cymbidium sinense
gb|AAC99310.1|  CONSTANS-like protein 2                                 114   5e-26   Malus domestica [apple tree]
ref|XP_006342453.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   6e-26   Solanum tuberosum [potatoes]
ref|XP_008386560.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   6e-26   
ref|XP_004253053.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   6e-26   Solanum lycopersicum
gb|AIE41594.1|  zinc finger protein CONSTANS-LIKE 3                     113   8e-26   Lagerstroemia indica [crape-myrtle]
ref|XP_008348263.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   1e-25   
dbj|BAO24102.1|  CONSTANS-like protein                                  113   1e-25   Lemna aequinoctialis
ref|XP_008782090.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   1e-25   Phoenix dactylifera
dbj|BAO24101.1|  CONSTANS-like protein                                  112   1e-25   Lemna gibba
ref|NP_001236860.1|  CONSTANS-like 2b                                   112   1e-25   
gb|AJR28830.1|  CONSTANS-like 6 protein                                 112   2e-25   Gossypium hirsutum subsp. latifolium
gb|AJR28812.1|  CONSTANS-like 6 protein                                 112   2e-25   Gossypium hirsutum [American cotton]
gb|AJR28824.1|  CONSTANS-like 6 protein                                 112   2e-25   Gossypium hirsutum [American cotton]
gb|KHG29079.1|  Zinc finger CONSTANS-LIKE 5 -like protein               112   2e-25   Gossypium arboreum [tree cotton]
gb|AEH05761.1|  CONSTANS-like 1 protein                                 112   2e-25   Phalaenopsis hybrid cultivar
ref|NP_001235843.1|  zinc finger protein CONSTANS-LIKE 2                112   2e-25   
gb|AEH05762.1|  CONSTANS-like 2 protein                                 112   2e-25   Phalaenopsis hybrid cultivar
emb|CBI21186.3|  unnamed protein product                                111   2e-25   Vitis vinifera
ref|XP_008223533.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     112   2e-25   Prunus mume [ume]
ref|XP_007223099.1|  hypothetical protein PRUPE_ppa007083mg             112   3e-25   Prunus persica
ref|XP_009363242.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    112   3e-25   Pyrus x bretschneideri [bai li]
gb|ADX97323.1|  CONSTANS                                                111   3e-25   Mangifera indica
gb|ADX97322.1|  CONSTANS                                                111   3e-25   Mangifera indica
ref|XP_011082019.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   3e-25   Sesamum indicum [beniseed]
gb|AFX73406.1|  constans-like protein 2                                 111   3e-25   Gossypium hirsutum [American cotton]
gb|AIE41595.1|  zinc finger protein CONSTANS-LIKE 4                     111   4e-25   Lagerstroemia indica [crape-myrtle]
ref|XP_009359063.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_009359064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   4e-25   Pyrus x bretschneideri [bai li]
gb|AJR28763.1|  CONSTANS-like 5 protein                                 111   4e-25   Gossypium hirsutum [American cotton]
ref|XP_010928631.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   4e-25   Elaeis guineensis
gb|KJB55148.1|  hypothetical protein B456_009G065600                    111   5e-25   Gossypium raimondii
gb|ADQ27229.1|  CONSTANS-like protein                                   110   5e-25   Cymbidium ensifolium
gb|AJR28856.1|  CONSTANS-like 6 protein                                 110   6e-25   Gossypium darwinii
gb|AJR28775.1|  CONSTANS-like 5 protein                                 110   6e-25   Gossypium hirsutum [American cotton]
ref|XP_007139358.1|  hypothetical protein PHAVU_008G022800g             111   6e-25   Phaseolus vulgaris [French bean]
gb|AJR28831.1|  CONSTANS-like 6 protein                                 110   6e-25   Gossypium hirsutum subsp. latifolium
ref|XP_009418181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJR28810.1|  CONSTANS-like 6 protein                                 110   6e-25   Gossypium herbaceum subsp. africanum
gb|ACN62415.1|  CONSTANS-like protein                                   110   7e-25   Mangifera indica
ref|XP_002263458.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     110   8e-25   Vitis vinifera
gb|AFX73405.1|  constans-like protein 1                                 110   8e-25   Gossypium hirsutum [American cotton]
ref|XP_009394556.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJR28762.1|  CONSTANS-like 5 protein                                 110   9e-25   Gossypium hirsutum [American cotton]
gb|KHG25074.1|  Zinc finger CONSTANS-LIKE 4 -like protein               110   9e-25   Gossypium arboreum [tree cotton]
gb|AJR28784.1|  CONSTANS-like 5 protein                                 110   1e-24   Gossypium barbadense [Egyptian cotton]
ref|XP_010525560.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     110   1e-24   Tarenaya hassleriana [spider flower]
gb|ADW65758.1|  CONSTANS-like protein                                   110   1e-24   Gossypium hirsutum [American cotton]
gb|AJR28785.1|  CONSTANS-like 5 protein                                 110   1e-24   Gossypium barbadense [Egyptian cotton]
gb|AJR28781.1|  CONSTANS-like 5 protein                                 110   1e-24   Gossypium hirsutum subsp. latifolium
gb|KHN14463.1|  Zinc finger protein CONSTANS-LIKE 2                     105   1e-24   Glycine soja [wild soybean]
ref|XP_011078988.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   1e-24   Sesamum indicum [beniseed]
gb|AGI62029.1|  CONSTANS-like 5                                         109   2e-24   Erycina pusilla
emb|CDQ51988.1|  constans like                                          109   2e-24   Fagus sylvatica
gb|ACZ67162.1|  GATA-4/5/6 transcription factor                         104   2e-24   Populus nigra [black poplar]
ref|XP_010692981.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     109   2e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|AJR28780.1|  CONSTANS-like 5 protein                                 109   2e-24   Gossypium hirsutum subsp. latifolium
ref|XP_010100899.1|  Zinc finger protein CONSTANS-LIKE 2                109   2e-24   Morus notabilis
gb|AEA50854.1|  col2a                                                   104   2e-24   Populus tremula [European aspen]
ref|XP_010913626.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     109   3e-24   Elaeis guineensis
ref|XP_009604722.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   3e-24   Nicotiana tomentosiformis
gb|AEE65453.1|  CONSTANS-like protein                                   108   3e-24   Cymbidium sinense
ref|XP_006450227.1|  hypothetical protein CICLE_v10008813mg             108   3e-24   Citrus clementina [clementine]
gb|KDP24338.1|  hypothetical protein JCGZ_25634                         108   4e-24   Jatropha curcas
gb|AJR28818.1|  CONSTANS-like 6 protein                                 108   4e-24   Gossypium hirsutum [American cotton]
gb|AIE41593.1|  zinc finger protein CONSTANS-LIKE 2                     108   4e-24   Lagerstroemia indica [crape-myrtle]
ref|XP_009630583.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     108   5e-24   Nicotiana tomentosiformis
gb|ADQ27228.1|  CONSTANS-like protein                                   108   5e-24   Cymbidium goeringii
ref|XP_010545431.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   5e-24   Tarenaya hassleriana [spider flower]
gb|AJR28809.1|  CONSTANS-like 5 protein                                 108   5e-24   Thespesia populneoides
gb|ACZ67160.1|  GATA-4/5/6 transcription factor                         103   6e-24   Populus balsamifera [balsam poplar]
ref|NP_001280817.1|  zinc finger protein CONSTANS-LIKE 4                108   6e-24   Malus domestica [apple tree]
ref|XP_006388756.1|  hypothetical protein POPTR_0105s00200g             103   6e-24   
ref|XP_009765376.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     108   6e-24   Nicotiana sylvestris
ref|XP_008379517.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     108   6e-24   Malus domestica [apple tree]
gb|AFX73408.1|  constans-like protein 4-1                               108   7e-24   Gossypium hirsutum [American cotton]
gb|AJR28713.1|  CONSTANS-like 3 protein                                 107   7e-24   Gossypium hirsutum [American cotton]
emb|CDY02749.1|  BnaC02g11400D                                          106   7e-24   
gb|AJR28715.1|  CONSTANS-like 3 protein                                 107   7e-24   Gossypium hirsutum [American cotton]
ref|XP_006844170.1|  hypothetical protein AMTR_s00006p00262710          108   8e-24   Amborella trichopoda
ref|NP_001235828.1|  CONSTANS-like 2a                                   107   8e-24   Glycine max [soybeans]
ref|XP_010525138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    107   9e-24   Tarenaya hassleriana [spider flower]
ref|XP_006483500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    107   9e-24   Citrus sinensis [apfelsine]
gb|AJR28859.1|  CONSTANS-like 6 protein                                 107   1e-23   Thespesia populneoides
ref|XP_007215513.1|  hypothetical protein PRUPE_ppa007007mg             107   1e-23   Prunus persica
ref|XP_008230340.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     107   1e-23   Prunus mume [ume]
gb|AFY06686.1|  constans                                                107   1e-23   Nicotiana tabacum [American tobacco]
gb|AJR28731.1|  CONSTANS-like 3 protein                                 107   1e-23   Gossypium hirsutum subsp. latifolium
ref|NP_001233839.1|  CONSTANS 1                                         107   1e-23   Solanum lycopersicum
ref|XP_004291989.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     106   2e-23   Fragaria vesca subsp. vesca
emb|CAP09655.1|  CONSTANS protein                                       107   2e-23   Solanum tuberosum subsp. andigenum
gb|ADU05552.1|  CONSTANS-like protein                                   106   2e-23   Dendrobium loddigesii
ref|XP_009378312.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    107   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_009378311.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    107   2e-23   
gb|AJR28757.1|  CONSTANS-like 3 protein                                 106   2e-23   Gossypium darwinii
gb|AGW80455.1|  constans-like protein                                   106   2e-23   Mangifera indica
gb|ACB36912.1|  CONSTANS-like protein 2                                 106   3e-23   Oxybasis rubra [pigweed]
ref|XP_007032965.1|  Zinc finger protein CONSTANS-LIKE 2                106   3e-23   
gb|ACB36911.2|  CONSTANS-like protein 1                                 106   3e-23   Oxybasis rubra [pigweed]
emb|CBI16899.3|  unnamed protein product                                106   3e-23   Vitis vinifera
ref|XP_002324936.1|  CONSTANS-like protein 2                            106   3e-23   Populus trichocarpa [western balsam poplar]
gb|ADL36670.1|  COL domain class transcription factor                   106   3e-23   Malus domestica [apple tree]
gb|ACV88633.1|  CONSTANS                                                106   3e-23   Magnolia virginiana [sweetbay]
ref|XP_010694604.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     106   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008379481.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     106   3e-23   
gb|ADZ72833.1|  CONSTANS-like protein                                   106   4e-23   Aquilegia formosa
gb|KEH21799.1|  zinc finger constans-like protein                       106   4e-23   Medicago truncatula
gb|ABK96477.1|  unknown                                                 105   4e-23   Populus trichocarpa x Populus deltoides
ref|XP_004491763.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   4e-23   Cicer arietinum [garbanzo]
ref|XP_010421344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   4e-23   Camelina sativa [gold-of-pleasure]
gb|KJB68430.1|  hypothetical protein B456_010G245200                    105   4e-23   Gossypium raimondii
gb|AJR28758.1|  CONSTANS-like 3 protein                                 105   5e-23   Thespesia populneoides
ref|XP_011085568.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   5e-23   Sesamum indicum [beniseed]
ref|XP_011044957.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   5e-23   Populus euphratica
gb|AEJ84000.1|  CONSTANS protein                                        105   5e-23   Nicotiana tabacum [American tobacco]
gb|AAS67379.1|  CONSTANS 3                                              105   5e-23   Solanum lycopersicum
ref|XP_004232119.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   6e-23   
ref|XP_008341185.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   6e-23   Malus domestica [apple tree]
ref|XP_009777143.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   6e-23   Nicotiana sylvestris
ref|XP_008341828.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   7e-23   
ref|XP_009373735.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     105   7e-23   Pyrus x bretschneideri [bai li]
ref|XP_004173366.1|  PREDICTED: zinc finger protein CONSTANS-like       100   7e-23   
gb|ADL36677.1|  COL domain class transcription factor                   105   7e-23   Malus domestica [apple tree]
gb|ADO61394.1|  CONSTANS-like 1                                         101   7e-23   Helianthus annuus
ref|NP_001274795.1|  CONSTANS                                           105   7e-23   Solanum tuberosum [potatoes]
emb|CAN74840.1|  hypothetical protein VITISV_035527                     105   8e-23   Vitis vinifera
ref|XP_002282509.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     105   8e-23   Vitis vinifera
ref|XP_002532886.1|  zinc finger protein, putative                      105   9e-23   Ricinus communis
gb|AFK08986.1|  CO-like protein                                         105   9e-23   Fragaria x ananassa
ref|XP_002872134.1|  hypothetical protein ARALYDRAFT_489353             104   9e-23   
ref|XP_010257847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     104   9e-23   Nelumbo nucifera [Indian lotus]
gb|AJR28808.1|  CONSTANS-like 5 protein                                 104   1e-22   Thespesia populneoides
gb|ACZ67161.1|  GATA-4/5/6 transcription factor                         100   1e-22   Populus deltoides
ref|XP_010261698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    104   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002309695.1|  CONSTANS-like protein 2                            104   1e-22   Populus trichocarpa [western balsam poplar]
gb|ADO61376.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
sp|Q940T9.2|COL4_ARATH  RecName: Full=Zinc finger protein CONSTAN...    104   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ADO61292.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61362.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61323.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61359.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61370.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61358.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ACJ06578.1|  CONSTANS                                                104   1e-22   Fragaria x ananassa
gb|ADO61364.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61298.1|  CONSTANS-like 1                                         100   1e-22   Helianthus annuus
gb|ADO61280.1|  CONSTANS-like 1                                         100   1e-22   Helianthus argophyllus
gb|AJR28626.1|  CONSTANS-like 1 protein                                 104   1e-22   Gossypium hirsutum [American cotton]
gb|KJB48246.1|  hypothetical protein B456_008G059900                    104   1e-22   Gossypium raimondii
gb|AJR28623.1|  CONSTANS-like 1 protein                                 104   1e-22   Gossypium hirsutum [American cotton]
gb|ABK95723.1|  unknown                                                 102   1e-22   Populus trichocarpa [western balsam poplar]
gb|ACZ67163.1|  GATA-4/5/6 transcription factor                       99.4    2e-22   Populus balsamifera [balsam poplar]
ref|XP_010493742.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     104   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006338763.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    103   2e-22   
gb|AJR28712.1|  CONSTANS-like 3 protein                                 103   2e-22   Gossypium hirsutum [American cotton]
gb|AJR28734.1|  CONSTANS-like 3 protein                                 103   2e-22   Gossypium barbadense [Egyptian cotton]
gb|AFK08985.1|  CONSTANTS-like protein                                  104   2e-22   Fragaria x ananassa
gb|AJR28738.1|  CONSTANS-like 3 protein                                 103   2e-22   Gossypium barbadense [Egyptian cotton]
ref|XP_006430882.1|  hypothetical protein CICLE_v10012022mg             103   2e-22   Citrus clementina [clementine]
gb|KDO58878.1|  hypothetical protein CISIN_1g017819mg                   103   2e-22   Citrus sinensis [apfelsine]
ref|XP_006482341.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    103   2e-22   Citrus sinensis [apfelsine]
gb|AJR28647.1|  CONSTANS-like 1 protein                                 103   2e-22   Gossypium barbadense var. peruvianum
ref|NP_197875.2|  zinc finger protein CONSTANS-LIKE 4                   104   2e-22   
ref|XP_010029446.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     103   2e-22   Eucalyptus grandis [rose gum]
emb|CDP14453.1|  unnamed protein product                                103   2e-22   Coffea canephora [robusta coffee]
gb|AJR28724.1|  CONSTANS-like 3 protein                                 103   2e-22   Gossypium hirsutum [American cotton]
gb|ACZ67165.1|  GATA-4/5/6 transcription factor                       99.0    2e-22   Populus nigra [black poplar]
gb|AJR28635.1|  CONSTANS-like 1 protein                                 103   2e-22   Gossypium barbadense [Egyptian cotton]
gb|ACZ67164.1|  GATA-4/5/6 transcription factor                       99.0    2e-22   Populus deltoides
gb|AJR28657.1|  CONSTANS-like 1 protein                                 103   2e-22   Gossypium darwinii
gb|AJR28720.1|  CONSTANS-like 3 protein                                 103   2e-22   Gossypium hirsutum var. punctatum
gb|AJR28756.1|  CONSTANS-like 3 protein                                 103   2e-22   Gossypium darwinii
ref|XP_002305307.1|  CONSTANS-like protein CO2                          103   3e-22   
gb|AGM20690.1|  COL1-1                                                  103   3e-22   Populus tomentosa [Chinese white poplar]
gb|ADO61340.1|  CONSTANS-like 1                                       99.8    3e-22   Helianthus annuus
ref|XP_006287997.1|  hypothetical protein CARUB_v10001230mg             103   3e-22   Capsella rubella
gb|ADO61300.1|  CONSTANS-like 1                                       99.8    3e-22   Helianthus annuus
gb|ACY95395.1|  CONSTANS-like 1                                         102   3e-22   Phalaenopsis amabilis
ref|XP_011021143.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    103   4e-22   Populus euphratica
ref|XP_010454822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    103   4e-22   Camelina sativa [gold-of-pleasure]
gb|AEA50856.1|  col2b                                                 98.6    4e-22   Populus tremula [European aspen]
ref|XP_009414699.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006373513.1|  hypothetical protein POPTR_0017s14410g             103   4e-22   
gb|AFZ84543.1|  GATA-4/5/6 transcription factor                       98.2    4e-22   Populus tremula [European aspen]
gb|AJR28634.1|  CONSTANS-like 1 protein                                 103   4e-22   Gossypium barbadense [Egyptian cotton]
gb|AJR28633.1|  CONSTANS-like 1 protein                                 103   4e-22   Gossypium hirsutum f. palmeri
ref|XP_009418532.1|  PREDICTED: zinc finger protein HD1-like            102   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382845.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3     102   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJR28612.1|  CONSTANS-like 1 protein                                 103   4e-22   Gossypium hirsutum [American cotton]
gb|AAX47172.1|  CONSTANS-LIKE a                                         103   4e-22   Pisum sativum [garden pea]
ref|XP_006373512.1|  CONSTANS-like protein CO2                          102   4e-22   
gb|AAS00054.1|  CONSTANS-like protein CO1                               103   4e-22   Populus deltoides
ref|XP_004304173.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     102   5e-22   Fragaria vesca subsp. vesca
gb|KFK37702.1|  hypothetical protein AALP_AA3G017800                    102   5e-22   Arabis alpina [alpine rockcress]
gb|AAG24863.1|  CONSTANS-like protein                                   103   5e-22   
gb|AJR28649.1|  CONSTANS-like 1 protein                                 102   5e-22   
ref|XP_008797568.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   5e-22   
gb|AFZ84541.1|  GATA-4/5/6 transcription factor                       97.8    6e-22   
gb|KHG24977.1|  Zinc finger CONSTANS-LIKE 2 -like protein               102   6e-22   
gb|AJR28621.1|  CONSTANS-like 1 protein                                 102   6e-22   
gb|ADD60697.1|  putative heading date 1 protein                         102   6e-22   
gb|ADX60072.1|  CONSTANS-like 4                                         102   7e-22   
gb|AJR28639.1|  CONSTANS-like 1 protein                                 102   7e-22   
gb|AAL99265.1|  CONSTANS-like protein CO5                             97.8    7e-22   
gb|AJR28632.1|  CONSTANS-like 1 protein                                 102   7e-22   
gb|AGC92992.1|  constans-like protein                                   102   7e-22   
gb|AGC92989.1|  constans-like protein                                   102   7e-22   
gb|AJR28655.1|  CONSTANS-like 1 protein                                 102   7e-22   
emb|CDP02370.1|  unnamed protein product                                102   7e-22   
ref|XP_010942234.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   8e-22   
ref|XP_010688513.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     102   9e-22   
gb|EYU22036.1|  hypothetical protein MIMGU_mgv1a008870mg                102   1e-21   
ref|XP_010048286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     101   1e-21   
ref|XP_004498823.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   1e-21   
gb|ADO61000.1|  CONSTANS-like 1                                         102   1e-21   
ref|XP_008451877.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   1e-21   
gb|ADD60671.1|  putative heading date 1 protein                         101   1e-21   
gb|ADO61336.1|  CONSTANS-like 1                                       97.8    1e-21   
gb|AJR28610.1|  CONSTANS-like 1 protein                                 101   1e-21   
gb|AAC35496.1|  CONSTANS-like 1 protein                                 101   1e-21   
gb|AIE41592.1|  zinc finger protein CONSTANS-LIKE 1                     101   1e-21   
gb|AAD22518.1|AF001136_1  zinc finger protein                           102   1e-21   
gb|ADO61001.1|  CONSTANS-like 1                                         101   1e-21   
gb|AJR28638.1|  CONSTANS-like 1 protein                                 101   1e-21   
gb|AAM62947.1|  zinc finger protein constans-like 8                     100   1e-21   
ref|XP_001783412.1|  predicted protein                                  101   2e-21   
gb|KHN07005.1|  Zinc finger protein CONSTANS-LIKE 5                   96.7    2e-21   
gb|AJR28659.1|  CONSTANS-like 1 protein                                 101   2e-21   
ref|NP_180052.1|  zinc finger protein CONSTANS-LIKE 3                   100   2e-21   
gb|AJR28658.1|  CONSTANS-like 1 protein                                 101   2e-21   
gb|AIP90463.1|  HD1                                                     101   2e-21   
gb|AFV79556.1|  constans-like 1                                         101   2e-21   
gb|AGI62035.1|  CONSTANS-like 11                                        100   2e-21   
gb|AFV78277.1|  constans-like 1                                         101   2e-21   
gb|KFK27763.1|  hypothetical protein AALP_AA8G425800                    100   2e-21   
dbj|BAI59738.1|  Heading date1                                          101   2e-21   
ref|XP_011032791.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     100   2e-21   
emb|CAK26129.1|  constans-like 1                                        100   3e-21   
emb|CAK26151.1|  constans-like 1                                        100   3e-21   
gb|AJR28753.1|  CONSTANS-like 3 protein                                 100   3e-21   
emb|CAK26110.1|  constans-like 1                                        100   3e-21   
emb|CAK26147.1|  constans-like 1                                        100   3e-21   
emb|CAK26149.1|  constans-like 1                                        100   3e-21   
emb|CAK26109.1|  constans-like 1                                        100   3e-21   
emb|CAK26141.1|  constans-like 1                                        100   3e-21   
ref|XP_010453734.1|  PREDICTED: zinc finger protein CONSTANS-like       100   3e-21   
emb|CAK26107.1|  constans-like 1                                        100   3e-21   
emb|CAK26106.1|  constans-like 1                                        100   3e-21   
emb|CAK26112.1|  constans-like 1                                        100   3e-21   
emb|CAK26119.1|  constans-like 1                                        100   3e-21   
emb|CAK26123.1|  constans-like 1                                        100   3e-21   
ref|XP_010492434.1|  PREDICTED: zinc finger protein CONSTANS-like       100   3e-21   
ref|XP_002878801.1|  hypothetical protein ARALYDRAFT_481339             100   3e-21   
emb|CDY45597.1|  BnaA04g14640D                                        99.8    3e-21   
ref|XP_004138691.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    100   3e-21   
emb|CDY36171.1|  BnaC04g37230D                                        99.8    3e-21   
gb|ADO60998.1|  CONSTANS-like 2                                         100   3e-21   
gb|ACF79190.1|  unknown                                               95.9    4e-21   
gb|AHB64449.1|  CONSTANS-like protein                                   100   4e-21   
dbj|BAM67031.1|  constans-like 1                                        100   4e-21   
gb|AGF86398.1|  CONSTANS-like protein                                   100   4e-21   
gb|AFW86339.1|  constans1                                             95.9    4e-21   
gb|KFK25823.1|  hypothetical protein AALP_AA8G166000                    100   4e-21   
ref|XP_008445288.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     100   4e-21   
gb|ADD60684.1|  putative heading date 1 protein                         100   4e-21   
gb|AAS00055.1|  CONSTANS-like protein CO2                               100   4e-21   
ref|NP_001140225.1|  uncharacterized protein LOC100272264             97.1    4e-21   
gb|KHG19343.1|  Zinc finger CONSTANS-LIKE 4 -like protein             99.8    5e-21   
gb|ACF81408.1|  unknown                                               96.7    5e-21   
ref|XP_003526113.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   99.8    5e-21   
gb|ACH47948.3|  constans-like protein                                   100   5e-21   
ref|XP_007136923.1|  hypothetical protein PHAVU_009G085300g           99.8    5e-21   
ref|XP_004137263.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.8    5e-21   
gb|ADE32719.1|  putative constans-like protein                          100   5e-21   
ref|XP_008455579.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   99.8    5e-21   
ref|XP_008783055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.4    5e-21   
gb|AGV54686.1|  zinc finger protein CONSTANS-LIKE 4-like protein      99.4    6e-21   
gb|ADE32718.1|  putative constans-like protein                        99.8    6e-21   
gb|ADE32725.1|  putative constans-like protein                        99.8    6e-21   
gb|ADE32724.1|  putative constans-like protein                        99.8    6e-21   
gb|ADE32717.1|  putative constans-like protein                        99.8    6e-21   
gb|ADE32722.1|  putative constans-like protein                        99.8    6e-21   
gb|ADE32723.1|  putative constans-like protein                        99.8    6e-21   
gb|ADE32721.1|  putative constans-like protein                        99.8    6e-21   
ref|XP_010929079.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.0    6e-21   
gb|ADE32730.1|  putative constans-like protein                        99.8    6e-21   
gb|ABR57243.1|  CONSTANS-like protein                                 99.8    6e-21   
gb|ABK24585.1|  unknown                                               99.8    6e-21   
gb|ADE32733.1|  putative constans-like protein                        99.8    7e-21   
gb|ACF20289.1|  constans-like protein                                   100   7e-21   
gb|AEE42605.1|  CONSTANS-like 2                                       99.4    7e-21   
gb|KFK27762.1|  hypothetical protein AALP_AA8G425800                  99.4    8e-21   
ref|XP_004150328.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.0    8e-21   
ref|XP_009140597.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3   98.6    8e-21   
gb|ADO61318.1|  CONSTANS-like 1                                       95.5    9e-21   
ref|XP_004164711.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.0    9e-21   
gb|ADE32720.1|  putative constans-like protein                        99.4    9e-21   
ref|XP_011031404.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.0    1e-20   
gb|ADO61312.1|  CONSTANS-like 1                                       95.5    1e-20   
gb|ACT22759.1|  CONSTANS-like protein                                 98.6    1e-20   
gb|AGO81840.1|  CONSTANS-like protein                                 98.6    1e-20   
gb|AAL99264.1|  CONSTANS-like protein CO5                             98.6    1e-20   
ref|XP_001767869.1|  predicted protein                                99.0    1e-20   
ref|XP_010914103.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    1e-20   
gb|AGL61503.1|  constans-like protein                                 99.0    1e-20   
ref|XP_010463643.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    1e-20   
ref|XP_004965220.1|  PREDICTED: zinc finger protein HD1-like          98.6    1e-20   
dbj|BAK00013.1|  predicted protein                                    98.6    1e-20   
gb|AEN71141.1|  constans-like protein                                 98.6    1e-20   
ref|XP_006287957.1|  hypothetical protein CARUB_v10001192mg           98.6    1e-20   
gb|AJR28710.1|  CONSTANS-like 3 protein                               98.6    1e-20   
ref|XP_010479901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    1e-20   
dbj|BAN00005.1|  heading date 1                                       98.6    1e-20   
gb|ABS72030.1|  putative CONSTANS-like protein                        93.2    1e-20   
dbj|BAN00006.1|  heading date 1                                       98.6    1e-20   
ref|XP_010485482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   98.6    1e-20   
emb|CAI64585.1|  CONSTANS-like 3                                      98.6    1e-20   
ref|XP_006400111.1|  hypothetical protein EUTSA_v10013895mg           98.6    1e-20   
ref|XP_009151020.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  98.6    1e-20   
emb|CAK26108.1|  constans-like 1                                      99.0    2e-20   
gb|ADO61294.1|  CONSTANS-like 1                                       94.7    2e-20   
gb|AJR28752.1|  CONSTANS-like 3 protein                               98.2    2e-20   
gb|EPS73275.1|  hypothetical protein M569_01485                       97.8    2e-20   
ref|XP_011099077.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   98.2    2e-20   
gb|AFK31626.1|  Hd1                                                   98.6    2e-20   
dbj|BAI59735.1|  Heading date1                                        98.6    2e-20   
ref|XP_010429472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    2e-20   
gb|AGU36784.1|  CONSTANS 3                                            92.4    2e-20   
gb|AEK05674.1|  constans-2                                            97.4    2e-20   
gb|AEK05666.1|  constans-2                                            97.4    2e-20   
gb|AEK05667.1|  constans-2                                            97.4    2e-20   
gb|AEK05675.1|  constans-2                                            97.4    2e-20   
gb|AEK05673.1|  constans-2                                            97.4    2e-20   
gb|AEK05668.1|  constans-2                                            97.4    3e-20   
gb|AEK05686.1|  constans-2                                            97.4    3e-20   
gb|AEK05685.1|  constans-2                                            97.4    3e-20   
gb|AEK05677.1|  constans-2                                            97.4    3e-20   
gb|AEK05669.1|  constans-2                                            97.4    3e-20   
dbj|BAI77474.1|  Zinc-finger type transcription factor                97.8    3e-20   
gb|AEK05679.1|  constans-2                                            97.4    3e-20   
gb|AEK05688.1|  constans-2                                            97.4    3e-20   
gb|AEK05684.1|  constans-2                                            97.4    3e-20   
gb|AEP02829.1|  heading day 1                                         97.8    3e-20   
ref|XP_006352044.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  95.9    3e-20   
dbj|BAI59736.1|  Heading date1                                        98.2    3e-20   
gb|AEP02828.1|  heading day 1                                         97.8    3e-20   
gb|AIP90444.1|  HD1                                                   97.8    3e-20   
gb|AEP02841.1|  heading day 1                                         97.8    3e-20   
gb|AFK31610.1|  Hd1                                                   97.8    3e-20   
gb|AIP90428.1|  HD1                                                   97.8    3e-20   
gb|AEP02811.1|  heading day 1                                         97.8    3e-20   
gb|AIP90424.1|  HD1                                                   97.8    3e-20   
gb|EMT22281.1|  hypothetical protein F775_52650                       98.2    3e-20   
gb|AEP02834.1|  heading day 1                                         97.8    3e-20   
gb|AIP90462.1|  HD1                                                   97.8    3e-20   
gb|AIP90439.1|  HD1                                                   97.8    3e-20   
gb|AEP02823.1|  heading day 1                                         97.8    3e-20   
gb|AIP90449.1|  HD1                                                   97.8    3e-20   
gb|AFK31568.1|  Hd1                                                   97.8    3e-20   
gb|ADO60999.1|  CONSTANS-like 2                                       97.4    3e-20   
gb|AEP02853.1|  heading day 1                                         97.8    3e-20   
gb|AIP90432.1|  HD1                                                   97.8    3e-20   
gb|AIP90425.1|  HD1                                                   97.8    3e-20   
gb|AIP90443.1|  HD1                                                   97.8    3e-20   
gb|AFK31625.1|  Hd1                                                   97.8    3e-20   
gb|AFK31604.1|  Hd1                                                   97.8    3e-20   
gb|AEP02816.1|  heading day 1                                         97.8    3e-20   
gb|AEP02807.1|  heading day 1                                         97.8    3e-20   
gb|AGU36799.1|  CONSTANS 3                                            91.7    3e-20   
ref|NP_001057378.1|  Os06g0275000                                     97.8    3e-20   
gb|AFK31566.1|  Hd1                                                   97.8    3e-20   
gb|AIP90423.1|  HD1                                                   97.8    4e-20   
gb|AFK31607.1|  Hd1                                                   97.8    4e-20   
gb|AEP02821.1|  heading day 1                                         97.8    4e-20   
gb|AIP90438.1|  HD1                                                   97.8    4e-20   
dbj|BAI59737.1|  Heading date1                                        97.8    4e-20   
gb|AEP02848.1|  heading day 1                                         97.8    4e-20   
gb|AFK31624.1|  Hd1                                                   97.8    4e-20   
gb|AEP02820.1|  heading day 1                                         97.8    4e-20   
ref|XP_010485483.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    4e-20   
gb|AFK31601.1|  Hd1                                                   97.8    4e-20   
gb|AIP90429.1|  HD1                                                   97.8    4e-20   
ref|XP_003522335.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    4e-20   
gb|AFK31574.1|  Hd1                                                   97.8    4e-20   
gb|AEP02825.1|  heading day 1                                         97.8    4e-20   
gb|AEP02840.1|  heading day 1                                         97.8    4e-20   
gb|EEE65515.1|  hypothetical protein OsJ_20956                        97.4    4e-20   
dbj|BAI59734.1|  Heading date1                                        97.8    4e-20   
gb|AFK31600.1|  Hd1                                                   97.8    4e-20   
gb|AEP02822.1|  heading day 1                                         97.8    4e-20   
gb|AFK31548.1|  Hd1                                                   97.8    4e-20   
gb|AIP90436.1|  HD1                                                   97.8    4e-20   
gb|AIP90435.1|  HD1                                                   97.8    4e-20   
gb|AFK31611.1|  Hd1                                                   97.8    4e-20   
gb|AFK31585.1|  Hd1                                                   97.8    4e-20   
gb|AEP02836.1|  heading day 1                                         97.8    4e-20   
gb|AEP02824.1|  heading day 1                                         97.8    4e-20   
gb|AEP02804.1|  heading day 1                                         97.8    4e-20   
gb|AEP02839.1|  heading day 1                                         97.8    4e-20   
gb|AEP02831.1|  heading day 1                                         97.8    4e-20   
gb|AEP02827.1|  heading day 1                                         97.4    4e-20   
gb|AEP02818.1|  heading day 1                                         97.8    4e-20   
gb|AFK31538.1|  Hd1                                                   97.4    4e-20   
gb|AFK31605.1|  Hd1                                                   97.4    4e-20   
gb|AFK31569.1|  Hd1                                                   97.4    4e-20   
dbj|BAI59726.1|  Heading date1                                        97.8    4e-20   
gb|AEP02803.1|  heading day 1                                         97.8    4e-20   
gb|AIP90415.1|  HD1                                                   97.4    4e-20   
gb|AIP90430.1|  HD1                                                   97.4    4e-20   
ref|XP_006357063.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    4e-20   
gb|AGZ15419.1|  constans                                              96.7    4e-20   
gb|AFK31576.1|  Hd1                                                   97.4    4e-20   
gb|AFK31553.1|  Hd1                                                   97.4    4e-20   
gb|ABV55996.1|  constans                                              97.4    4e-20   
gb|AFK31545.1|  Hd1                                                   97.4    4e-20   



>emb|CDP02934.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 131/208 (63%), Gaps = 30/208 (14%)
 Frame = -1

Query  729  SDNFLDFEYPVSWES--NSHQNQYNSDRVVPIQTIKTSAPIIP---------QEKHFEID  583
            SDN+LDF+Y +S  +    H     +D VVP+QT K   PI+P          EKHFEID
Sbjct  207  SDNYLDFDYRISSGARIQQHYTSSGTDGVVPVQTTK--PPILPAQLPGHHEPSEKHFEID  264

Query  582  FTRSNLTSYNSGFTKpslsvsssldvgvvpdg---ssvSEISY---RNIGGGSVDSRG--  427
            FT+S+++SY   +T  SLS S S     V      SSVSEISY   RN+ G + D  G  
Sbjct  265  FTKSHISSYTPSYTSHSLSQSVSSSSLDVGVVPDGSSVSEISYPFGRNLSGSTADLSGSS  324

Query  426  ------GSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEV  265
                  GSQ  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR E 
Sbjct  325  SGGNNQGSQLPGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRAEA  384

Query  264  ESESDIDTLFSSADSAA--DVGRFSVVP  187
              ES+ID +F+   SAA     R+ VVP
Sbjct  385  -IESEIDQMFTCPGSAAFFPESRYGVVP  411



>ref|XP_006343545.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Solanum 
tuberosum]
Length=385

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 138/198 (70%), Gaps = 22/198 (11%)
 Frame = -1

Query  729  SDNFLDFEYPVSWESNSHQNQYNS--DRVVPIQT---IKTSAPIIPQEKHFEIDFTRSNL  565
            S+NFLDF+YPVS ++ S Q  YNS  D VVP+QT   IK S P   QEKHFEIDFT+S++
Sbjct  189  SENFLDFDYPVSVDTQS-QPHYNSANDSVVPVQTNTAIK-SLPFHHQEKHFEIDFTQSHI  246

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISY-----RNIGGGSVD-----SRGGSQW  415
             SYN   T      SSSLDVG+VPDGSS+SEISY      N    S+D     +  G + 
Sbjct  247  KSYN---TPSLSVSSSSLDVGIVPDGSSISEISYPYMRTMNNSNSSIDLSNSANHQGEKL  303

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE--SDIDT  241
             G+DREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+  +    D+D 
Sbjct  304  LGLDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDGGAGEFDDVDG  363

Query  240  LFSSADSAADVGRFSVVP  187
            +FS A+  A   R+ VVP
Sbjct  364  IFSGAEFIAADSRYGVVP  381



>ref|NP_001234448.1| CONSTANS-like protein [Solanum lycopersicum]
 gb|ACC95379.1| CONSTANS-like protein [Solanum lycopersicum]
 gb|AEW69784.1| Hop-interacting protein THI010 [Solanum lycopersicum]
Length=386

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 134/199 (67%), Gaps = 22/199 (11%)
 Frame = -1

Query  729  SDNFLDFEYPVSWESNSHQNQYNS--DRVVPIQ--TIKTSAPIIPQEKHFEIDFTRSNLT  562
            S+NFLDF+YP   ++ S Q  YNS  D VVP+Q  T   S P   QEKHFEIDFT+S++ 
Sbjct  188  SENFLDFDYPACVDTQS-QPHYNSSNDSVVPVQANTPIKSLPFHHQEKHFEIDFTQSHIK  246

Query  561  SYNSGFTKpslsvsssldvgvvpdgssvSEISY-----RNIGGGSVD-----SRGGSQWN  412
            SYN   T      SSSLDVG+VPDGSS+SEISY      N    S+D     +  G +  
Sbjct  247  SYN---TPSLSVSSSSLDVGIVPDGSSISEISYPYIRTMNNSNSSIDLSNSANHQGEKLL  303

Query  411  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESES----DID  244
            G+DREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+  + +    D+D
Sbjct  304  GLDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDGSAGAGEFDDVD  363

Query  243  TLFSSADSAADVGRFSVVP  187
             +FS  D  A   R+ VVP
Sbjct  364  GIFSGTDFIAAESRYGVVP  382



>ref|XP_009799762.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Nicotiana 
sylvestris]
Length=384

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 134/191 (70%), Gaps = 12/191 (6%)
 Frame = -1

Query  729  SDNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            S+N LDF+Y VS ++NS  N YNS  D VVP+Q+     P   QEKHFEIDFT+S++ SY
Sbjct  194  SENILDFDYSVSIDTNSQPN-YNSANDSVVPVQSTIKPLPFQHQEKHFEIDFTQSHIKSY  252

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISYRNI-GGGSVDSRGGS----QWNGMDREAR  391
             +  +      SSSLDVG+VPDGSS+SEISY  +    S+   G S    +  GM+REAR
Sbjct  253  TTP-SLSHSVSSSSLDVGIVPDGSSISEISYPFVRSVNSIIEMGSSAPAEKLIGMNREAR  311

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVES---ESDIDTLFSSADS  220
            VLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKR + +    +SDID +FS A  
Sbjct  312  VLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRNDSDGAGVDSDIDQIFSGAGF  371

Query  219  AADVGRFSVVP  187
             A+  R+ VVP
Sbjct  372  IANDSRYGVVP  382



>ref|XP_011069877.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Sesamum 
indicum]
Length=378

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 131/198 (66%), Gaps = 28/198 (14%)
 Frame = -1

Query  729  SDNFLDFE-YPVSWESNSHQNQYNSDRVVPIQT-IKTSAPIIPQEKH-----FEIDFTRS  571
            SD F+DFE Y +S       +Q  SD VVP+QT IK  AP      H     FEIDFTRS
Sbjct  190  SDQFIDFENYQIS-------SQPYSDSVVPVQTTIKPPAPARLTRDHSSENRFEIDFTRS  242

Query  570  NLTSYNSGFTKpslsvsssldvgvvpdg---ssvSEISY---RNIGGGSVDSRG--GSQW  415
            N+ +YNS +T  SLS S S     V      S++SEISY   RNI   S+D  G  GSQ 
Sbjct  243  NINAYNSSYTTASLSHSVSSSSMDVGVVPDGSALSEISYPFSRNINS-SLDLNGNQGSQV  301

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLF  235
             GMDREARVLRY+EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT  ++ESDID +F
Sbjct  302  VGMDREARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT--DAESDIDRIF  359

Query  234  --SSADSAADVGRFSVVP  187
               +A+  AD  R+ VVP
Sbjct  360  GAGAANFIAD-ARYGVVP  376



>ref|XP_009608073.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Nicotiana tomentosiformis]
Length=383

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 134/192 (70%), Gaps = 14/192 (7%)
 Frame = -1

Query  729  SDNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            S+N LDF+Y VS ++NS  N YNS  D VVP+Q+     P   QEKHFEIDFT++++ SY
Sbjct  193  SENILDFDYSVSIDTNSQPN-YNSANDSVVPVQSTIKPLPFQYQEKHFEIDFTQTHIKSY  251

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWN---GMDREA  394
             +  +      SSSLDVG+VPDGSS+SEISY   R++   SV+    +Q     GM+REA
Sbjct  252  TTP-SLSHSVSSSSLDVGIVPDGSSISEISYPFGRSVNS-SVEMGSSAQAEKLIGMNREA  309

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVES---ESDIDTLFSSAD  223
            RVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKR +      +SDID ++S A 
Sbjct  310  RVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRNDSSGAGVDSDIDQIYSCAG  369

Query  222  SAADVGRFSVVP  187
              A   R+ VVP
Sbjct  370  FIASDSRYGVVP  381



>ref|XP_011012685.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Populus 
euphratica]
Length=384

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 131/200 (66%), Gaps = 22/200 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQ----YNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D FLDFEY  S +    Q+       +D VVP+Q      P+I  +  F+IDF RS LTS
Sbjct  185  DPFLDFEYQNSMDGRYKQSHGGGGAGADSVVPVQNKPAPLPVIDHKNCFDIDFCRSKLTS  244

Query  558  YNS--GFTKpslsvsssldvgvvpdgssvSEISY---RNIGG---------GSVDSRGGS  421
            ++S    +      SSSLDVGVVPDG+S+S+ISY   R++           GS  ++  +
Sbjct  245  FSSYPSQSLSHSVSSSSLDVGVVPDGNSMSDISYPFGRSMNNYTDPNMPISGSTTNQAAA  304

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q  G+DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ESD+DT
Sbjct  305  QLAGIDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEM--ESDMDT  362

Query  240  LFSSADSAADVG--RFSVVP  187
            L++SA S   +    + VVP
Sbjct  363  LYNSASSVPFLADTHYGVVP  382



>ref|XP_004507812.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X1 
[Cicer arietinum]
Length=384

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 17/176 (10%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ--EKHFEIDFTRSNLTSYN  553
            D F+DF+Y  ++++N++ +   +D VVP+QT  T AP++    E  F+IDF RS L+S+N
Sbjct  180  DPFIDFDYSNTFQNNNNCSSAINDSVVPVQTKPTPAPMMNHNSESCFDIDFCRSKLSSFN  239

Query  552  --SGFTKpslsvsssldvgvvpdgssvSEISY---RN------IGGGSVDSRGG----SQ  418
              +     S   SSSLDVGVVPDG++V E+SY   RN      +  G V+S+ G    +Q
Sbjct  240  YPAQSISQSQVSSSSLDVGVVPDGNAVPEMSYSFGRNSSESSGMVSGGVNSQQGVQVATQ  299

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
              GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE++SE D
Sbjct  300  LCGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIDSEVD  355



>ref|XP_002309640.2| hypothetical protein POPTR_0006s18760g [Populus trichocarpa]
 gb|EEE93163.2| hypothetical protein POPTR_0006s18760g [Populus trichocarpa]
Length=339

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 130/200 (65%), Gaps = 22/200 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQ----YNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D FLDFEY  S +    Q+       +D VVP+Q      P+I  +  F+IDF RS LTS
Sbjct  140  DPFLDFEYQNSMDGRYKQSHGGGGAGADSVVPVQNKPAPLPVIDHKNCFDIDFCRSKLTS  199

Query  558  YNS--GFTKpslsvsssldvgvvpdgssvSEISY---RNIG---------GGSVDSRGGS  421
            ++S    +      SSSLDVGVVPDG+S+S+ISY   R++           GS  ++  +
Sbjct  200  FSSYPSQSLSHSVSSSSLDVGVVPDGNSMSDISYPFGRSMNTYTDPSMPISGSTTNQAAA  259

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q  G+DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ESD+DT
Sbjct  260  QLAGIDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEM--ESDMDT  317

Query  240  LFSSADSAADVG--RFSVVP  187
            L++S  S   +    + VVP
Sbjct  318  LYNSPSSVPFLADTHYGVVP  337



>ref|XP_004507813.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X2 
[Cicer arietinum]
Length=383

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 16/175 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ--EKHFEIDFTRSNLTSYN  553
            D F+DF+Y  ++++N++ +   +D VVP+QT  T AP++    E  F+IDF RS L+S+N
Sbjct  180  DPFIDFDYSNTFQNNNNCSSAINDSVVPVQTKPTPAPMMNHNSESCFDIDFCRSKLSSFN  239

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISY---RN------IGGGSVDSRGG----SQW  415
                +      SSSLDVGVVPDG++V E+SY   RN      +  G V+S+ G    +Q 
Sbjct  240  YPAQSISQSVSSSSLDVGVVPDGNAVPEMSYSFGRNSSESSGMVSGGVNSQQGVQVATQL  299

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
             GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE++SE D
Sbjct  300  CGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIDSEVD  354



>ref|XP_003610187.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AES92384.1| zinc finger constans-like protein [Medicago truncatula]
Length=375

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 130/181 (72%), Gaps = 17/181 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ--EKHFEIDFTRSNLTSYN  553
            D FLDF+Y  ++++N+  N  N D VVP+QT  T AP++    E  F+IDF RS L+S+N
Sbjct  179  DPFLDFDYSNNFQNNNCSNAMN-DSVVPVQTKPTPAPMMNHNSEGCFDIDFCRSKLSSFN  237

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISYRNIGG-----GSVDS-----RGGSQWNGM  406
                +      SSSLDVGVVPDG++VSEISY N G      G V+S     +G +Q  GM
Sbjct  238  YPSHSISHSVSSSSLDVGVVPDGNTVSEISY-NFGSESMVSGGVNSSNQGVQGATQLCGM  296

Query  405  DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSA  226
            DREARV+RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  +SD+D L++ A
Sbjct  297  DREARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEI--DSDVDRLYNPA  354

Query  225  D  223
            D
Sbjct  355  D  355



>ref|XP_010246902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like, partial 
[Nelumbo nucifera]
Length=297

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 123/192 (64%), Gaps = 16/192 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESN-SHQNQYNSDRVVPIQTIKTSAPII-PQEKHFEIDFTRSNLTSYN  553
            D +LD +Y  S ++   HQN   +D VVP+ T  T +P + P ++ F++DF RS   SY+
Sbjct  108  DPYLDLDYASSMDARYHHQNSAGADSVVPVHTKPTPSPFMHPSDQCFDMDFCRSK-PSYS  166

Query  552  SGFTKpslsvsssldvgvvpdgssvSEIS-YRNIGG--GSVD------SRGGSQWNGMDR  400
                  S SVSSS     V    S + IS   N  G  G +D      + G SQ +GMDR
Sbjct  167  YTTPSLSQSVSSSSLDVGVVPDGSSNTISDISNPFGRKGGIDGTLGAGNHGASQLSGMDR  226

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS  220
            EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+E E  +D ++SSA +
Sbjct  227  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIEIE--VDRIYSSAAA  284

Query  219  -AADVGRFSVVP  187
              AD G + +VP
Sbjct  285  LMADTG-YGIVP  295



>ref|XP_011079319.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Sesamum 
indicum]
Length=368

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 128/194 (66%), Gaps = 21/194 (11%)
 Frame = -1

Query  729  SDNFLDFE-YPVSWESNSHQNQYNSDRVVPIQT-IKTSAPI-----IPQEKHFEIDFTRS  571
            SD FLDF+ Y +S ++      Y  D VVP+QT IK S P+        E  FEIDFTRS
Sbjct  181  SDQFLDFDNYQISSQT------YGGDSVVPVQTTIKPSVPVQSTHQFSPENRFEIDFTRS  234

Query  570  NLTSYNSGFTKpslsvsssldvgvv---pdgssvSEISYRNIGGGSVD--SRGGSQWNGM  406
             + SYNS +T PSLS S S     V   P+GSS+SEIS R +   S D  +    Q  G+
Sbjct  235  RIASYNSNYTTPSLSHSVSSSSMDVGIVPEGSSMSEISSRTMSTSSFDLSANPAPQPAGL  294

Query  405  DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSA  226
            DREARVLRY+EKRKNRKF+KTIRYASRKAYAETRPRIKGRFAKRT  +SESDID +FSS 
Sbjct  295  DREARVLRYKEKRKNRKFDKTIRYASRKAYAETRPRIKGRFAKRT--DSESDIDGIFSSG  352

Query  225  DSAADV-GRFSVVP  187
              +     R+ VVP
Sbjct  353  GGSFFGDARYGVVP  366



>ref|XP_002277953.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Vitis vinifera]
Length=361

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 127/193 (66%), Gaps = 15/193 (8%)
 Frame = -1

Query  726  DNFLDFEYP-VSWESNSHQNQYNSDRVVPIQTIKTSAPII--PQEKHFEIDFTRSNLTSY  556
            D FLDF+YP   +  + H +   +D VVP+Q    S P+   P +  FE+DF+RS L++Y
Sbjct  169  DPFLDFDYPDAKFPHHHHHHCGGNDGVVPVQAKDPSPPVTNHPADNCFELDFSRSKLSAY  228

Query  555  N-SGFTKpslsvsssldvgvvpdgssvSEISYRNI------GGGSVDSRGGSQWNGMDRE  397
            N +  +      SS + V    + +S+S+ SY ++      GGG       +Q +GMDRE
Sbjct  229  NYTAQSLSQSISSSDVGVVPDGNCNSMSDTSYPSMKQVSGGGGGGSTGSQATQLSGMDRE  288

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+ESE  +D +++SA +A
Sbjct  289  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEMESEM-VDHIYNSASAA  347

Query  216  A---DVGRFSVVP  187
            A   D G + VVP
Sbjct  348  AFMVDAG-YGVVP  359



>ref|XP_007154800.1| hypothetical protein PHAVU_003G149000g [Phaseolus vulgaris]
 gb|ESW26794.1| hypothetical protein PHAVU_003G149000g [Phaseolus vulgaris]
Length=369

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 121/197 (61%), Gaps = 26/197 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNS-HQNQYNSDRVVPIQTIKTSAPIIPQEKH-----FEIDFTRSNL  565
            D FLDF+Y     SNS H N   +D VVP+QT  + AP +    H     F+IDF RS L
Sbjct  180  DPFLDFDY-----SNSFHNNNSGNDSVVPVQTKPSFAPPLINNHHQSESCFDIDFCRSKL  234

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISY---RN------IG-GGSVDSRGGSQW  415
            +S+N  +   SLS S S     V      + +SY   RN      IG  G    +G +Q 
Sbjct  235  SSFN--YPSQSLSQSVSSSSLDVGVVPDGNTVSYSFGRNSSESSGIGLSGVSGGQGATQL  292

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLF  235
             GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT  E++SD++ L+
Sbjct  293  CGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT--ETDSDVERLY  350

Query  234  SSADSAADV-GRFSVVP  187
            S   ++  +   + VVP
Sbjct  351  SPGAASLMLDSPYGVVP  367



>ref|NP_001240941.1| zinc finger protein CONSTANS-LIKE 5-like [Glycine max]
 gb|ACX42572.1| CONSTANS-like zinc finger protein [Glycine max]
Length=365

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 132/195 (68%), Gaps = 26/195 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPI-IPQEKH-------FEIDFT  577
            D FLDF+Y     SNS QN  ++  D VVP+QT  + AP  I   +H       F+IDF 
Sbjct  180  DPFLDFDY-----SNSFQNHNSAVNDSVVPVQTKPSLAPPPINNHQHHHQSETCFDIDFC  234

Query  576  RSNLTSYN-SGFTKpslsvsssldvgvvpdgssvSEISYRN---IGGGSVDSRGGSQWNG  409
            RS L+S+N    +      SSSLDVGVVPDG++VS++SY +   + GG    +G +Q  G
Sbjct  235  RSKLSSFNYPSQSLSQSVSSSSLDVGVVPDGNTVSDMSYSSGIVVSGG----QGATQLCG  290

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  +SD++ L+S 
Sbjct  291  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEI--DSDVERLYSP  348

Query  228  ADSAADVGR-FSVVP  187
              +A  +   + VVP
Sbjct  349  GAAALMLDTPYGVVP  363



>ref|XP_011018162.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Populus euphratica]
Length=380

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 128/197 (65%), Gaps = 19/197 (10%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQ--NQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D FL+F+Y  S + +  Q      +D VVP+QT     P+I  E  F+IDF RS LTS+N
Sbjct  184  DPFLEFKYQNSIDESYEQIHGGAGADSVVPVQTKPAPLPVINHESCFDIDFCRSKLTSFN  243

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISY---RNIG---------GGSVDSRGGSQWN  412
             S  ++      SSLDVGVVPDG+S+S+ISY   R++           G    +  +Q  
Sbjct  244  YSPQSRSHSVSPSSLDVGVVPDGNSMSDISYPFSRSMNTTIDPSMPLSGCTAYQAATQLA  303

Query  411  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFS  232
            G+DREARVLRY+EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ESD D LF+
Sbjct  304  GIDREARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEM--ESDTDNLFN  361

Query  231  SADSAADVG--RFSVVP  187
            S  S   +   ++ VVP
Sbjct  362  SPSSVPFMADTQYGVVP  378



>gb|KHN17564.1| Zinc finger protein CONSTANS-LIKE 5 [Glycine soja]
Length=359

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 125/184 (68%), Gaps = 25/184 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKH------FEIDFTRSNL  565
            D FLDF+Y  S+++N   N   +D VVP+Q    + P+I    H      F++DF RS L
Sbjct  164  DPFLDFDYSNSFQNN---NSAGNDSVVPVQKPSLAPPLINNHHHHQSETCFDVDFCRSKL  220

Query  564  TSYN-SGFTKpslsvsssldvgvvpdgssvSEISY---RN---------IGGGSVDSRGG  424
            +S+N    +      SSSLDVGVVPDG++VS++SY   RN         + G SV  +G 
Sbjct  221  SSFNYPSNSLSQSVSSSSLDVGVVPDGNTVSDMSYSFGRNSSDSSGIVVVSGNSV-GQGA  279

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  +SD++
Sbjct  280  TQLCGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEI--DSDVE  337

Query  243  TLFS  232
             L+S
Sbjct  338  RLYS  341



>ref|NP_001239972.1| zinc finger protein CONSTANS-LIKE 5-like [Glycine max]
 gb|ACX42570.1| CONSTANS-like zinc finger protein [Glycine max]
Length=374

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 125/184 (68%), Gaps = 25/184 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKH------FEIDFTRSNL  565
            D FLDF+Y  S+++N   N   +D VVP+Q    + P+I    H      F++DF RS L
Sbjct  179  DPFLDFDYSNSFQNN---NSAGNDSVVPVQKPSLAPPLINNHHHHQSETCFDVDFCRSKL  235

Query  564  TSYN-SGFTKpslsvsssldvgvvpdgssvSEISY---RN---------IGGGSVDSRGG  424
            +S+N    +      SSSLDVGVVPDG++VS++SY   RN         + G SV  +G 
Sbjct  236  SSFNYPSNSLSQSVSSSSLDVGVVPDGNTVSDMSYSFGRNSSDSSGIVVVSGNSV-GQGA  294

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  +SD++
Sbjct  295  TQLCGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEI--DSDVE  352

Query  243  TLFS  232
             L+S
Sbjct  353  RLYS  356



>gb|KDP43803.1| hypothetical protein JCGZ_23011 [Jatropha curcas]
Length=367

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 126/195 (65%), Gaps = 25/195 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D FLD ++        HQN + +  D VVP+QT  +  PII  E  +++DF RS L+S N
Sbjct  181  DPFLDMDF--------HQNHHTAATDSVVPVQTKPSPMPIINNEICYDVDFCRSKLSSLN  232

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGG-------SVDSRGGSQWNGM  406
                +      SSS+DVGVVPDG+S+S+ISY   +NI          S  +   SQ  G+
Sbjct  233  YPTQSISQSVSSSSVDVGVVPDGNSMSDISYPFGQNINNSAGPNVSISATASQASQAPGI  292

Query  405  DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSA  226
            DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ESD++ L+ S 
Sbjct  293  DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEI--ESDMNHLYGSP  350

Query  225  DSAADV--GRFSVVP  187
             S   +   R+ VVP
Sbjct  351  SSVGFISDSRYGVVP  365



>dbj|BAB09583.1| CONSTANS-like B-box zinc finger protein-like [Arabidopsis thaliana]
Length=351

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLT--SYN  553
            D  +DFE+P S+  N HQN    D +VP+QT     P+   +  F+IDF RS L+  +Y 
Sbjct  180  DRLIDFEFPNSF--NHHQNNAGGDSLVPVQTKTEPLPLTNNDHCFDIDFCRSKLSAFTYP  237

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYRE  373
            S     S      +  G   +  + S I+    GG         Q + MDREARVLRYRE
Sbjct  238  SQSVSTSSIEYGVVPDGNTNNSVNRSTITSSTTGGDH-------QASSMDREARVLRYRE  290

Query  372  KRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSV  193
            KRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D   S   ++A   ++ V
Sbjct  291  KRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DIFLSHVYASAAHAQYGV  347

Query  192  VP  187
            VP
Sbjct  348  VP  349



>ref|XP_007014105.1| Zinc finger protein CONSTANS-LIKE 5, putative [Theobroma cacao]
 gb|EOY31724.1| Zinc finger protein CONSTANS-LIKE 5, putative [Theobroma cacao]
Length=367

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 128/195 (66%), Gaps = 22/195 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D F+DFEY      NS Q   N+  D VVP+Q    + P+I  E  F+IDF RS LT+++
Sbjct  178  DPFIDFEY-----QNSFQPHNNAAMDSVVPVQAKPATIPVINNENCFDIDFCRSKLTAFS  232

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVD------SRGGSQWNGMD  403
                +      SSSL+VGVVPDG+++SEISY   R +   SV       +    Q  G+D
Sbjct  233  YQTPSLSQSVSSSSLEVGVVPDGNTLSEISYPFGRTMTDPSVPISATTTNNQAPQACGID  292

Query  402  REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSAD  223
            REARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR E+++E  +D +++S  
Sbjct  293  REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRAEIDNE--VDHMYNSPS  350

Query  222  SAADV---GRFSVVP  187
            +AA      ++SVVP
Sbjct  351  AAAAFMSDAQYSVVP  365



>ref|NP_568863.1| zinc finger protein CONSTANS-LIKE 5 [Arabidopsis thaliana]
 sp|Q9FHH8.2|COL5_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 5 [Arabidopsis 
thaliana]
 gb|AAL15263.1| AT5g57660/MRI1_1 [Arabidopsis thaliana]
 gb|AAL85993.1| putative CONSTANS B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM45054.1| putative CONSTANS B-box zinc finger protein [Arabidopsis thaliana]
 gb|AED96933.1| zinc finger protein CONSTANS-LIKE 5 [Arabidopsis thaliana]
Length=355

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 112/183 (61%), Gaps = 12/183 (7%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFE+P S+  N HQN    D +VP+QT     P+   +  F+IDF RS L    S 
Sbjct  180  DRLIDFEFPNSF--NHHQNNAGGDSLVPVQTKTEPLPLTNNDHCFDIDFCRSKL----SA  233

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSR---GGSQWNGMDREARVLRYR  376
            FT PS SVS S+    +  G      +  ++   ++ S    G  Q + MDREARVLRYR
Sbjct  234  FTYPSQSVSHSVSTSSIEYGVVPDGNTNNSVNRSTITSSTTGGDHQASSMDREARVLRYR  293

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D   S   ++A   ++ 
Sbjct  294  EKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DIFLSHVYASAAHAQYG  350

Query  195  VVP  187
            VVP
Sbjct  351  VVP  353



>gb|AAM65968.1| CONSTANS-like B-box zinc finger protein-like [Arabidopsis thaliana]
Length=355

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 112/183 (61%), Gaps = 12/183 (7%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFE+P S+  N HQN    D +VP+QT     P+   +  F+IDF RS L    S 
Sbjct  180  DRLIDFEFPNSF--NHHQNNAGGDSLVPVQTKTEPLPLTNNDHCFDIDFCRSKL----SA  233

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSR---GGSQWNGMDREARVLRYR  376
            FT PS SVS S+    +  G      +  ++   ++ S    G  Q + MDREARVLRYR
Sbjct  234  FTYPSQSVSHSVSTSSIEYGVVPDGNTNNSVNRSTITSSTTGGDHQASSMDREARVLRYR  293

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D   S   ++A   ++ 
Sbjct  294  EKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DIFLSHVYASAAHAQYG  350

Query  195  VVP  187
            VVP
Sbjct  351  VVP  353



>ref|XP_004146352.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis 
sativus]
Length=322

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 123/199 (62%), Gaps = 27/199 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ----EKHFEIDFTRSNLTS  559
            D+F+DFEYP    ++S  N    D VVP+QT     P+I Q    E  ++IDF RS L S
Sbjct  130  DSFIDFEYPNPVNNHSAIN----DSVVPVQTKPLLTPVINQTHSPENCYDIDFCRSKLNS  185

Query  558  YNSGFTKpslsvsssldvgvvpdg---ssvSEISY---RNIGGG-------SVDSRGGSQ  418
            +  G+   SLS S S     V      +SVS+ISY   +N+  G       S      +Q
Sbjct  186  F--GYQPQSLSHSVSSSSLEVGVVPEGNSVSDISYPMGQNVSTGADSGLPLSGSGNQATQ  243

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
              GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT++ SE  +D +
Sbjct  244  LCGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDMLSE--VDEI  301

Query  237  FSSADSAADV--GRFSVVP  187
            + SA S+  +   ++ VVP
Sbjct  302  YGSAASSVFLTDAQYGVVP  320



>ref|XP_010047014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Eucalyptus grandis]
Length=379

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 133/202 (66%), Gaps = 33/202 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYN---SDRVVPIQTIKTSAPII--PQEKHFEIDFTRSNLT  562
            + FLDFE       N+  ++++   +D +VP+QT    AP++    E  F+IDF RS LT
Sbjct  187  ETFLDFEC-----GNNSMDRFHGSATDSLVPVQTKPAPAPVVHPSSENCFDIDFCRSKLT  241

Query  561  SYNSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVD------------SRG  427
            S++          SSSLDVGVVP+G+S+S+ISY   +++ G S D            +  
Sbjct  242  SFSY---LSHSVSSSSLDVGVVPEGNSMSDISYPFVQSMSGNSTDLSITNSAATTTTANQ  298

Query  426  GSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
             +  +GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+ESE  +
Sbjct  299  PTPMSGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIESE--V  356

Query  246  DTLFSSADSA--ADVGRFSVVP  187
            D ++ +A +A  AD  R+ VVP
Sbjct  357  DNIYGTASAAFMAD-SRYGVVP  377



>ref|XP_004167377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis 
sativus]
 gb|KGN65418.1| Zinc finger protein [Cucumis sativus]
Length=375

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 123/199 (62%), Gaps = 27/199 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ----EKHFEIDFTRSNLTS  559
            D+F+DFEYP    ++S  N    D VVP+QT     P+I Q    E  ++IDF RS L S
Sbjct  183  DSFIDFEYPNPVNNHSAIN----DSVVPVQTKPLLTPVINQTHSPENCYDIDFCRSKLNS  238

Query  558  YNSGFTKpslsvsssldvgvvpdg---ssvSEISY---RNIGGG-------SVDSRGGSQ  418
            +  G+   SLS S S     V      +SVS+ISY   +N+  G       S      +Q
Sbjct  239  F--GYQPQSLSHSVSSSSLEVGVVPEGNSVSDISYPMGQNVSTGADSGLPLSGSGNQATQ  296

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
              GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT++ SE  +D +
Sbjct  297  LCGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDMLSE--VDEI  354

Query  237  FSSADSAADV--GRFSVVP  187
            + SA S+  +   ++ VVP
Sbjct  355  YGSAASSVFLTDAQYGVVP  373



>dbj|BAJ33765.1| unnamed protein product [Thellungiella halophila]
Length=221

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 113/185 (61%), Gaps = 11/185 (6%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLT--SYN  553
            D  +DFEYP S+      N   +D +VP+QT     P+      F+IDF RS L+  +Y 
Sbjct  41   DRLIDFEYPNSFNHQPPHNSAGADSLVPVQTKTEPLPLTNNGHCFDIDFCRSKLSAFTYP  100

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWNGMDREARVLR  382
            S     S+S SS     V    +SVSEIS    R+   GS  +  G Q + MDREARVLR
Sbjct  101  SQSISHSVSTSSLEYGVVPDGNTSVSEISIPFKRSTITGST-ATTGDQASSMDREARVLR  159

Query  381  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGR  202
            YREKRKNR+FEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D   S   ++A   +
Sbjct  160  YREKRKNRRFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DVFLSHVYASA--AQ  214

Query  201  FSVVP  187
            + VVP
Sbjct  215  YGVVP  219



>ref|XP_008453645.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis 
melo]
Length=364

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 128/199 (64%), Gaps = 30/199 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYN--SDRVVPIQTIKTSAPIIPQ----EKHFEIDFTRSNL  565
            D+F+DFEYP     NS  + +N  +D VVP+QT     P+I      E  ++IDF RS L
Sbjct  175  DSFIDFEYP-----NSVSDDHNDINDSVVPVQTKPHPTPVINHSHSPENCYDIDFCRSKL  229

Query  564  TSYNSGF---TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDS--------RGGSQ  418
             S+  G+   +      SSSLDVGVVP  +S+SEISY    G +VDS           +Q
Sbjct  230  NSF--GYQPQSLSHSVSSSSLDVGVVPQANSMSEISYPM--GQTVDSGLPLSGSGNQATQ  285

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
              G+DREARVLRYREKRKNRKFEKT+RYASRKAYAETRPRIKGRFAKRT++ SE  +D +
Sbjct  286  LCGIDREARVLRYREKRKNRKFEKTVRYASRKAYAETRPRIKGRFAKRTDMVSE--VDEI  343

Query  237  FSSADSAADV--GRFSVVP  187
            + SA S   +   ++ +VP
Sbjct  344  YGSAASPVFLTDAQYGIVP  362



>ref|XP_006401182.1| hypothetical protein EUTSA_v10013919mg [Eutrema salsugineum]
 gb|ESQ42635.1| hypothetical protein EUTSA_v10013919mg [Eutrema salsugineum]
Length=359

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 11/185 (6%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLT--SYN  553
            D  +DFEYP S+      N   +D +VP+QT     P+   +  F+IDF RS L+  +Y 
Sbjct  179  DRLIDFEYPNSFNHQPPHNSAGADSLVPVQTKTEPLPLTNNDHCFDIDFCRSKLSAFTYP  238

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWNGMDREARVLR  382
            S     S+S SS     V    +SVSEIS    R+   GS  +  G Q + MDREARVLR
Sbjct  239  SQSISHSVSTSSLEYGVVPDGNTSVSEISIPFKRSTITGST-ATTGDQASSMDREARVLR  297

Query  381  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGR  202
            YREKRKNR+FEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D   S   ++A   +
Sbjct  298  YREKRKNRRFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DVFLSHVYASA--AQ  352

Query  201  FSVVP  187
            + VVP
Sbjct  353  YGVVP  357



>ref|XP_010259762.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Nelumbo 
nucifera]
Length=374

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 121/192 (63%), Gaps = 18/192 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESN-SHQNQYNSDRVVPIQTIKTSAPII-PQEKHFEIDFTRSNLTSYN  553
            D +LD +Y  S E+   HQN  N+D VVP+ T     P++   ++ F++ F RS   SY 
Sbjct  187  DPYLDLDYGSSMETRYHHQNSANADSVVPVHTKPPPPPLMNTSDRCFDMGFCRSK-PSY-  244

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGG-----GSVDSRGGS----QWNGMDR  400
             G+T P+LS S S     V      +  +  +I       G VD+ GG+    Q +GMDR
Sbjct  245  -GYTTPTLSQSVSSSSLDVGVVPDGNSNAISDITNPFGRKGGVDAGGGNHGAPQLSGMDR  303

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS-AD  223
            EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR E++SE  +D ++SS A 
Sbjct  304  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRVEIDSE--VDRIYSSTAA  361

Query  222  SAADVGRFSVVP  187
              AD G + VVP
Sbjct  362  FIADTG-YGVVP  372



>ref|XP_002533687.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF28695.1| zinc finger protein, putative [Ricinus communis]
Length=388

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 133/200 (67%), Gaps = 28/200 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSA----PIIPQEKHFEIDFTRSNLTS  559
            D FLD E+    ++N+H +  N D VVP+Q  K +A    P++  +  ++IDF R+ L+S
Sbjct  195  DPFLDLEF---HQNNNHSSAAN-DSVVPVQITKPAAASSIPVMNNDICYDIDFCRTKLSS  250

Query  558  YN-SGFTKpslsvsssldvgvvpdgssvSEISY---RN----------IGGGSVDSRGGS  421
            +N    +      SSSLDVGVVPDGSS S+ISY   RN          I G S +    +
Sbjct  251  FNYPTQSLSQSVSSSSLDVGVVPDGSSTSDISYPFGRNMNTCTDPSGPISGNSTNQ--AA  308

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q  G++REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ++D+D 
Sbjct  309  QMCGINREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEI--DTDMDR  366

Query  240  LFSSADSAADVG--RFSVVP  187
            L++S  S + +G  ++ VVP
Sbjct  367  LYNSPSSVSYLGDAQYGVVP  386



>ref|XP_008453644.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis 
melo]
Length=375

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 120/199 (60%), Gaps = 27/199 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ----EKHFEIDFTRSNLTS  559
            D+F+DFEYP    ++S  N    D VVP+QT     P+       E  ++IDF RS L S
Sbjct  183  DSFIDFEYPNPVNNHSAIN----DSVVPVQTKPLPTPVTNHTHSPENCYDIDFCRSKLNS  238

Query  558  YNSGFTKpslsvsssldvgvvpdgs---svSEISY---RNIGGG-------SVDSRGGSQ  418
            +  G+   SLS S S     V       S+SEISY   +N+  G       S      +Q
Sbjct  239  F--GYQPQSLSHSVSSSSLEVGVVPEGNSMSEISYPMGQNVSTGADSGLRLSGPGNQATQ  296

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
              GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT++ SE  +D +
Sbjct  297  LCGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDMLSE--VDEI  354

Query  237  FSSADSAADV--GRFSVVP  187
            + SA S+  +   ++ VVP
Sbjct  355  YGSAASSVFLTDAQYGVVP  373



>ref|XP_002324491.1| hypothetical protein POPTR_0018s10510g [Populus trichocarpa]
 gb|EEF03056.1| hypothetical protein POPTR_0018s10510g [Populus trichocarpa]
Length=362

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 116/184 (63%), Gaps = 11/184 (6%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQ--YNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D FL+ EY  S +++  +      +D VVP+QT     P+I  E  F+IDF RS LTS++
Sbjct  184  DPFLELEYQNSIDASYEKIHGGAGADSVVPVQTKPAPLPVINHESCFDIDFCRSKLTSFS  243

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYRE  373
                  S SVSSS     V    +    S   + G + + +  +Q  G+DREARVLRYRE
Sbjct  244  YSSQSLSHSVSSSSLDVGVVPDGN----SIMPLSGWTAN-QAATQLAGIDREARVLRYRE  298

Query  372  KRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVG--RF  199
            +RKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ESD+D L++S  S   +   ++
Sbjct  299  RRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEM--ESDMDNLYNSPSSVPFMADTQY  356

Query  198  SVVP  187
             VVP
Sbjct  357  GVVP  360



>ref|XP_004146297.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis 
sativus]
 ref|XP_004167376.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Cucumis 
sativus]
 gb|KGN65417.1| CONSTANS-like zinc finger protein [Cucumis sativus]
Length=368

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 126/199 (63%), Gaps = 29/199 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQ----EKHFEIDFTRSNL  565
            D+F+DFEYP     NS  + +N   D +VP+QT     P+I      E  ++I+F RS L
Sbjct  176  DSFIDFEYP-----NSVNDDHNDIKDSIVPVQTKPDPTPVINHTHSPENCYDIEFCRSKL  230

Query  564  TSYNSGF---TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDS--------RGGSQ  418
             S+  G+   +      SSSLDVGVVP   S+SE SY  +GG + DS           +Q
Sbjct  231  NSF--GYQPQSLSHSVSSSSLDVGVVPQAISMSETSYP-MGGQTGDSGLPLSGSGNQATQ  287

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
              GMDREARVLRYREKRKNRKFEKT+RYASRKAYAETRPRIKGRFAKRT++ SE  +D +
Sbjct  288  LCGMDREARVLRYREKRKNRKFEKTVRYASRKAYAETRPRIKGRFAKRTDMLSE--VDEM  345

Query  237  FSSADSAADV--GRFSVVP  187
            + SA S   +   ++ +VP
Sbjct  346  YGSAASHVLLTDAQYGLVP  364



>ref|XP_006474138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Citrus sinensis]
 gb|KDO62430.1| hypothetical protein CISIN_1g017166mg [Citrus sinensis]
Length=376

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 121/186 (65%), Gaps = 34/186 (18%)
 Frame = -1

Query  714  DFEYPVSWESNSHQNQYNS--DRVVPIQTIK---------TSAPIIPQEKHFEIDFTRSN  568
            DF+YP     NS QN +++  D VVP+QT K            P+I  E  F+IDF RS 
Sbjct  181  DFDYP-----NSFQNHHSAGMDSVVPVQTTKPEPIPAQAAAPIPLINNENCFDIDFCRSK  235

Query  567  LTSYNSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGS-------VDSRGG--  424
            L+S+N    +     SSSLDVGVVPDG+S+S+ISY   RN+  GS       V + G   
Sbjct  236  LSSFN---YQSQSVSSSSLDVGVVPDGNSMSDISYTFGRNMSTGSGADPSVTVSAPGANQ  292

Query  423  -SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
             SQ  G+DREARVLRYREKRKNRKFEKTIRY SRKAYAETRPRIKGRFAKR E +SE  +
Sbjct  293  ASQLCGIDREARVLRYREKRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRAEADSE--V  350

Query  246  DTLFSS  229
            D L+ S
Sbjct  351  DRLYKS  356



>emb|CDY58843.1| BnaA02g35200D [Brassica napus]
Length=342

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 105/180 (58%), Gaps = 15/180 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFEYP         N + +D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  176  DRLIDFEYP---------NTFGADSLVPVQTKTEPLPVTNNDHCFDIDFCRSKLSTFTYP  226

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
             T+      S+  +         + + +      +     G Q + MDREARVLRYREKR
Sbjct  227  -TQSISHSVSTSSLEYGVVPDGTTSVPFNRSTITTSTGTTGEQPSSMDREARVLRYREKR  285

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D  FS   ++A  G++ VVP
Sbjct  286  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DVFFSQVYASA--GQYGVVP  340



>ref|NP_001288998.1| zinc finger protein CONSTANS-LIKE 5 [Brassica rapa]
 gb|ADK63391.1| B-box type zinc finger protein [Brassica rapa]
Length=342

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 105/180 (58%), Gaps = 15/180 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFEYP         N + +D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  176  DRLIDFEYP---------NTFGADSLVPVQTKTEPLPVTNNDHCFDIDFCRSKLSTFTYP  226

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
             T+      S+  +         + + +      +     G Q + MDREARVLRYREKR
Sbjct  227  -TQSISHSVSTSSLEYGVVPDGTTSVPFNRSTITTSTGTTGEQPSSMDREARVLRYREKR  285

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D  FS   ++A  G++ VVP
Sbjct  286  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DVFFSQVYASA--GQYGVVP  340



>emb|CDY49730.1| BnaA10g11600D [Brassica napus]
Length=218

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 106/198 (54%), Gaps = 36/198 (18%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFEYP S+  +   N   +D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  37   DRLIDFEYPNSFNHHPPHNSAGADSLVPVQTKTEPLPLSKNDHCFDIDFCRSKLSAFT--  94

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSR------------------GGS  421
                            +    S S + Y  +  G+  S                    G 
Sbjct  95   -----------YPTQSISHSVSTSSLEYGVVPDGNTSSEISIPFNRSTTTITASTATTGD  143

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q + M+REARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D 
Sbjct  144  QASSMNREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DV  200

Query  240  LFSSADSAADVGRFSVVP  187
             FS   ++A   ++ VVP
Sbjct  201  FFSHVYASA--AQYGVVP  216



>ref|XP_010102982.1| Zinc finger protein CONSTANS-LIKE 5 [Morus notabilis]
 gb|EXB94549.1| Zinc finger protein CONSTANS-LIKE 5 [Morus notabilis]
Length=368

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 109/181 (60%), Gaps = 24/181 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTS-APIIPQ-EKHFEIDFTRSNLTSYN  553
            D+FLD    + +  N       +D VVP++    S +P+I Q E  F+IDF RS L+S+ 
Sbjct  169  DSFLDV---LDYSGNPIHTSSGTDSVVPVKIKPVSPSPMINQSENCFDIDFCRSKLSSFT  225

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVD--------------SRGG  424
            +GF+    S S  + V    +  S  EISY   RN+   + D              +   
Sbjct  226  NGFSHSVSSSSLDVGVVPDGNSLS--EISYSFGRNLSQSTGDPIPSVPASSNSMSTAPQA  283

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q  GM REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+E ++D+D
Sbjct  284  TQLCGMAREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIELDADVD  343

Query  243  T  241
             
Sbjct  344  A  344



>ref|XP_006453443.1| hypothetical protein CICLE_v10008366mg [Citrus clementina]
 gb|ESR66683.1| hypothetical protein CICLE_v10008366mg [Citrus clementina]
Length=429

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 121/186 (65%), Gaps = 34/186 (18%)
 Frame = -1

Query  714  DFEYPVSWESNSHQNQYNS--DRVVPIQTIK---------TSAPIIPQEKHFEIDFTRSN  568
            DF+YP     NS QN +++  D VVP+QT K            P+I  E  F+IDF RS 
Sbjct  234  DFDYP-----NSFQNHHSAGMDSVVPVQTTKPEPIPAQAAAPIPLINNENCFDIDFCRSK  288

Query  567  LTSYNSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGS-------VDSRGG--  424
            L+S+N    +     SSSLDVGVVPDG+S+S+ISY   RN+  GS       V + G   
Sbjct  289  LSSFN---YQSQSVSSSSLDVGVVPDGNSMSDISYTFGRNMSTGSGADPSVTVSAPGANQ  345

Query  423  -SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
             SQ  G+DREARVLRYREKRKNRKFEKTIRY SRKAYAETRPRIKGRFAKR E +SE  +
Sbjct  346  ASQLCGIDREARVLRYREKRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRAEADSE--V  403

Query  246  DTLFSS  229
            D L+ S
Sbjct  404  DRLYKS  409



>ref|XP_006280689.1| hypothetical protein CARUB_v10026653mg [Capsella rubella]
 gb|EOA13587.1| hypothetical protein CARUB_v10026653mg [Capsella rubella]
Length=361

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 106/188 (56%), Gaps = 15/188 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN--  553
            D  +DFE+P S   + H      D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  179  DRLIDFEFPNSL--SHHHQPSGGDSLVPVQTKTEPLPLTNNDHCFDIDFCRSKLSAFTYS  236

Query  552  --SGFTKpslsvsssldvgvvpdgssvSEISY----RNIGGGSVDSRGGSQWNGMDREAR  391
              S     S S      V      + V EI        I   +  + GG Q N MDREAR
Sbjct  237  TQSLSHSVSTSSLEYGVVPDGNTNNCVPEIPIPFNRSGITSSTAATTGGDQTNSMDREAR  296

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAAD  211
            VLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D   S   ++A 
Sbjct  297  VLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DVFLSHVYASA-  352

Query  210  VGRFSVVP  187
              ++ VVP
Sbjct  353  -AQYGVVP  359



>ref|XP_006372098.1| hypothetical protein POPTR_0018s10510g [Populus trichocarpa]
 gb|ERP49895.1| hypothetical protein POPTR_0018s10510g [Populus trichocarpa]
Length=380

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 123/197 (62%), Gaps = 19/197 (10%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQ--YNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D FL+ EY  S +++  +      +D VVP+QT     P+I  E  F+IDF RS LTS++
Sbjct  184  DPFLELEYQNSIDASYEKIHGGAGADSVVPVQTKPAPLPVINHESCFDIDFCRSKLTSFS  243

Query  552  SGFTKpslsvsssldvgvvpdg-ssvSEISY---RNIG---------GGSVDSRGGSQWN  412
                  S SVSSS     V    +S+S+ISY   R++           G   ++  +Q  
Sbjct  244  YSSQSLSHSVSSSSLDVGVVPDGNSMSDISYPFSRSMNTTTDPSMPLSGWTANQAATQLA  303

Query  411  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFS  232
            G+DREARVLRYRE+RKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+  ESD+D L++
Sbjct  304  GIDREARVLRYRERRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEM--ESDMDNLYN  361

Query  231  SADSAADVG--RFSVVP  187
            S  S   +   ++ VVP
Sbjct  362  SPSSVPFMADTQYGVVP  378



>ref|XP_002864524.1| hypothetical protein ARALYDRAFT_495863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40783.1| hypothetical protein ARALYDRAFT_495863 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 110/188 (59%), Gaps = 13/188 (7%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN--  553
            D  +DFE+P S+   S+ N    D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  159  DRLIDFEFPNSFNHPSN-NDAGGDSLVPVQTKTEPLPLTNNDHCFDIDFCRSKLSAFTYP  217

Query  552  --SGFTKpslsvsssldvgvvpdgssvSEISY----RNIGGGSVDSRGGSQWNGMDREAR  391
              S     S S      V      +SVSEIS       I   +  S G  Q + MDREAR
Sbjct  218  SQSVSHSVSTSSIEYGVVPDGNTNNSVSEISIPFNRSMITTSTAASTGDHQTSSMDREAR  277

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAAD  211
            VLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E+    D +F S   A+ 
Sbjct  278  VLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEN----DDVFLSHVYASA  333

Query  210  VGRFSVVP  187
              ++ VVP
Sbjct  334  ATQYGVVP  341



>ref|XP_009120283.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Brassica rapa]
Length=356

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 106/198 (54%), Gaps = 36/198 (18%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFEYP S+  +   N   +D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  175  DRLIDFEYPNSFNHHPPHNSAGADSLVPVQTKTEPLPLSKNDHCFDIDFCRSKLSAFT--  232

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSR------------------GGS  421
                            +    S S + Y  +  G+  S                    G 
Sbjct  233  -----------YPTQSISHSVSTSSLEYGVVPDGNTSSEISIPFNRSTTTITASTATTGD  281

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q + M+REARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   D 
Sbjct  282  QASSMNREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---DV  338

Query  240  LFSSADSAADVGRFSVVP  187
             FS   ++A   ++ VVP
Sbjct  339  FFSHVYASA--AQYGVVP  354



>ref|XP_008789696.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X1 [Phoenix 
dactylifera]
Length=360

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 113/191 (59%), Gaps = 19/191 (10%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEID-FTRS--NLTSY  556
            D +LD +Y  S ++  HQ    +D VVP+Q      P  P     + D FTRS  + +SY
Sbjct  176  DPYLDLDYASSMDARFHQ----TDSVVPVQAKAVGGPPPPALLALDGDDFTRSKPSYSSY  231

Query  555  ------NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREA  394
                  +SG T  S  V    D      G   +     N  GG+   R G+    MDREA
Sbjct  232  TAHSVSHSGGTVSSSEVGVVPDGSCGGGGGVGAMADVTNPYGGA--GRAGNPAAQMDREA  289

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            RV+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTE+E+E  +D ++SSA +AA
Sbjct  290  RVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEIETE--VDRMYSSAAAAA  347

Query  213  DV--GRFSVVP  187
             +  G + VVP
Sbjct  348  FMVDGVYGVVP  358



>ref|XP_010443467.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Camelina 
sativa]
Length=374

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 115/207 (56%), Gaps = 38/207 (18%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYN---SDRVVPIQTIKTSAPIIPQEKH-FEIDFTRSNLTS  559
            D  +DFE+P    S SHQ+Q+     D +VP+QT     P+     H F+IDF RS L+S
Sbjct  177  DRLIDFEFP---NSLSHQHQHQPSGGDSLVPVQTKTEPLPLTNNNDHCFDIDFCRSKLSS  233

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSR-----------------  430
                FT P+ S+S  +         S S + Y  +  G+ ++                  
Sbjct  234  ----FTYPTQSLSYGVVPADQSSLLSTSSLEYGVVPDGNTNNNSVSEISIPFNRSTITTS  289

Query  429  ------GGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE  268
                  GG Q + MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE
Sbjct  290  TAATTTGGDQTSSMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTE  349

Query  267  VESESDIDTLFSSADSAADVGRFSVVP  187
             E+    D +F S   A+   ++ VVP
Sbjct  350  TEN----DDVFLSHVYASAAAQYGVVP  372



>emb|CDY25892.1| BnaC09g32640D [Brassica napus]
Length=333

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 100/180 (56%), Gaps = 23/180 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D  +DFEYP S+      N   +D +VP+QT     P+   +  F+IDF RS L+++   
Sbjct  175  DRLIDFEYPNSFNHQQPHNNAGADSLVPVQTKTEPLPLSKNDHCFDIDFCRSKLSAFT--  232

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                             P  S    +S       +  +  G Q + M+REARVLRYREKR
Sbjct  233  ----------------YPTQSISHSVSTSTTTITASTATTGDQASSMNREARVLRYREKR  276

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E+    D +F S    A   ++ VVP
Sbjct  277  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEN----DNVFLS-HVYASAAQYGVVP  331



>ref|XP_010452640.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Camelina 
sativa]
Length=377

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 111/207 (54%), Gaps = 35/207 (17%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKH-FEIDFTRSNLTSYNS  550
            D  +DFE+P S   + HQ     D +VP+QT     P+     H F+IDF RS L+S   
Sbjct  177  DRLIDFEFPNSLSHHHHQQPSGGDSLVPVQTKTEPLPLTNINDHCFDIDFCRSKLSS---  233

Query  549  GFTKpslsvsssldvgvvpdgssvSEISYRNIGGGS------------------------  442
             FT P+ S+S  +         S S + Y  +  G+                        
Sbjct  234  -FTYPTQSLSYGVVPADQSSLLSTSSLEYGVVPDGNNTNNNSVSEISIPFNRSTITTSST  292

Query  441  --VDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE  268
                + GG Q + MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE
Sbjct  293  AATTTTGGDQTSSMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTE  352

Query  267  VESESDIDTLFSSADSAADVGRFSVVP  187
             E+    D +F S   A+   ++ VVP
Sbjct  353  TEN----DDVFFSHVYASAAAQYGVVP  375



>ref|XP_008789698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X2 [Phoenix 
dactylifera]
Length=353

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 114/186 (61%), Gaps = 16/186 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFE-IDFTRSNLTSYNS  550
            D +LD +Y  S ++  HQ    +D VVP+Q      P  P     +  DFTRS   SY+S
Sbjct  176  DPYLDLDYASSMDARFHQ----TDSVVPVQAKAVGGPPPPALLALDGDDFTRSK-PSYSS  230

Query  549  GFTKpslsvsssldvgvvpdgssvSEISYRNIG---GGSVDSRGGSQWNGMDREARVLRY  379
             +T  S+S S    V     G      +  ++    GG+   R G+    MDREARV+RY
Sbjct  231  -YTAHSVSSSEVGVVPDGSCGGGGGVGAMADVTNPYGGA--GRAGNPAAQMDREARVMRY  287

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADV--G  205
            REKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTE+E+E  +D ++SSA +AA +  G
Sbjct  288  REKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEIETE--VDRMYSSAAAAAFMVDG  345

Query  204  RFSVVP  187
             + VVP
Sbjct  346  VYGVVP  351



>ref|XP_010536937.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Tarenaya 
hassleriana]
Length=367

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 115/196 (59%), Gaps = 21/196 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS--YN  553
            D  + FE P S+  +  QN   SD VVP+QT  +       +  F+IDF RS L++  Y 
Sbjct  175  DRLIGFECPNSF--HPPQNSGGSDSVVPVQTKPSHVSATNTDHCFDIDFCRSKLSALRYP  232

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRG-----------GSQW  415
            +  T  S+S SS     V    +S+SEIS    RN+ GGS  + G             Q 
Sbjct  233  TQSTSHSVSTSSLEFGVVPEGSTSLSEISIPFGRNVNGGSTATAGDPSPSLSVGTTNQQI  292

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLF  235
             G DREARV RYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE ++++DI  + 
Sbjct  293  CGSDREARVSRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTEADNDNDIVLVG  352

Query  234  SSADSAADVGRFSVVP  187
                SAA  G   VVP
Sbjct  353  HVYASAAQYG---VVP  365



>gb|AHI45076.1| COL domain class transcription factor [Boehmeria nivea]
Length=392

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 125/200 (63%), Gaps = 27/200 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVP--IQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D+FLDF+Y     SN       +D VVP  I+ I  S  I   +  F+I+F RS L+S+ 
Sbjct  198  DSFLDFDY-----SNPIHPSSGTDSVVPVKIKPISPSPVINNPDNCFDIEFCRSKLSSFA  252

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISY---RNIG---------GGSVDSRGGSQWN  412
                       SSSLDVGVVPDGSS SE+SY   R++          G +  S   +Q  
Sbjct  253  YPTQCLSHSVSSSSLDVGVVPDGSSASELSYAFGRSVSRAGSDPMQSGPASSSAPATQLC  312

Query  411  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD-----I  247
            G+DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+E E+D     +
Sbjct  313  GLDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIELENDNENDVV  372

Query  246  DTLFSSADSAADVGRFSVVP  187
            D ++ SA   AD  ++ VVP
Sbjct  373  DHIYGSA-FLADT-QYGVVP  390



>gb|AGS32266.1| CONSTANS-like protein [Litchi chinensis]
Length=374

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 124/187 (66%), Gaps = 28/187 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSA-PIIPQEKHFEIDFTRSNLTSY  556
            D F++FEY      NS QN +++  D VVP+QT K +  P+I  E  F+IDF RS L+S 
Sbjct  175  DPFIEFEY-----QNSFQNHHSAAMDSVVPVQTTKPAPIPMINNENCFDIDFCRSKLSSL  229

Query  555  N-SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGS--------------VDSR  430
            +    +      SSSLDVGVVPDG+S+S+ISY   RN+  G+                + 
Sbjct  230  SYPTQSISQSVSSSSLDVGVVPDGNSMSDISYPFGRNMTNGTDPTVPVSASAAAAAATAN  289

Query  429  GGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
              +Q  G+DREARVLRYREKRKNRKFEKTIRY SRKAYAETRPRIKGRFAKRT  +++SD
Sbjct  290  QATQLCGVDREARVLRYREKRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRT--DADSD  347

Query  249  IDTLFSS  229
            +D L+S+
Sbjct  348  VDRLYST  354



>gb|EYU34282.1| hypothetical protein MIMGU_mgv1a020062mg [Erythranthe guttata]
Length=371

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 113/194 (58%), Gaps = 21/194 (11%)
 Frame = -1

Query  729  SDNFLDFEYPVSWESNSHQNQYNSDRVVPIQTI---KTSAPII---PQEKHFEIDFTRSN  568
            SD  L+F+    + SN       +D VVP+QT       A +I   P E  FEIDFTRSN
Sbjct  184  SDQLLNFDNYQIFSSNPF-----NDSVVPVQTTVKPPVQAQLIHKQPPENRFEIDFTRSN  238

Query  567  LTSYNSGFTKpslsvsssldvgvvpdgssvSEISY----RNIGGGSVDSRGGSQWNGMDR  400
            +TSY +   + + S +    V  V  G      SY     ++   + D       N +DR
Sbjct  239  ITSYTNQKFQATSSSTDVGIVPDVSSGGVSETTSYPFATTSVKSENYDPIPIRSINHVDR  298

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS  220
            +ARVLRY+EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE   +SD D +FSS   
Sbjct  299  KARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEY--DSDADEIFSSGAG  356

Query  219  A---ADVGRFSVVP  187
            +   AD G + VVP
Sbjct  357  SNFFADAG-YGVVP  369



>gb|KJB23517.1| hypothetical protein B456_004G102000 [Gossypium raimondii]
 gb|KJB23518.1| hypothetical protein B456_004G102000 [Gossypium raimondii]
 gb|AJR28911.1| CONSTANS-like 7 protein [Gossypium raimondii]
Length=368

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 107/173 (62%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q +G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVDG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>ref|XP_010108302.1| Zinc finger protein CONSTANS-LIKE 4 [Morus notabilis]
 gb|EXC18782.1| Zinc finger protein CONSTANS-LIKE 4 [Morus notabilis]
Length=333

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 98/166 (59%), Gaps = 12/166 (7%)
 Frame = -1

Query  720  FLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            +LD +Y PV  +  +H QN   +D VVP+      API+  E  F++DF+ S    Y  G
Sbjct  160  YLDLDYGPVDLKLEAHEQNSSGTDGVVPVHNKSPQAPIV-NEPCFDLDFSASKPFVY--G  216

Query  546  FTKpslsvsssldvgvvpdgssvSEI-----SYRNIGGGSVDS--RGGSQWNGMDREARV  388
            +    LS S S     V      + I     +Y       VDS  R   Q +  DREARV
Sbjct  217  YNAHCLSHSVSSSSLDVGVVPDGNAITDISDAYTTPMNSGVDSSARHPVQISAADREARV  276

Query  387  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE + D
Sbjct  277  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVELDVD  322



>gb|AJR28929.1| CONSTANS-like 7 protein [Gossypium hirsutum var. marie-galante]
Length=368

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28919.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28927.1| CONSTANS-like 7 protein [Gossypium hirsutum]
Length=368

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28935.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28937.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28939.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28941.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28943.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28945.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28947.1| CONSTANS-like 7 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28949.1| CONSTANS-like 7 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28951.1| CONSTANS-like 7 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28955.1| CONSTANS-like 7 protein [Gossypium mustelinum]
 gb|AJR28957.1| CONSTANS-like 7 protein [Gossypium darwinii]
 gb|AJR28959.1| CONSTANS-like 7 protein [Thespesia populneoides]
Length=368

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28931.1| CONSTANS-like 7 protein [Gossypium hirsutum subsp. latifolium]
Length=368

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28953.1| CONSTANS-like 7 protein [Gossypium tomentosum]
Length=368

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28921.1| CONSTANS-like 7 protein [Gossypium hirsutum var. punctatum]
Length=368

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28923.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28925.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28933.1| CONSTANS-like 7 protein [Gossypium hirsutum f. palmeri]
Length=368

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  341



>gb|AJR28913.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28915.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28917.1| CONSTANS-like 7 protein [Gossypium hirsutum]
Length=368

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 105/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DFEY  S++    Q+    D VVP+QT   +  +I  E  F++DF RS   ++ S 
Sbjct  174  DPFIDFEYQDSFQ----QHDGAMDSVVPVQTKPATISMINNENCFDVDFCRSKFPTF-SY  228

Query  546  FTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSV---------DSRGGSQWNG  409
             TK      SS  + V      +SVS+ISY   R +G  S           +   +Q  G
Sbjct  229  QTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATANNQAPPQAQVGG  288

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR E ++E D
Sbjct  289  MDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRNETDNEVD  341



>ref|XP_011462636.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 126/200 (63%), Gaps = 27/200 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQ-YNSDRVVPIQTIKTS-APII---PQEKHFEIDFTRSNLT  562
            ++ L+F+YP     N  QN     D VVP+Q      AP++    QE  F+IDF RS L+
Sbjct  162  ESLLEFDYP-----NPIQNSSLGMDSVVPVQPDPIPPAPVLHQPSQESCFDIDFCRSKLS  216

Query  561  SYNS--GFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDS--------RGGS  421
            S  S    +      SSSLDVGVVPDG+S S+ISY    N+    +DS           +
Sbjct  217  SSFSYPAQSISQSVSSSSLDVGVVPDGNSFSDISYPFIANVNQNGMDSGVPAPATVSQAT  276

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q  G+DREARV+RYREKRKNR F+KTIRYASRKAYAETRPRIKGRFAKR+E E+E  +D 
Sbjct  277  QLTGVDREARVMRYREKRKNRTFQKTIRYASRKAYAETRPRIKGRFAKRSESETEV-MDR  335

Query  240  LFSSADSA--ADVGRFSVVP  187
            +F+SA  +  AD  ++ VVP
Sbjct  336  IFNSAPGSYIAD-AQYGVVP  354



>ref|XP_006845571.1| hypothetical protein AMTR_s00019p00192190 [Amborella trichopoda]
 gb|ERN07246.1| hypothetical protein AMTR_s00019p00192190 [Amborella trichopoda]
Length=390

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 120/191 (63%), Gaps = 22/191 (12%)
 Frame = -1

Query  726  DNFLDFEY--PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRS-NLTSY  556
            D +LD EY  PV     +H     +D VVP+Q+          ++  E DF+R  N  SY
Sbjct  209  DPYLDLEYGSPVDQRFQAHNG---TDSVVPVQSKGMG-----NDQCLEFDFSRPKNGYSY  260

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEIS---YRNIGGGS-----VDSRGGSQWNGMDR  400
             +  +      SSSLDVGVVPDGS++++IS    R + GG      V S+  S +  MDR
Sbjct  261  TTA-SMSHSVSSSSLDVGVVPDGSAMTDISNPYSRTLKGGQDLVAHVPSQPSSHYPPMDR  319

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS  220
            EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT++E E  +D ++SSA +
Sbjct  320  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVE--VDRIYSSAAA  377

Query  219  AADVGRFSVVP  187
                  + +VP
Sbjct  378  LMADTSYGIVP  388



>gb|AJR28936.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28938.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28942.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28944.1| CONSTANS-like 7 protein [Gossypium barbadense]
Length=369

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D F+DFEY      +S Q  ++   D VVP+QT      +I  E  F++DF RS   ++ 
Sbjct  174  DPFIDFEY-----QDSFQQHHDGAMDSVVPVQTKPAIISMINNENCFDVDFCRSKFPTF-  227

Query  552  SGFTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSVDSRGGS---------QW  415
            S  TK      SS  + V      +SVS+ISY   R +G  S      +         Q 
Sbjct  228  SYQTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATSNNQPPPQAQV  287

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
             GMDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  288  GGMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  342



>gb|KHG03714.1| Zinc finger CONSTANS-LIKE 5 -like protein [Gossypium arboreum]
 gb|AJR28912.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28914.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28916.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28918.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28922.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28924.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28926.1| CONSTANS-like 7 protein [Gossypium hirsutum]
 gb|AJR28928.1| CONSTANS-like 7 protein [Gossypium hirsutum var. marie-galante]
 gb|AJR28930.1| CONSTANS-like 7 protein [Gossypium hirsutum subsp. latifolium]
 gb|AJR28932.1| CONSTANS-like 7 protein [Gossypium hirsutum f. palmeri]
 gb|AJR28934.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28940.1| CONSTANS-like 7 protein [Gossypium barbadense]
 gb|AJR28946.1| CONSTANS-like 7 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28948.1| CONSTANS-like 7 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28950.1| CONSTANS-like 7 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28952.1| CONSTANS-like 7 protein [Gossypium tomentosum]
 gb|AJR28954.1| CONSTANS-like 7 protein [Gossypium mustelinum]
 gb|AJR28958.1| CONSTANS-like 7 protein [Thespesia populneoides]
Length=369

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D F+DFEY      +S Q  ++   D VVP+QT      +I  E  F++DF RS   ++ 
Sbjct  174  DPFIDFEY-----QDSFQQHHDGAMDSVVPVQTKPAIISMINNENCFDVDFCRSKFPTF-  227

Query  552  SGFTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSVDSRGGS---------QW  415
            S  TK      SS  + V      +SVS+ISY   R +G  S      +         Q 
Sbjct  228  SYQTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATSNNQPPPQAQV  287

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
             GMDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  288  GGMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  342



>gb|ADB93871.1| CCT domain protein [Arachis hypogaea]
Length=345

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 123/178 (69%), Gaps = 17/178 (10%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSHQNQYNSDRVVPIQTIKTSAPII---PQEKHFEIDFTRSNLTS  559
            D FLDF+Y      +N++ N   +D VVP+Q+    AP++    +   F+IDF RS L+S
Sbjct  135  DPFLDFDYSNSFQNNNNNNNSAGNDSVVPVQS--KPAPMMNHHAEGSCFDIDFCRSKLSS  192

Query  558  YN-SGFTKpslsvsssldvgvvpdgssvSEISY---RNI-----GGGSVDSRGGSQWNGM  406
            +N    +      SSSLDVGVVPDG++VS+ISY   RN       G +    GG+Q  GM
Sbjct  193  FNYPSQSISQSVSSSSLDVGVVPDGNTVSDISYSFGRNCSDSSGMGSAGSGGGGTQLCGM  252

Query  405  DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFS  232
            DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+ESE  +D L+S
Sbjct  253  DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIESE--VDRLYS  308



>gb|AJR28910.1| CONSTANS-like 7 protein [Gossypium herbaceum subsp. africanum]
Length=369

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D F+DFEY      +S Q  ++   D VVP+QT      +I  E  F++DF RS   ++ 
Sbjct  174  DPFIDFEY-----QDSFQQHHDGAMDSVVPVQTKPAIISMINNENCFDVDFCRSKFPTF-  227

Query  552  SGFTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSVDSRGGS---------QW  415
            S  TK      SS  + V      +SVS+ISY   R +G  S      +         Q 
Sbjct  228  SYQTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDPSAPIWAATSNNQPPPQAQV  287

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
             GMDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  288  GGMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  342



>gb|AJR28956.1| CONSTANS-like 7 protein [Gossypium darwinii]
Length=369

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D F+DFEY      +S Q  ++   D VVP+QT      +I  E  F++DF RS   ++ 
Sbjct  174  DPFIDFEY-----QDSFQQHHDGAMDSVVPVQTKPAIISMINNENCFDVDFCRSKFPTF-  227

Query  552  SGFTKpslsvsssldvgvvpdg--ssvSEISY---RNIGGGSVDSRGGS---------QW  415
            S  TK      SS  + V      +SVS+ISY   R +G  S      +         Q 
Sbjct  228  SYQTKSQSHSVSSSSLEVGVVPDGNSVSDISYTLGRTMGDLSAPIWAATSNNQPPPQAQV  287

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
             GMDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  288  GGMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  342



>ref|XP_009590370.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Nicotiana 
tomentosiformis]
 ref|XP_009618115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Nicotiana 
tomentosiformis]
Length=341

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 118/190 (62%), Gaps = 21/190 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSH-----QNQYNSDRVVPIQ----TIKTSAPIIPQEKHFEIDFTR  574
            D++LD +  +S +   H       QY+SD VVP+Q          P++     +E+DF  
Sbjct  161  DSYLDMDI-MSCDQKPHNILQLHQQYSSDGVVPVQKKNENNHLQGPVVDGFPTYEMDFIG  219

Query  573  SNLTSYN-SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDRE  397
            S    YN +  +      SSS+DVGVVP+ S+++++S   +   S D+   +  +G+DRE
Sbjct  220  SKPYLYNFNSQSISQSVSSSSMDVGVVPEHSAMADVSNTLVMNSSADAGVPNPVSGLDRE  279

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+E    +D+L      A
Sbjct  280  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIE----VDSLL-----A  330

Query  216  ADVGRFSVVP  187
            AD   + VVP
Sbjct  331  AD-ASYGVVP  339



>gb|AJR28920.1| CONSTANS-like 7 protein [Gossypium hirsutum var. punctatum]
Length=369

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 103/177 (58%), Gaps = 26/177 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D F+DFEY      +S Q  ++   D VVP+QT      +I  E  F++DF RS   ++ 
Sbjct  174  DPFIDFEY-----QDSFQQHHDGAMDSVVPVQTKPAIISMINNENCFDVDFCRSKFPTF-  227

Query  552  SGFTKpslsvsssldvgvvpdg--ssvSEISYRNIGGGSVDSRGGSQW------------  415
            S  TK      SS  + V      +SVS+ISY    G ++D      W            
Sbjct  228  SYQTKSQSHSVSSSSLEVGVVPDGNSVSDISY--TLGRTMDDPSAPIWAATSNNQPPPQA  285

Query  414  --NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
               GMDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKR+E ++E D
Sbjct  286  QVGGMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSETDNEVD  342



>ref|XP_010483296.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Camelina 
sativa]
Length=375

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 113/205 (55%), Gaps = 33/205 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQ-YNSDRVVPIQTIKTSAPIIPQEKH-FEIDFTRSNLTSYN  553
            D  +DFE+P S   + HQ+Q    D +VP+QT      +     H F+IDF RS L+S  
Sbjct  177  DRLIDFEFPNSLSHHHHQHQPSGGDSIVPVQTKTEPLLLTNNNDHCFDIDFCRSKLSS--  234

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSR-------------------  430
              FT P+ S+S  +         S S + Y  +  G+ ++                    
Sbjct  235  --FTYPTQSLSYGVVPADQSSLLSTSSLEYGVVPDGNTNNNSVSEISIPFNRSTITTSTA  292

Query  429  ----GGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE  262
                GG Q + MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E
Sbjct  293  ATTTGGDQTSSMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETE  352

Query  261  SESDIDTLFSSADSAADVGRFSVVP  187
            +    D +F S   A+   ++ VVP
Sbjct  353  N----DDVFLSHVYASAAAQYGVVP  373



>ref|XP_009758697.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Nicotiana 
sylvestris]
Length=341

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 22/190 (12%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSH-----QNQYNSDRVVPIQTIKTSA----PIIPQEKHFEIDFTR  574
            D++LD +  +S +   H       QY SD VVP+Q    S+    P++     +E+DF  
Sbjct  162  DSYLDMDI-MSCDQKPHNILQLHQQYCSDGVVPVQNKNESSHLQGPVVDGFPTYEMDFIG  220

Query  573  SNLTSYN-SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDRE  397
            S    YN +  +      SSS+DVGVVP+ S+++++S   +   S D+   +  +G+DRE
Sbjct  221  SKPYLYNFNSQSISQSVSSSSMDVGVVPEHSAMADVSNSLVMNSSADTVANAV-SGLDRE  279

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+E    +D+L      A
Sbjct  280  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIE----VDSLL-----A  330

Query  216  ADVGRFSVVP  187
            AD   + VVP
Sbjct  331  AD-ASYGVVP  339



>ref|XP_010539452.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Tarenaya 
hassleriana]
Length=367

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 116/196 (59%), Gaps = 23/196 (12%)
 Frame = -1

Query  714  DFEYPVSWE-SNSHQNQYNS---DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS--YN  553
            DFE  + +E SNS Q  +NS   D VVP+QT          E  F+IDF RS L++  Y 
Sbjct  173  DFERLMEFENSNSFQPPHNSAGADSVVPVQTKPNPVTAANNEHCFDIDFCRSKLSTFCYP  232

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRG-----------GSQW  415
            S     S+S SS     V   G+S+SEIS    RN+  GS  + G             Q 
Sbjct  233  SQSISHSVSTSSIDFGVVPDGGTSLSEISIPYGRNMNAGSTGTVGDPSSSVSGGVTNQQT  292

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLF  235
             G DREARV RYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRT+ ++++D+  + 
Sbjct  293  CGSDREARVSRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTDGDNDNDVLLVG  352

Query  234  SSADSAADVGRFSVVP  187
                SA+   ++ VVP
Sbjct  353  HVYASAS---QYGVVP  365



>gb|KDP33477.1| hypothetical protein JCGZ_07048 [Jatropha curcas]
Length=339

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 108/186 (58%), Gaps = 21/186 (11%)
 Frame = -1

Query  720  FLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            +LD +Y PV  +  S  QN   +D VVP+Q+     P++  +  FE+DF+ S   +Y  G
Sbjct  165  YLDLDYGPVDPKLESQEQNSSGTDGVVPVQSKSVQTPLV-NDHCFELDFSGSKAFAY--G  221

Query  546  FTKpslsvsssldvgvvpdgs---svSEIS---YRNIGGGSVDSRGGSQWNGMDREARVL  385
            +    LS S S     V       ++ +IS    R++  G   +    Q + +DREARVL
Sbjct  222  YKAQCLSHSVSSSSLDVGVVPDGGNMVDISNPYSRSVSNGIESANQTVQLSAVDREARVL  281

Query  384  RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVG  205
            RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ E E D  +++          
Sbjct  282  RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDTEVEVDRSSIYG---------  332

Query  204  RFSVVP  187
             F VVP
Sbjct  333  -FGVVP  337



>gb|ACS94258.1| CONSTANS-like protein [Phalaenopsis hybrid cultivar]
Length=328

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 96/174 (55%), Gaps = 39/174 (22%)
 Frame = -1

Query  720  FLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSGFT  541
            +LD EY  S E+      Y SD VVP     +S  I+       +DF +S   +++   +
Sbjct  163  YLDLEYASSVEAG----IYQSDSVVPAGAGASSGLIM-------LDFGKSKPKTHSYTIS  211

Query  540  KpslsvsssldvgvvpdgssvSEISYRNIGGGSV-----DSRGGSQWNG-----MDREAR  391
                S                 E++    GGGS      +  GGS   G     MDREAR
Sbjct  212  HSMSSS----------------EVAVVPDGGGSALADVSNCAGGSGGMGERSAMMDREAR  255

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            V+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTEVE E  ID ++SS
Sbjct  256  VMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEVELE--IDQIYSS  307



>ref|XP_010541548.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Tarenaya 
hassleriana]
Length=334

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 110/188 (59%), Gaps = 17/188 (9%)
 Frame = -1

Query  729  SDNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            SD +LD +Y  V  +  +  QN   +D VVP+++ +   P +  E  +E+DF+     +Y
Sbjct  155  SDPYLDLDYGSVDPKMEAEEQNSSGTDGVVPMESSRVHVPTV-NENCYELDFSGGGSKAY  213

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGG-SVDSRGGSQ----WNGMDREAR  391
               +   S SVSS+     V      +  +    GGG + +S  GSQ     +  +REAR
Sbjct  214  AYSYDCISQSVSSTSLEVGVVPDGGATADATNVFGGGNAANSDSGSQRPVPLSPAEREAR  273

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAAD  211
            VLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR+EVE++++    +        
Sbjct  274  VLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRSEVETDAERCVFY--------  325

Query  210  VGRFSVVP  187
             G FSVVP
Sbjct  326  -GGFSVVP  332



>gb|KFK27307.1| constans-like zinc finger protein [Arabis alpina]
Length=341

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 107/186 (58%), Gaps = 26/186 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPII----PQEKHFEIDFTRSNLT-  562
            D  +DFEYP S            D +VP+QT     P+       +  F+IDF RS L+ 
Sbjct  174  DRLIDFEYPNS----------GGDSLVPVQTKTEPLPVTNNNNINDHCFDIDFCRSKLSA  223

Query  561  -SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVL  385
             +Y S     S+S SS     V    +SVSEIS        V+    +  + MDREARV+
Sbjct  224  FTYPSQSVSHSVSTSSMEYGVVPERNNSVSEISV------PVNRSMTTTGDQMDREARVM  277

Query  384  RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVG  205
            RYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E+    D +F S   A+   
Sbjct  278  RYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEN----DDVFLSHVYASAAA  333

Query  204  RFSVVP  187
            ++ VVP
Sbjct  334  QYGVVP  339



>gb|AHM25240.1| CO [Paeonia suffruticosa]
Length=373

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 123/200 (62%), Gaps = 24/200 (12%)
 Frame = -1

Query  726  DNFLDFEYP------VSWESNSHQNQYNSDRVVPIQTIKTSAPII---PQEKHFEIDFTR  574
            D +LD +Y          +    QN   +D VVP+Q+    AP++     E  FE+DFT 
Sbjct  176  DPYLDLDYASMDQKFQQQQQQHQQNSSGTDCVVPVQSQNLQAPLVNGGGSESCFEVDFTG  235

Query  573  SN---LTSYNSGFTKpslsvsssldvgvvpdgssvSEIS-------YRNIGGGSVDSRGG  424
            S      ++N+  +      SSS+DVGVVPDGS++ ++S         NI   + +    
Sbjct  236  SKAFPFNNFNNAHSLSQSVSSSSMDVGVVPDGSALVDVSNPFGRSQLNNIVCDATN-HPA  294

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
             Q +G+DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR+E+E E  +D
Sbjct  295  VQISGIDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSEIEVE--VD  352

Query  243  TLF-SSADSAADVGRFSVVP  187
             ++ ++A   AD G + +VP
Sbjct  353  QIYGTTAAFIADAG-YGIVP  371



>ref|XP_008220621.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Prunus mume]
Length=343

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 110/189 (58%), Gaps = 22/189 (12%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---L  565
            D +LD +Y       E    QN   +D VVP+Q+ K+  P +  +  FEIDF+ ++   +
Sbjct  166  DPYLDLDYGNVDPKLEDAQEQNSCGTDGVVPVQS-KSVQPQLVNDHSFEIDFSAASKPYV  224

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEIS--YRNIGGGSVDS-RGGSQWNGMDREA  394
              +++     S+S SS     V    ++++++S  Y      +V+S     Q +  DREA
Sbjct  225  YGFHAQCLSQSVSSSSMDVSVVPDGNTTMTDVSDPYTKSMSSAVESTHQAVQISSADREA  284

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E            A 
Sbjct  285  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIE------------AE  332

Query  213  DVGRFSVVP  187
             + R+ VVP
Sbjct  333  RLCRYGVVP  341



>ref|XP_007222404.1| hypothetical protein PRUPE_ppa008143mg [Prunus persica]
 gb|ACH73166.1| CONSTANS-like protein [Prunus persica]
 gb|EMJ23603.1| hypothetical protein PRUPE_ppa008143mg [Prunus persica]
Length=343

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 98/169 (58%), Gaps = 12/169 (7%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            D +LD +Y       E    QN   +D VVP+Q+ K+  P +  +  FEIDF+ ++   Y
Sbjct  166  DPYLDLDYGHVDPKLEDAQEQNSCGTDGVVPVQS-KSVQPQLVNDHSFEIDFSAAS-KPY  223

Query  555  NSGFTKpslsvsssldvgvv-------pdgssvSEISYRNIGGGSVDSRGGSQWNGMDRE  397
              GF    LS S S     V          + V +   +++      +    Q +  DRE
Sbjct  224  VYGFHAQCLSQSVSSSSMDVSVVPDGNTTMTDVCDPYTKSMSAAVESTHQAVQISSADRE  283

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E++
Sbjct  284  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIEAE  332



>ref|XP_007011648.1| CONSTANS-like 4 [Theobroma cacao]
 gb|EOY29267.1| CONSTANS-like 4 [Theobroma cacao]
Length=335

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 115/183 (63%), Gaps = 15/183 (8%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D +LD +Y  V  +  +  QN   +D VVP+Q+    AP++  +  F++DFT S   +Y 
Sbjct  163  DPYLDLDYGHVDPKMEAQEQNSSGTDGVVPVQSKSVQAPMV-NDHCFDLDFTGSKPFAYG  221

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYR  376
             +         SSSLDVGVVPDGS++++IS    G G+  +    Q +  DREARVLRYR
Sbjct  222  YNAHCVSHSVSSSSLDVGVVPDGSAMTDIS-NPYGRGAESTHQTVQLSSADREARVLRYR  280

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR+++E E+D   ++           F 
Sbjct  281  EKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRSDIEVEADRRNMYG----------FG  330

Query  195  VVP  187
            VVP
Sbjct  331  VVP  333



>ref|XP_002515382.1| Salt-tolerance protein, putative [Ricinus communis]
 gb|EEF46831.1| Salt-tolerance protein, putative [Ricinus communis]
Length=332

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 106/185 (57%), Gaps = 22/185 (12%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIK-TSAPIIPQEKHFEIDFTRSNLTSY  556
            D +LD +Y P   +  +  QN   +D VVP+++ K   AP +  +  FE+DFT S    Y
Sbjct  163  DPYLDLDYGPGDPKLEAQEQNSSGTDGVVPVKSSKNVQAPFV-NDNCFELDFTGSKPFPY  221

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEIS--YRNIGGGSVDSRGGSQWNGMDREARVLR  382
              G+    LS S S     V       +IS  Y      SV      Q + +DREARVLR
Sbjct  222  --GYNAQCLSNSVSSSSLDVGVVPDGGDISNPYSKSTMESV-----QQLSAVDREARVLR  274

Query  381  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGR  202
            YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+++ E         AD ++ +  
Sbjct  275  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIDVE---------ADRSSSINA  325

Query  201  FSVVP  187
            F VVP
Sbjct  326  FGVVP  330



>gb|ADN97077.1| CONSTANS-like protein [Cymbidium sinense]
Length=326

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 96/174 (55%), Gaps = 38/174 (22%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D FLD EY  S E+      Y SD VVP      S  I+       +DF+++  T    G
Sbjct  162  DPFLDLEYASSVETG----IYQSDSVVPAGGGAPSGLIM-------LDFSKAKTTH---G  207

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV--------DSRGGSQWNGMDREAR  391
            +T              V    S SE      GGG+          +  G +   MDREAR
Sbjct  208  YT--------------VSHSVSSSEAGVVPDGGGTAIADAPTCAAAAAGERSVMMDREAR  253

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            V+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTEVESE  ID ++SS
Sbjct  254  VMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE--IDQIYSS  305



>gb|AAC99310.1| CONSTANS-like protein 2 [Malus domestica]
 gb|ACD69428.1| CONSTANS-like 2 [Malus domestica]
 gb|ADL36664.1| COL domain class transcription factor [Malus domestica]
Length=329

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 88/163 (54%), Gaps = 11/163 (7%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P   E    QN   +D VVP+Q+ K   P++  ++ FE+DF+  +   
Sbjct  163  DPYLDLDYGHVDP-KLEEAQEQNSCGADGVVPVQS-KNMQPLLVNDQSFELDFSAGS---  217

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
                F                             +      S+   Q + +DR ARVLRY
Sbjct  218  --KPFVYGYHHARCLSQSVSSSSMDISVVPDGNAVTAAVETSQPAVQLSSVDRVARVLRY  275

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E++
Sbjct  276  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIEAE  318



>ref|XP_006342453.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Solanum 
tuberosum]
Length=357

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 118/199 (59%), Gaps = 30/199 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSH-----QNQYNSDRVVPIQ--------TIKTSAPIIPQEKHFEI  586
            D++LD +  +S E   H        Y+SD VVP+Q        +     P++     +EI
Sbjct  168  DSYLDIDL-MSCEQKPHIIHHQHGHYSSDGVVPVQNNNNNNETSTHLPGPVVDGFPTYEI  226

Query  585  DFTRSNLTSYN-SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQW--  415
            DF  S    YN +  +      SSS+DVGVVPD S+++++S   +   S  +  G+    
Sbjct  227  DFAGSKPYMYNFTSQSISQSVSSSSIDVGVVPDHSAMTDVSNTFVMNSSAGTGTGTDAVP  286

Query  414  ---NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
               +G+DREARV+RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE+E    ID
Sbjct  287  NAVSGLDREARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEIE----ID  342

Query  243  TLFSSADSAADVGRFSVVP  187
            +L      AAD   + VVP
Sbjct  343  SLI-----AAD-ASYGVVP  355



>ref|XP_008386560.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Malus domestica]
Length=329

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 87/162 (54%), Gaps = 9/162 (6%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            D +LD +Y       E    QN   +D VVP+Q+ K   P++  ++ FE+DF+  +    
Sbjct  163  DPYLDLDYGHVDPKLEEAQEQNSCGADGVVPVQS-KNMQPLLVNDQSFELDFSAGS----  217

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYR  376
               F                             +      S+   Q + +DR ARVLRYR
Sbjct  218  -KPFVYGYHHARCLSQSVSSSSMDISVVPDGNAVTAAVETSQPAVQLSSVDRVARVLRYR  276

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E++
Sbjct  277  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIEAE  318



>ref|XP_004253053.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Solanum 
lycopersicum]
Length=358

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 103/182 (57%), Gaps = 25/182 (14%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSH--------QNQYNSDRVVPIQ----TIKTSAPIIPQEKHFEID  583
            D++LD +  +S E   H         N Y+SD VVP+Q    T     P++     +E+D
Sbjct  168  DSYLDIDL-MSCEQKPHILHHQQHQHNHYSSDGVVPVQNNNETTHLPGPVVDGFPTYELD  226

Query  582  FTRSNLTSYNSGFTKpslsvsssldvgvvpdgssvSEIS------YRNIGGGSVDSRGG-  424
            FT S    YN  FT  S+S S S     V      S ++        N   G++   G  
Sbjct  227  FTGSKPYMYN--FTSQSISQSVSSSSLDVGVVPDHSTMTDVSNTFVMNSSSGAIAGAGAD  284

Query  423  ---SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESES  253
               +  +G+DREARV+RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTE E +S
Sbjct  285  VVPNAVSGLDREARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTETEIDS  344

Query  252  DI  247
             I
Sbjct  345  LI  346



>gb|AIE41594.1| zinc finger protein CONSTANS-LIKE 3 [Lagerstroemia indica]
Length=338

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 100/176 (57%), Gaps = 26/176 (15%)
 Frame = -1

Query  684  NSHQNQYNSDRVVPIQ-----TIKTSAPIIPQEKHFEIDFTRSNLTSYNSGFTKpslsvs  520
            N  ++ Y+SD VVP+Q     +     P++     +EID+  S    YN  FT  S+S S
Sbjct  177  NEQKHHYSSDGVVPVQKNEYGSGPYPGPVVDGFPTYEIDYPGSKPFMYN--FTSQSISQS  234

Query  519  ssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQW-----NGMDREARVLRYREKRKNRK  355
             S     V        +   N  G   DS   +       +G+DREARVLRYREKRKNRK
Sbjct  235  VSSSSLEVGV------VPDHNPMGDVSDSFAKNDAVPIPVSGLDREARVLRYREKRKNRK  288

Query  354  FEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            FEKTIRYASRKAYAETRPRIKGRFAKR+E+E ES I        +AAD   + VVP
Sbjct  289  FEKTIRYASRKAYAETRPRIKGRFAKRSELEVESLI--------AAADASSYGVVP  336



>ref|XP_008348263.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Malus domestica]
Length=114

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G+VD   GS      Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  16   ISHPRTPTGTVDLFSGSSIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  75

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +FS+   A +   + +VP
Sbjct  76   TRPRIKGRFAKRTEMEVE--VDQMFSTTLMAEN--GYGIVP  112



>dbj|BAO24102.1| CONSTANS-like protein [Lemna aequinoctialis]
Length=352

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 110/189 (58%), Gaps = 15/189 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQT-IKTSAPIIPQ----EKHFEIDFTRSNLT  562
            D +LD E   S +       +++D VVP+Q  I   A  +P     E   + DF+RS  +
Sbjct  168  DRYLDLECGSSMDDG---GIHHTDSVVPVQPKIGIPAVHLPPFYAPESCLDYDFSRSKAS  224

Query  561  SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWN-GMDREARVL  385
             Y++  +      SS + V       +     Y   G  ++  +  +Q   G+DREARV+
Sbjct  225  CYSTVPSLSQSMSSSDVGVVPDVSSMADISNPYGVPGVPAMVVQPQAQAAMGLDREARVM  284

Query  384  RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS---AA  214
            RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+++SE  +D +FS A     AA
Sbjct  285  RYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDMDSE--MDHIFSPAAGSLVAA  342

Query  213  DVGRFSVVP  187
            D G + +VP
Sbjct  343  DSG-YGLVP  350



>ref|XP_008782090.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Phoenix 
dactylifera]
Length=365

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 108/181 (60%), Gaps = 20/181 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQ----TIKTSAPIIPQEKHFEIDFTRS--NL  565
            D +LD EY  S +S   Q    +D VVP+Q          P++  +   ++DFTRS  + 
Sbjct  182  DPYLDLEYGSSMDSRFQQ----TDSVVPVQAKAVVCPPPPPLLAPDGGVDLDFTRSRPSY  237

Query  564  TSYNS----GFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDRE  397
            +SY +         S        V     G ++++++    GGG    R G+    +DRE
Sbjct  238  SSYTAHSLSHSVSSSEVGVVPEGVCGGGGGGAMADVTDPYGGGG----RSGNPAAQLDRE  293

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARV+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTE+E+E  +D ++S+A  A
Sbjct  294  ARVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEIEAE--VDRIYSTAAEA  351

Query  216  A  214
            A
Sbjct  352  A  352



>dbj|BAO24101.1| CONSTANS-like protein [Lemna gibba]
Length=352

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 114/183 (62%), Gaps = 15/183 (8%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ----EKHFEIDFTRSNLTS  559
            D +LD E   S E  S    ++SD VVP   I   A  +PQ    E   + DF+RS    
Sbjct  178  DRYLDLECGSSMEDGS---IHHSDSVVP--KIAVPAAHLPQFFAPENCLDYDFSRSKAAC  232

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEIS--YRNIGGGSVDSRGGSQWN-GMDREARV  388
            Y S     S S  SS DVGVVPD SS+++IS  Y   G  ++  +  +Q   G+DREARV
Sbjct  233  Y-SAVPSLSHSQMSSSDVGVVPDVSSMADISNPYGVPGVPAMVVQPQAQAAMGLDREARV  291

Query  387  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADV  208
            +RY EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+++SE  +D +FSSA     V
Sbjct  292  MRYGEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIDSE--MDHIFSSASGYGLV  349

Query  207  GRF  199
              F
Sbjct  350  PSF  352



>ref|NP_001236860.1| CONSTANS-like 2b [Glycine max]
 gb|ABD17254.1| CONSTANS-like 2b [Glycine max]
Length=328

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 102/172 (59%), Gaps = 24/172 (14%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEI--DFTRSNLT-SYNSGFTKpslsvsssldv  505
            Q  Y  D VVP+Q          Q +HF++  DF  S    SYN G    S+SVSS    
Sbjct  170  QKSYAGDSVVPVQ----------QHQHFQLGLDFDNSKPAFSYN-GSVSQSVSVSSMDIG  218

Query  504  gvvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKT  343
             V         I++     G++D   G      S ++ MDREARVLRYREK+K RKFEKT
Sbjct  219  VVPESPMRDVSIAHTRPPKGTIDLFSGPPIQVPSHFSPMDREARVLRYREKKKMRKFEKT  278

Query  342  IRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            IRYASRKAYAETRPRIKGRFAKRT+VE+E  +D +FS+     +VG + +VP
Sbjct  279  IRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQMFSTT-LITEVG-YGIVP  326



>gb|AJR28830.1| CONSTANS-like 6 protein [Gossypium hirsutum subsp. latifolium]
 gb|AJR28834.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28836.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28838.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28840.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28842.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28844.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28846.1| CONSTANS-like 6 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28848.1| CONSTANS-like 6 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28850.1| CONSTANS-like 6 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28852.1| CONSTANS-like 6 protein [Gossypium tomentosum]
 gb|AJR28854.1| CONSTANS-like 6 protein [Gossypium mustelinum]
Length=314

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 95/171 (56%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D+F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DSFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPIIPLINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>gb|AJR28812.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28814.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28816.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28820.1| CONSTANS-like 6 protein [Gossypium hirsutum var. punctatum]
 gb|AJR28822.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28826.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28828.1| CONSTANS-like 6 protein [Gossypium hirsutum var. marie-galante]
 gb|AJR28832.1| CONSTANS-like 6 protein [Gossypium hirsutum f. palmeri]
Length=314

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 95/171 (56%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D+F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DSFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPIIPLINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>gb|AJR28824.1| CONSTANS-like 6 protein [Gossypium hirsutum]
Length=314

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 95/171 (56%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D+F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DSFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPIIPLINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>gb|KHG29079.1| Zinc finger CONSTANS-LIKE 5 -like protein [Gossypium arboreum]
Length=314

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 95/171 (56%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D+F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DSFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPIIPLINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>gb|AEH05761.1| CONSTANS-like 1 protein [Phalaenopsis hybrid cultivar]
Length=334

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 110/184 (60%), Gaps = 27/184 (15%)
 Frame = -1

Query  720  FLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSGFT  541
            FLD EY     S+     Y SD VVP      +   IP    F +DF +S   +Y SG+ 
Sbjct  170  FLDLEY----ASSVDAGMYQSDSVVP------AGAGIPAS--FMLDFAKSK-PAY-SGYN  215

Query  540  KpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKN  361
                  SS   V    +G +++++S    GGG   S   +  + MDREARV+RYREKRKN
Sbjct  216  ISPSMSSSEFGVVPDGEGCAMADVS--TCGGGR--SSSVTAVSMMDREARVMRYREKRKN  271

Query  360  RKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS------ADSAADVGRF  199
            R+FEKTIRYASRKAYAETRPRIKGRFAKRTE+E+E  +D ++ S      A  AAD G F
Sbjct  272  RRFEKTIRYASRKAYAETRPRIKGRFAKRTEMEAE--VDQIYLSASAATAAFMAADPG-F  328

Query  198  SVVP  187
            SVVP
Sbjct  329  SVVP  332



>ref|NP_001235843.1| zinc finger protein CONSTANS-LIKE 2 [Glycine max]
 gb|ABD28283.1| zinc finger protein CONSTANS-LIKE 2 [Glycine max]
Length=352

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 102/172 (59%), Gaps = 24/172 (14%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEI--DFTRSNLT-SYNSGFTKpslsvsssldv  505
            Q  Y  D VVP+Q          Q +HF++  DF  S    SYN G    S+SVSS    
Sbjct  194  QKSYAGDSVVPVQ----------QHQHFQLGLDFDNSKPAFSYN-GSVSQSVSVSSMDIG  242

Query  504  gvvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKT  343
             V         I++     G++D   G      S ++ MDREARVLRYREK+K RKFEKT
Sbjct  243  VVPESPMRDVSIAHTRPPKGTIDLFSGPPIQVPSHFSPMDREARVLRYREKKKMRKFEKT  302

Query  342  IRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            IRYASRKAYAETRPRIKGRFAKRT+VE+E  +D +FS+     +VG + +VP
Sbjct  303  IRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQMFSTT-LITEVG-YGIVP  350



>gb|AEH05762.1| CONSTANS-like 2 protein [Phalaenopsis hybrid cultivar]
Length=334

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 110/184 (60%), Gaps = 27/184 (15%)
 Frame = -1

Query  720  FLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSGFT  541
            FLD EY     S+     Y SD VVP      +   IP    F +DF +S   +Y SG+ 
Sbjct  170  FLDLEY----ASSVDAGMYQSDSVVP------AGAGIPAS--FMLDFAKSK-PAY-SGYN  215

Query  540  KpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKN  361
                  SS   V    +G +++++S    GGG   S   +  + MDREARV+RYREKRKN
Sbjct  216  ISPSMSSSEFGVVPDGEGCAMADVS--TCGGGR--SSSVTAVSMMDREARVMRYREKRKN  271

Query  360  RKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS------ADSAADVGRF  199
            R+FEKTIRYASRKAYAETRPRIKGRFAKRTE+E+E  +D ++ S      A  AAD G F
Sbjct  272  RRFEKTIRYASRKAYAETRPRIKGRFAKRTEMEAE--VDQIYLSAAAATAAFMAADPG-F  328

Query  198  SVVP  187
            SVVP
Sbjct  329  SVVP  332



>emb|CBI21186.3| unnamed protein product [Vitis vinifera]
Length=307

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 121/187 (65%), Gaps = 16/187 (9%)
 Frame = -1

Query  726  DNFLDFEYPV---SWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            D +LD +YP      +S   Q    +D VVP+Q     AP++  +  F++DF+ S   S+
Sbjct  128  DPYLDLDYPSMDPKLQSQQQQQSSGTDGVVPVQNKSVQAPLV-NDNCFDMDFSGSK--SF  184

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWN-GMDREARV  388
             +G +      SSSL+VGVVPDG+++ +++    R++  GS  +   +Q + G+DREARV
Sbjct  185  YNGQSLSQSVSSSSLEVGVVPDGNAMVDVTNPFGRSMNTGSESANQTAQISSGIDREARV  244

Query  387  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADV  208
            LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR+E+E +       SS    AD 
Sbjct  245  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSEIEVDYS-----SSGALTADS  299

Query  207  GRFSVVP  187
            G + VVP
Sbjct  300  G-YGVVP  305



>ref|XP_008223533.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 [Prunus mume]
Length=380

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -1

Query  426  GSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
             +Q +G+DREARVLRYREKRKNRKF+KTIRYASRKAYAETRPRIKGRFAKRTE E E+ +
Sbjct  300  ATQLSGLDREARVLRYREKRKNRKFQKTIRYASRKAYAETRPRIKGRFAKRTETEIEA-V  358

Query  246  DTLFSSADSAADVGRFSVVP  187
            D ++ SA  A     + VVP
Sbjct  359  DNIYGSAQGAFIPETYGVVP  378



>ref|XP_007223099.1| hypothetical protein PRUPE_ppa007083mg [Prunus persica]
 gb|EMJ24298.1| hypothetical protein PRUPE_ppa007083mg [Prunus persica]
Length=383

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -1

Query  426  GSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
             +Q +G+DREARVLRYREKRKNRKF+KTIRYASRKAYAETRPRIKGRFAKRTE E E+ +
Sbjct  303  ATQLSGLDREARVLRYREKRKNRKFQKTIRYASRKAYAETRPRIKGRFAKRTETEIEA-V  361

Query  246  DTLFSSADSAADVGRFSVVP  187
            D ++ SA  A     + VVP
Sbjct  362  DNIYGSAQGAFIPETYGVVP  381



>ref|XP_009363242.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Pyrus x 
bretschneideri]
Length=340

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 105/168 (63%), Gaps = 10/168 (6%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---L  565
            D +LD +Y       E    QN   +D VVP Q+ K   P +  +  FEIDF+ ++   +
Sbjct  163  DPYLDLDYGHVDPKLEDAQEQNSCVTDGVVPEQS-KNMQPQLVNDHSFEIDFSAASKPFV  221

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWNGMDREA  394
              Y+          SSS+DV +VPD ++++++S    +++      S    Q +  DREA
Sbjct  222  YGYHHAQCLGQSVSSSSMDVSIVPDANAMTDVSNPYNKSMTSAVESSHPAVQLSSADREA  281

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E++
Sbjct  282  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIEAE  329



>gb|ADX97323.1| CONSTANS [Mangifera indica]
Length=322

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 20/183 (11%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D +LD +Y PV  +  +  QN   +D VVP+Q+     P++  +  F++DF  S   S+ 
Sbjct  155  DPYLDLDYGPVDPKLEAQEQNSSGTDGVVPVQSQTAPVPLV-NDHCFDLDF--SGPKSFG  211

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGS-QWNGMDREARVLRYR  376
             G+        S     +               G  + +S   + Q +  DREARVLRYR
Sbjct  212  YGYNNTQCLSHSVSSSSLDVGVVPD--------GSATTESTNQTVQLSSADREARVLRYR  263

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+++ E+D      S++S++  G F 
Sbjct  264  EKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDMDVEAD-----RSSNSSSIYG-FG  317

Query  195  VVP  187
            VVP
Sbjct  318  VVP  320



>gb|ADX97322.1| CONSTANS [Mangifera indica]
Length=322

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 20/183 (11%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D +LD +Y PV  +  +  QN   +D VVP+Q+     P++  +  F++DF  S   S+ 
Sbjct  155  DPYLDLDYGPVDPKLEAQEQNSSGTDGVVPVQSQTAPVPLV-NDHCFDLDF--SGPKSFG  211

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGS-QWNGMDREARVLRYR  376
             G+        S     +               G  + +S   + Q +  DREARVLRYR
Sbjct  212  YGYNNTQCLSHSVSSSSLDVGVVPD--------GSATTESTNQTVQLSSADREARVLRYR  263

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+++ E+D      S++S++  G F 
Sbjct  264  EKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDMDVEAD-----RSSNSSSIYG-FG  317

Query  195  VVP  187
            VVP
Sbjct  318  VVP  320



>ref|XP_011082019.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Sesamum 
indicum]
Length=339

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 106/188 (56%), Gaps = 20/188 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSH------QNQYNSDRVVPIQ------TIKTSAPIIPQEKHFEID  583
            D +LD E  +S E   H      Q QY+SD VVP+Q      + +   P++     +E+D
Sbjct  160  DPYLDLEL-ISGEQKPHHVVINEQKQYSSDGVVPVQNKNEYGSGQYPGPVVDGFPTYEVD  218

Query  582  FTRSNLTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMD  403
            +  +    YN  FT  S+S S S     V      + ++  +      D+      +GMD
Sbjct  219  YPGTKPFMYN--FTTQSISQSVSSSSLDVGVVPDHNAMADVSDTLAKTDAVP-IPVSGMD  275

Query  402  REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSAD  223
            REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR+E+E    ID+L +   
Sbjct  276  REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSELE----IDSLIAPDA  331

Query  222  SAADVGRF  199
            S   V  F
Sbjct  332  SYGVVPSF  339



>gb|AFX73406.1| constans-like protein 2 [Gossypium hirsutum]
 gb|AJR28765.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28769.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28771.1| CONSTANS-like 5 protein [Gossypium hirsutum var. punctatum]
 gb|AJR28779.1| CONSTANS-like 5 protein [Gossypium hirsutum var. marie-galante]
Length=335

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 102/185 (55%), Gaps = 19/185 (10%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            D FLD +Y       E+   QN   +D VVP+Q+    AP    +  F++DFT S   SY
Sbjct  163  DPFLDLDYGHGDPKMEAQ-EQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKSFSY  220

Query  555  --NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLR  382
              N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLR
Sbjct  221  GYNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLR  278

Query  381  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGR  202
            YREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           
Sbjct  279  YREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------  328

Query  201  FSVVP  187
            F VVP
Sbjct  329  FGVVP  333



>gb|AIE41595.1| zinc finger protein CONSTANS-LIKE 4 [Lagerstroemia indica]
Length=358

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 108/193 (56%), Gaps = 19/193 (10%)
 Frame = -1

Query  720  FLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPI-IPQEKHFEIDFTR-SNLTSYN--  553
            F+D  + +   ++   N   +D  VP+Q    S P+ +P EK   +D  R +   S+   
Sbjct  168  FIDPCFDLDLGNSDGLNGSGTDGQVPVQAKADSDPVDLPPEKCLHMDLGRPAKPASFRFP  227

Query  552  -SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRG--------GSQWNGMDR  400
               FT+   S S    V       S   +S  ++ GG  ++           +Q +G+DR
Sbjct  228  AHSFTQTVSSSSQDFGVVPDGSDVSNPYVS--SMSGGLTETSHSKTQINIQATQLSGVDR  285

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS  220
            EARVLRY+EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR+EVE +  +D+++    S
Sbjct  286  EARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSEVEGQL-VDSIYGGCSS  344

Query  219  A--ADVGRFSVVP  187
               AD   F VVP
Sbjct  345  VFFAD-AEFGVVP  356



>ref|XP_009359063.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1 
[Pyrus x bretschneideri]
 gb|AGW24796.1| CONSTANS-like protein [Pyrus pyrifolia]
Length=340

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 106/168 (63%), Gaps = 10/168 (6%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---L  565
            D +LD +Y       E    QN   +D VVP+++ K   P++  ++ FE+DF+  +   +
Sbjct  163  DPYLDLDYGHVDPKLEEAQEQNSCGADGVVPVRS-KNMQPLLVNDQSFELDFSAGSKPFV  221

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEIS---YRNIGGGSVDSRGGSQWNGMDREA  394
              Y+          SSS+D+ VVPD ++V++ S    +++      S+   Q +  DR A
Sbjct  222  YGYHHAQCLSQSVSSSSMDISVVPDSNAVTDASDAYTKSLTAAVETSQLAVQLSSADRVA  281

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E++
Sbjct  282  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIEAE  329



>ref|XP_009359064.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2 
[Pyrus x bretschneideri]
Length=329

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 87/163 (53%), Gaps = 11/163 (7%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P   E    QN   +D VVP+++ K   P++  ++ FE+DF+  +   
Sbjct  163  DPYLDLDYGHVDP-KLEEAQEQNSCGADGVVPVRS-KNMQPLLVNDQSFELDFSAGS---  217

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
                F                             +      S+   Q +  DR ARVLRY
Sbjct  218  --KPFVYGYHHAQCLSQSVSSSSMDISVVPDSNAVTAAVETSQLAVQLSSADRVARVLRY  275

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E++
Sbjct  276  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIEAE  318



>gb|AJR28763.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28767.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28773.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28783.1| CONSTANS-like 5 protein [Gossypium hirsutum f. palmeri]
 gb|AJR28803.1| CONSTANS-like 5 protein [Gossypium tomentosum]
 gb|AJR28807.1| CONSTANS-like 5 protein [Gossypium darwinii]
Length=335

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D FLD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPFLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKSFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>ref|XP_010928631.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Elaeis guineensis]
Length=359

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 110/187 (59%), Gaps = 16/187 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSA-PIIPQEKHFEIDFTRS--NLTSY  556
            D +LD +Y  S ++   Q    +D VVP+        P  P       DFTRS  + +SY
Sbjct  180  DPYLDLDYASSMDARFRQ----TDSVVPVHAKAVGGTPPPPLLAPDSGDFTRSKPSYSSY  235

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEIS-YRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             +     S+S S    V     G  V  ++   N  GG+   R G+    MDREARV+RY
Sbjct  236  TAHSLSHSVSSSEVGVVPDGSCGGGVGAMADVTNPYGGA--GRAGNPAAQMDREARVMRY  293

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA---ADV  208
            REKRKNR+F+KTIRYASRKAYAETRPRIKGRFAKR+E+E+E  +D ++S+A +A    D 
Sbjct  294  REKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKRSEIEAE--VDRMYSAAAAAVLMVDH  351

Query  207  GRFSVVP  187
            G + VVP
Sbjct  352  G-YGVVP  357



>gb|KJB55148.1| hypothetical protein B456_009G065600 [Gossypium raimondii]
 gb|AJR28761.1| CONSTANS-like 5 protein [Gossypium raimondii]
Length=335

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 100/184 (54%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNS--HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D FLD +Y           QN   +D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPFLDLDYGHGDPKMDAREQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKSFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>gb|ADQ27229.1| CONSTANS-like protein [Cymbidium ensifolium]
Length=327

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 96/175 (55%), Gaps = 39/175 (22%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D +LD EY  S E+      Y SD VVP      S  I+       +DF+++  T    G
Sbjct  162  DPYLDLEYASSVETG----IYQSDSVVPAGGGAPSGLIM-------LDFSKAKTTH---G  207

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRG---------GSQWNGMDREA  394
            +T              V    S SE      GGG+  +           G +   MDREA
Sbjct  208  YT--------------VSHSVSSSEAGVVPDGGGTATADASTCAAAAAAGERSVMMDREA  253

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            RV+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTEVESE  ID ++SS
Sbjct  254  RVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE--IDQIYSS  306



>gb|AJR28856.1| CONSTANS-like 6 protein [Gossypium darwinii]
 gb|AJR28858.1| CONSTANS-like 6 protein [Thespesia populneoides]
Length=314

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 99/171 (58%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D+F+DF YP    S+ H +    D VVP+QT K   PIIP             L +  + 
Sbjct  153  DSFIDFGYP---NSSQHLHDAAMDSVVPVQTPK---PIIP-------------LINDGNC  193

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
            F   S    SSL   V      V  +   N     V   GGS    +DREARVLRY+EKR
Sbjct  194  FDTFSYQTESSLSHSVSSSSLEVGTVPDGNYHATQV---GGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>gb|AJR28775.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28777.1| CONSTANS-like 5 protein [Gossypium hirsutum]
Length=335

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D FLD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPFLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVLAPSA-NDHCFDLDFTGSKSFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>ref|XP_007139358.1| hypothetical protein PHAVU_008G022800g [Phaseolus vulgaris]
 gb|ESW11352.1| hypothetical protein PHAVU_008G022800g [Phaseolus vulgaris]
Length=359

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 100/173 (58%), Gaps = 25/173 (14%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---LTSYNSGFTKpslsvsssldv  505
            Q  Y  D VVP+Q          Q +HF++     N     SYN G    S+SVS+    
Sbjct  200  QKSYAGDSVVPVQ----------QHQHFQLGLEFENSKPAFSYN-GSISQSISVSTLDIG  248

Query  504  gvvpdgssvSEISYRNIGGGSVDSRGG-------SQWNGMDREARVLRYREKRKNRKFEK  346
             V         IS+     G++D   G       S ++ MDREARVLRYREK+K RKFEK
Sbjct  249  VVPESPMRDVSISHTRPPKGTIDLFSGPPIQMMPSHFSPMDREARVLRYREKKKTRKFEK  308

Query  345  TIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D +FS+     +VG + +VP
Sbjct  309  TIRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQMFSTT-LITEVG-YGLVP  357



>gb|AJR28831.1| CONSTANS-like 6 protein [Gossypium hirsutum subsp. latifolium]
Length=313

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 94/176 (53%), Gaps = 27/176 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DRFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPDIPLINDGSCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++  A     F
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSFAVGPAGF  301



>ref|XP_009418181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 3-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 115/193 (60%), Gaps = 26/193 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQ----TIKTSAP----IIPQEKHFEIDFTRS  571
            D +LD EY  S ++  HQ     D VVP+      +   AP     +P +   EIDF+ S
Sbjct  181  DPYLDLEYATSMDARFHQ----MDSVVPVNGKAAGVNGGAPPLPSFLPPDAGVEIDFSPS  236

Query  570  NLTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREAR  391
               SY++  T  S+S S+S     V    S +     N  GG V  +  +Q   MDREAR
Sbjct  237  E-PSYST-HTTFSMSHSASSSEAGVVPDGSGATTDVTNPHGG-VPEKAAAQ---MDREAR  290

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA--  217
            V+RYREKRK+R+FEKTIRYASRKAYAETRPRIKGRFAKR ++E+E  +D ++S+A +A  
Sbjct  291  VMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRKDIEAE--VDRIYSAAAAAAA  348

Query  216  ---ADVGRFSVVP  187
               AD G + VVP
Sbjct  349  ALMADTG-YGVVP  360



>gb|AJR28810.1| CONSTANS-like 6 protein [Gossypium herbaceum subsp. africanum]
Length=314

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 95/171 (56%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            ++F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  NSFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPIIPVINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>gb|ACN62415.1| CONSTANS-like protein [Mangifera indica]
Length=322

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 104/183 (57%), Gaps = 20/183 (11%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D +LD +Y PV  +  +  QN   +D VVP+Q+     P++  +  F++DF  S   S+ 
Sbjct  155  DPYLDLDYGPVDPKLEAQEQNSSGTDGVVPVQSQTAPVPLV-NDHCFDLDF--SGPKSFG  211

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGS-QWNGMDREARVLRYR  376
             G+        S     +               G  + +S   + Q +  DREARVLRYR
Sbjct  212  YGYNNTQCLSHSVSSSSLDVGVVPD--------GSATTESTNQTVQLSSADREARVLRYR  263

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKN+KFEKTIRYASRKAYAE RPRIKGRFAKRT+++ E+D      S++S++  G F 
Sbjct  264  EKRKNKKFEKTIRYASRKAYAEMRPRIKGRFAKRTDMDVEAD-----RSSNSSSIYG-FG  317

Query  195  VVP  187
            VVP
Sbjct  318  VVP  320



>ref|XP_002263458.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Vitis vinifera]
Length=347

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 121/187 (65%), Gaps = 16/187 (9%)
 Frame = -1

Query  726  DNFLDFEYP---VSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            D +LD +YP      +S   Q    +D VVP+Q     AP++  +  F++DF+ S   S+
Sbjct  168  DPYLDLDYPSMDPKLQSQQQQQSSGTDGVVPVQNKSVQAPLV-NDNCFDMDFSGSK--SF  224

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWN-GMDREARV  388
             +G +      SSSL+VGVVPDG+++ +++    R++  GS  +   +Q + G+DREARV
Sbjct  225  YNGQSLSQSVSSSSLEVGVVPDGNAMVDVTNPFGRSMNTGSESANQTAQISSGIDREARV  284

Query  387  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADV  208
            LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR+E+E +       SS    AD 
Sbjct  285  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSEIEVD-----YSSSGALTADS  339

Query  207  GRFSVVP  187
            G + VVP
Sbjct  340  G-YGVVP  345



>gb|AFX73405.1| constans-like protein 1 [Gossypium hirsutum]
 gb|KJB22117.1| hypothetical protein B456_004G030300 [Gossypium raimondii]
 gb|AJR28811.1| CONSTANS-like 6 protein [Gossypium raimondii]
 gb|AJR28813.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28815.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28817.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28819.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28821.1| CONSTANS-like 6 protein [Gossypium hirsutum var. punctatum]
 gb|AJR28823.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28825.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28827.1| CONSTANS-like 6 protein [Gossypium hirsutum]
 gb|AJR28829.1| CONSTANS-like 6 protein [Gossypium hirsutum var. marie-galante]
 gb|AJR28833.1| CONSTANS-like 6 protein [Gossypium hirsutum f. palmeri]
 gb|AJR28835.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28837.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28839.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28841.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28843.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28845.1| CONSTANS-like 6 protein [Gossypium barbadense]
 gb|AJR28847.1| CONSTANS-like 6 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28849.1| CONSTANS-like 6 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28851.1| CONSTANS-like 6 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28853.1| CONSTANS-like 6 protein [Gossypium tomentosum]
 gb|AJR28855.1| CONSTANS-like 6 protein [Gossypium mustelinum]
 gb|AJR28857.1| CONSTANS-like 6 protein [Gossypium darwinii]
Length=313

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 94/176 (53%), Gaps = 27/176 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DRFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPVIPLINDGSCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++  A     F
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSFAVGPAGF  301



>ref|XP_009394556.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Musa acuminata 
subsp. malaccensis]
Length=302

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = -1

Query  615  IIPQEKH---FEIDFTRSNLTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGG-  448
            ++P E+H    +++F  SN  +Y+S  +      S    V           +   +IG  
Sbjct  160  LVPNEQHQHSLQMEFDASNGFNYSSSLSHRVSLSSMDASV-----------VPDTSIGAP  208

Query  447  -GSVDSRGGS-------QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIK  292
             G++D   G        Q N MDREARVLRYREKRK R+FEKTIRYASRKAYAETRPRIK
Sbjct  209  KGTMDLFSGHHPLQVQPQLNLMDREARVLRYREKRKTRRFEKTIRYASRKAYAETRPRIK  268

Query  291  GRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            GRFAK+++VE E  +D +FS+A   A+  RF VVP
Sbjct  269  GRFAKKSDVELE--VDQMFSTAAVLAN-SRFGVVP  300



>gb|AJR28762.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28764.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28766.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28768.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28774.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28776.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28782.1| CONSTANS-like 5 protein [Gossypium hirsutum f. palmeri]
Length=335

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D +LD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPYLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKPFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPQSTHQTVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>gb|KHG25074.1| Zinc finger CONSTANS-LIKE 4 -like protein [Gossypium arboreum]
 gb|AJR28760.1| CONSTANS-like 5 protein [Gossypium herbaceum subsp. africanum]
 gb|AJR28770.1| CONSTANS-like 5 protein [Gossypium hirsutum var. punctatum]
 gb|AJR28772.1| CONSTANS-like 5 protein [Gossypium hirsutum]
 gb|AJR28778.1| CONSTANS-like 5 protein [Gossypium hirsutum var. marie-galante]
 gb|AJR28802.1| CONSTANS-like 5 protein [Gossypium tomentosum]
 gb|AJR28806.1| CONSTANS-like 5 protein [Gossypium darwinii]
Length=335

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D +LD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPYLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKPFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>gb|AJR28784.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28786.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28788.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28790.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28792.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28794.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28796.1| CONSTANS-like 5 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28798.1| CONSTANS-like 5 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28800.1| CONSTANS-like 5 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28804.1| CONSTANS-like 5 protein [Gossypium mustelinum]
Length=335

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D +LD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPYLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKPFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQMVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>ref|XP_010525560.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Tarenaya hassleriana]
Length=340

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 107/189 (57%), Gaps = 17/189 (9%)
 Frame = -1

Query  729  SDNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            SD +LD +Y  V  +  +  QN   +D VVP++        +  E  +E+DF+  +  +Y
Sbjct  159  SDPYLDLDYGSVDPKMEAEEQNSSGTDGVVPVENGGVQVATV-SENCYELDFSGGSSKAY  217

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV--DSRGGSQ----WNGMDREA  394
              G++  + SVSSS     V         +   + GG+   DS  GSQ     +  +REA
Sbjct  218  GYGYSCITQSVSSSSLEVGVVPDGCAIANAANTLSGGAGNNDSGSGSQQAVPLSPAEREA  277

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            RVLRYREKRKNR+FEKTIRYASRKAYAE RPRIKGRFAKR +VE++++         S  
Sbjct  278  RVLRYREKRKNRRFEKTIRYASRKAYAEMRPRIKGRFAKRAKVETDAE--------SSGG  329

Query  213  DVGRFSVVP  187
                FSVVP
Sbjct  330  IYCGFSVVP  338



>gb|ADW65758.1| CONSTANS-like protein [Gossypium hirsutum]
Length=335

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 101/184 (55%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D +LD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPYLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKPFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQMVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>gb|AJR28785.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28787.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28789.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28791.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28793.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28795.1| CONSTANS-like 5 protein [Gossypium barbadense]
 gb|AJR28797.1| CONSTANS-like 5 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28799.1| CONSTANS-like 5 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28801.1| CONSTANS-like 5 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28805.1| CONSTANS-like 5 protein [Gossypium mustelinum]
Length=335

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 100/184 (54%), Gaps = 17/184 (9%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNS--DRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D FLD +Y         Q Q +S  D VVP+Q+    AP    +  F++DFT S   SY 
Sbjct  163  DPFLDLDYGHGDPKMDAQEQNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKSFSYG  221

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRY  379
             N  F   S+S SS     V    +   +IS    G G   +    Q +  DREARVLRY
Sbjct  222  YNPNFISHSVSSSSLDVGVVPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRY  279

Query  378  REKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            REKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT +E E D   ++           F
Sbjct  280  REKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTGIEVEVDRSNMYG----------F  329

Query  198  SVVP  187
             VVP
Sbjct  330  GVVP  333



>gb|AJR28781.1| CONSTANS-like 5 protein [Gossypium hirsutum subsp. latifolium]
Length=335

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 94/165 (57%), Gaps = 15/165 (9%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY--NSGFTKpslsvsssldvg  502
            QN   +D VVP+Q+    AP    +  F++DFT S   SY  N  F   S+S SS     
Sbjct  182  QNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKSFSYGYNPNFISHSVSSSSLDVGV  240

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRK  322
            V    +   +IS    G G   +    Q +  DREARVLRYREKRKNRKFEKTIRYASRK
Sbjct  241  VPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRYREKRKNRKFEKTIRYASRK  298

Query  321  AYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            AYAE RPRIKGRFAKRT++E E D   ++           F VVP
Sbjct  299  AYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------FGVVP  333



>gb|KHN14463.1| Zinc finger protein CONSTANS-LIKE 2 [Glycine soja]
Length=114

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 73/101 (72%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            I +     G++D   G      S ++ MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  16   IGHTRTPKGTIDLFSGPPIQVPSHFSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  75

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRT+VE+E  +D +FS+     +VG + +VP
Sbjct  76   TRPRIKGRFAKRTDVEAE--VDQMFSTT-LITEVG-YGIVP  112



>ref|XP_011078988.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Sesamum 
indicum]
Length=335

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 111/186 (60%), Gaps = 19/186 (10%)
 Frame = -1

Query  726  DNFLDFEYPVSWE--SNSHQN-QYNSDRVVPIQ------TIKTSAPIIPQEKHFEIDFTR  574
            D +LD +  +S E   NSH+  +Y+SDRVVP+Q      + +   P++     +++D+  
Sbjct  159  DPYLDLDL-ISGEQKPNSHEKKEYSSDRVVPVQNKNEYGSGQYPGPVVDGFPTYDVDYPG  217

Query  573  SNLTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRG-GSQWNGMDRE  397
            S    YN  FT  S+S S S     V      + ++  ++    V +    +  +G+DRE
Sbjct  218  SKPFMYN--FTSQSISQSVSCSSLDVGVVPDHNAMA--DVSDTFVKTEAIPTPVSGVDRE  273

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR+E+E    +D+L S   S 
Sbjct  274  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSELE----VDSLISGDASY  329

Query  216  ADVGRF  199
              V  F
Sbjct  330  GVVPTF  335



>gb|AGI62029.1| CONSTANS-like 5 [Erycina pusilla]
Length=331

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 94/157 (60%), Gaps = 15/157 (10%)
 Frame = -1

Query  720  FLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSGFT  541
            FLD EY  S ++  +Q    +D VVP         I P    F +DF++S   +Y  GF 
Sbjct  164  FLDLEYGCSVDAGVYQ----TDSVVP-----AGGGINPA--CFMLDFSKSKSGTYG-GFA  211

Query  540  KpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKN  361
                  SS + V    +GS+  ++S     G +  S      + MDREARV+RYREKRKN
Sbjct  212  ISPSMSSSEVAVVPDGEGSATGDVS---TCGAARSSSSAPTVSVMDREARVMRYREKRKN  268

Query  360  RKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            R+FEKTIRYASRKAYAETRPR+KGRFAKR++VE E D
Sbjct  269  RRFEKTIRYASRKAYAETRPRVKGRFAKRSDVEVEVD  305



>emb|CDQ51988.1| constans like, partial [Fagus sylvatica]
Length=311

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 108/166 (65%), Gaps = 11/166 (7%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY-  556
            D +LD +Y  V  +  +  QN   +D VVP+Q    S P +  +  F+++F+ S   SY 
Sbjct  139  DPYLDLDYGSVDPKLEAQEQNSSGTDGVVPVQ----SKPPLLHDHCFDMEFSASKPYSYA  194

Query  555  -NSGFTKpslsvsssldvgvvpdgssvSEIS---YRNIGGGSVDSRGGSQWNGMDREARV  388
             N+         SSSLDVGVVPDG++++EIS    + +   +  +    Q +  DREARV
Sbjct  195  YNTHQCLSQSVSSSSLDVGVVPDGNTMTEISDSYTKPMSAATESTNRPVQISAADREARV  254

Query  387  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE E D
Sbjct  255  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVD  300



>gb|ACZ67162.1| GATA-4/5/6 transcription factor, partial [Populus nigra]
Length=117

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            SQ + MDREARVLRYREKRK RKFEKTIRYASRKAYAETRPRIKGRFAKR +VE E   D
Sbjct  43   SQLSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVED--D  100

Query  243  TLFSSADSAADVGRFSVVP  187
             +FSS    A+ G + +VP
Sbjct  101  QMFSST-LMAETG-YGIVP  117



>ref|XP_010692981.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 9/78 (12%)
 Frame = -1

Query  411  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE---SDIDT  241
            GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E   + +D 
Sbjct  310  GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVSAASVDG  369

Query  240  LFSSADSAADVGRFSVVP  187
            LF     A D G + VVP
Sbjct  370  LF-----APDPG-YGVVP  381



>gb|AJR28780.1| CONSTANS-like 5 protein [Gossypium hirsutum subsp. latifolium]
Length=335

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 94/165 (57%), Gaps = 15/165 (9%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY--NSGFTKpslsvsssldvg  502
            QN   +D VVP+Q+    AP    +  F++DFT S   SY  N  F   S+S SS     
Sbjct  182  QNSSGTDGVVPVQSKNVQAPSA-NDHWFDLDFTGSKPFSYGYNPNFISHSVSSSSLDVGV  240

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRK  322
            V    +   +IS    G G   +    Q +  DREARVLRYREKRKNRKFEKTIRYASRK
Sbjct  241  VPDGSTMT-DIS-NPYGRGPESTHQTVQLSPADREARVLRYREKRKNRKFEKTIRYASRK  298

Query  321  AYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            AYAE RPRIKGRFAKRT++E E D   ++           F VVP
Sbjct  299  AYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------FGVVP  333



>ref|XP_010100899.1| Zinc finger protein CONSTANS-LIKE 2 [Morus notabilis]
 gb|EXB85823.1| Zinc finger protein CONSTANS-LIKE 2 [Morus notabilis]
Length=387

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 98/169 (58%), Gaps = 17/169 (10%)
 Frame = -1

Query  657  DRVVPIQTIKTSAPII-PQEKH-----FEIDFTRSNLTSYNSGFTKpslsvsssldvgvv  496
            D VVP+Q       I+ P   H      E D  +S  ++YN G    S+S+SS     V 
Sbjct  222  DSVVPVQCGDGKGQIMMPHISHGFQLGLEFDSPKSTYSNYN-GSISHSVSISSMDVSVVP  280

Query  495  pdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRY  334
                S   IS+     G++D   G      +Q   MDREARVLRYREK+K RKFEKTIRY
Sbjct  281  DSTMSDISISHPRPPKGTIDLFSGPAVQMPAQLTPMDREARVLRYREKKKTRKFEKTIRY  340

Query  333  ASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            ASRKAYAETRPRIKGRFAKRT+VE E  +D +FS+     D G + +VP
Sbjct  341  ASRKAYAETRPRIKGRFAKRTDVEVE--VDQMFSTT-LMVDTG-YGIVP  385



>gb|AEA50854.1| col2a [Populus tremula]
Length=117

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDS------RGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+++   G++D       +  SQ + M+REARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  21   ISHQSAPRGTIDLFSSPPIQMPSQLSPMEREARVLRYREKKKARKFEKTIRYASRKAYAE  80

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRT+V+ E  +D +FSS   A     + +VP
Sbjct  81   TRPRIKGRFAKRTDVDVE--VDQMFSSTLMAETA--YGIVP  117



>ref|XP_010913626.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Elaeis guineensis]
Length=363

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 101/168 (60%), Gaps = 17/168 (10%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQ----EKHFEIDFTRS----  571
            D +LD +Y  S ++  HQ    +D VVP+Q      P  P     +   ++DFT+S    
Sbjct  181  DPYLDLDYASSMDARFHQ----TDSVVPVQAKTVGGPPPPPLLAPDGGLDLDFTQSKPSY  236

Query  570  -NLTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREA  394
             + T+++   +  S  V    D      G ++++++     GG    R G+    MDREA
Sbjct  237  SSYTAHSLSHSVSSSEVGVVPDGRYGGGGGAMADVTNPYGSGG----RAGNPAAQMDREA  292

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            RV+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRFAKRTE+E+E D
Sbjct  293  RVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEIEAEVD  340



>ref|XP_009604722.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Nicotiana 
tomentosiformis]
Length=336

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 108/169 (64%), Gaps = 15/169 (9%)
 Frame = -1

Query  678  HQNQYNSDRVVP-IQT---IKTSAPIIPQEKHFEIDFTRSNLTSYN-SGFTKpslsvsss  514
            H  +Y  D VVP +Q    I    P++     +E+DF+ S    YN S  +      SSS
Sbjct  176  HVQEYKDDCVVPHVQNKNEIHLQGPVVNGYPTYEMDFSGSKPFMYNFSSQSISQSVSSSS  235

Query  513  ldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRY  334
            ++VGVVPD ++++++S   +   S D       N +DREARVLRYREKRKNRKFEKTIRY
Sbjct  236  MEVGVVPDHNTMADVSNTFVRNSSTDGLPNPLSN-LDREARVLRYREKRKNRKFEKTIRY  294

Query  333  ASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            ASRKAYAETRPRIKGRFAKRTE E    +D+L +S+D++     + VVP
Sbjct  295  ASRKAYAETRPRIKGRFAKRTENE----VDSLIASSDAS-----YGVVP  334



>gb|AEE65453.1| CONSTANS-like protein [Cymbidium sinense]
Length=327

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 95/175 (54%), Gaps = 39/175 (22%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D +LD EY  S E+      Y SD VVP      S  I+       +DF+++  T    G
Sbjct  162  DPYLDLEYASSVETG----IYQSDSVVPPGGGAPSGLIM-------LDFSKAKTTH---G  207

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRG---------GSQWNGMDREA  394
            +T              V    S SE      GGG+  +           G +   MDREA
Sbjct  208  YT--------------VSHSVSSSEAGVVPDGGGTATADASTCAAAAAAGERSVMMDREA  253

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            RV+RYREKRKNR+FEKTIRYASRKAYAETRPRIKGRF KRTEVESE  ID ++SS
Sbjct  254  RVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFVKRTEVESE--IDQIYSS  306



>ref|XP_006450227.1| hypothetical protein CICLE_v10008813mg [Citrus clementina]
 gb|ESR63467.1| hypothetical protein CICLE_v10008813mg [Citrus clementina]
Length=347

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 106/190 (56%), Gaps = 19/190 (10%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSA-PIIPQEKHFEIDF--TRSNL  565
            D +LD EY       E+   QN   +D VVP+QT   +A   +  +  F++DF  ++S  
Sbjct  165  DPYLDLEYGHVDTKLEAQ-EQNSSGTDGVVPVQTRNVNANGHLVNDACFDLDFPGSKSYG  223

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDRE  397
              YNS     S SVSSS     V    S +     N  G  V    G+Q     +  DRE
Sbjct  224  YGYNSHSQCLSQSVSSSSLEVGVVPDGSSAMTDITNPYGKGVGVEAGNQTVVQISAADRE  283

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E         AD +
Sbjct  284  ARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDLEVE--------PADRS  335

Query  216  ADVGRFSVVP  187
            + +  F +VP
Sbjct  336  SSIYGFGIVP  345



>gb|KDP24338.1| hypothetical protein JCGZ_25634 [Jatropha curcas]
Length=383

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 108/180 (60%), Gaps = 16/180 (9%)
 Frame = -1

Query  690  ESNSHQNQYNSDRVVPIQTIKTSAPII----PQEKHFEI--DFTRSNLTSYNSGFTKpsl  529
            +++  Q QY +D VVP+Q ++     +     Q ++F++  +F  S  T   +G    S+
Sbjct  206  QNSLQQQQYGADGVVPVQCLEAGKDQMINHHQQYRNFQLGLEFDSSKPTYSYNGSISHSV  265

Query  528  svsssldvgvvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKR  367
            S+SS     V     S   IS+     G++D   G      SQ +  DREARVLRYREK+
Sbjct  266  SISSMDVGVVQDSTMSEISISHSRTPKGTIDLFSGPPMQMPSQLSPRDREARVLRYREKK  325

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            K RKFEKTIRYASRKAYAETRPRIKGRFAKRT+V+ E  +D +FS+     + G +S+VP
Sbjct  326  KTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDFE--VDQMFSTT-LMTETG-YSIVP  381



>gb|AJR28818.1| CONSTANS-like 6 protein [Gossypium hirsutum]
Length=313

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 94/176 (53%), Gaps = 27/176 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D+F+DF YP    S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DSFIDFGYP---NSSQHLHDAAMDSVVPVQTPKPIIPLINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYHATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRF  199
            KNRKF KTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++  A     F
Sbjct  247  KNRKFGKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSFAVGPAGF  301



>gb|AIE41593.1| zinc finger protein CONSTANS-LIKE 2 [Lagerstroemia indica]
Length=345

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q + MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKR +V+ +  +D 
Sbjct  267  QLSAMDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRRDVQVQLQVDH  326

Query  240  LFSSADSAADVGRFSVVP  187
            LFS      D   + VVP
Sbjct  327  LFSDPSLMPDT-SYGVVP  343



>ref|XP_009630583.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Nicotiana tomentosiformis]
Length=403

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 16/103 (16%)
 Frame = -1

Query  468  SYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAET  307
            S+  +  G++D   G      +Q   MDREARVLRYREK+KNRKFEKTIRYASRKAYAET
Sbjct  306  SHPRLPKGTIDLFSGPPIQMPTQLTPMDREARVLRYREKKKNRKFEKTIRYASRKAYAET  365

Query  306  RPRIKGRFAKRTEVESESDIDTLFSS---ADSAADVGRFSVVP  187
            RPRIKGRFAKRT+VE+E  +D +FS+   ADS+     + +VP
Sbjct  366  RPRIKGRFAKRTDVEAE--VDQMFSTQLIADSS-----YGIVP  401



>gb|ADQ27228.1| CONSTANS-like protein [Cymbidium goeringii]
Length=326

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 98/166 (59%), Gaps = 22/166 (13%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D +LD EY  S E+      Y SD VVP      S  I+       +DF+++  T    G
Sbjct  162  DPYLDLEYASSVETG----IYQSDSVVPAGGGAPSGLIM-------LDFSKAKTTH---G  207

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
            +T      SS   V     G+++++ +          +  G +   MDREARV+RYREKR
Sbjct  208  YTVSHSVSSSEAGVVPDDGGTAIADATTCAA------AAAGERSVMMDREARVMRYREKR  261

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            KNR+FEKTIRYASRKAYAETRPRIKGRFAKRTEVESE  ID ++SS
Sbjct  262  KNRRFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE--IDQIYSS  305



>ref|XP_010545431.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Tarenaya 
hassleriana]
Length=353

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 91/168 (54%), Gaps = 18/168 (11%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLT--SYN  553
            D   DF  P S+      N   +DRVVP++T          E  F IDF  S L+  SY 
Sbjct  159  DGLADFVCPNSFHPP--HNSTGADRVVPVRTKTNLVSAGNNEHCFNIDFCGSKLSTFSYA  216

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRG-----------GSQW  415
            +      +S SS     V     S+SEIS    RN+  GS  + G             Q 
Sbjct  217  TQSISHRVSTSSHDFGVVPDGSISLSEISIPLGRNVIAGSTATAGDPNPSILGGTTSQQI  276

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT  271
             G DREARV RYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRT
Sbjct  277  CGSDREARVSRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT  324



>gb|AJR28809.1| CONSTANS-like 5 protein [Thespesia populneoides]
Length=335

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 93/165 (56%), Gaps = 15/165 (9%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY--NSGFTKpslsvsssldvg  502
            QN   +D VVP+Q+    AP    +  F++DFT S   SY  N  F   S+S SS     
Sbjct  182  QNSSGTDGVVPVQSKNVQAPSA-NDHCFDLDFTGSKPFSYGYNPNFISHSVSSSSLDVGV  240

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRK  322
            V    +   +IS      G   +    Q +  DREARVLRYREKRKNRKFEKTIRYASRK
Sbjct  241  VPDGSAMT-DIS-NPYARGPESTHQMVQLSPADREARVLRYREKRKNRKFEKTIRYASRK  298

Query  321  AYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            AYAE RPRIKGRFAKRT++E E D   ++           F VVP
Sbjct  299  AYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------FGVVP  333



>gb|ACZ67160.1| GATA-4/5/6 transcription factor, partial [Populus balsamifera]
Length=117

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            SQ + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKR +VE E   D
Sbjct  43   SQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVED--D  100

Query  243  TLFSSADSAADVGRFSVVP  187
             +FSS    A+ G + +VP
Sbjct  101  QMFSST-LMAETG-YGIVP  117



>ref|NP_001280817.1| zinc finger protein CONSTANS-LIKE 4 [Malus domestica]
 gb|AAC99309.1| CONSTANS-like protein 1 [Malus domestica]
Length=340

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 109/189 (58%), Gaps = 22/189 (12%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---L  565
            D ++D +Y       E    QN   +D VVP Q+ K   P +  +  FEIDF+ ++   +
Sbjct  163  DPYMDLDYGHVDPKLEDAQEQNSCITDGVVPEQS-KNMQPQLVNDHSFEIDFSAASKPFV  221

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWNGMDREA  394
              Y+          SSS+DV +VPD +++++ S    +++      S    Q +  DREA
Sbjct  222  YGYHHAQCLRQSVSSSSMDVSIVPDDNAMTDDSNPYNKSMTSAVESSHPAVQLSSADREA  281

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E            A 
Sbjct  282  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIE------------AE  329

Query  213  DVGRFSVVP  187
             + R+ +VP
Sbjct  330  PMCRYGIVP  338



>ref|XP_006388756.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
 ref|XP_006388757.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
 gb|ERP47670.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
 gb|ERP47671.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
Length=117

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            SQ + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKR +VE E   D
Sbjct  41   SQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVED--D  98

Query  243  TLFSSADSAADVGRFSVVP  187
             +FSS    A+ G + +VP
Sbjct  99   QMFSST-LMAETG-YGIVP  115



>ref|XP_009765376.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Nicotiana sylvestris]
Length=406

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 10/82 (12%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D
Sbjct  330  TQLTPMDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VD  387

Query  243  TLFSS---ADSAADVGRFSVVP  187
             +FS+   ADS+     + +VP
Sbjct  388  QMFSTQLIADSS-----YGIVP  404



>ref|XP_008379517.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Malus domestica]
 gb|ACD69427.1| CONSTANS-like 1 [Malus domestica]
Length=340

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 109/189 (58%), Gaps = 22/189 (12%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---L  565
            D ++D +Y       E    QN   +D VVP Q+ K   P +  +  FEIDF+ ++   +
Sbjct  163  DPYMDLDYGHVDPKLEDAQEQNSCITDGVVPEQS-KNMQPQLVNDHSFEIDFSAASKPFV  221

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISY---RNIGGGSVDSRGGSQWNGMDREA  394
              Y+          SSS+DV +VPD +++++ S    +++      S    Q +  DREA
Sbjct  222  YGYHHAQCLRQSVSSSSMDVSIVPDDNAMTDDSNPYNKSMTSAVESSHPAVQLSSADREA  281

Query  393  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E            A 
Sbjct  282  RVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIE------------AE  329

Query  213  DVGRFSVVP  187
             + R+ +VP
Sbjct  330  PMCRYGIVP  338



>gb|AFX73408.1| constans-like protein 4-1 [Gossypium hirsutum]
Length=338

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNLHCLSHSVSSSSLDVGVVPDGGSTITDISVPCAKVTETTHQAVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSSAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            F           F VVP
Sbjct  330  FG----------FGVVP  336



>gb|AJR28713.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28717.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28719.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28721.1| CONSTANS-like 3 protein [Gossypium hirsutum var. punctatum]
 gb|AJR28723.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28725.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28727.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28729.1| CONSTANS-like 3 protein [Gossypium hirsutum var. marie-galante]
 gb|AJR28733.1| CONSTANS-like 3 protein [Gossypium hirsutum f. palmeri]
Length=338

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNLHCLSHSVSSSSLDVGVVPDGGSTITDISVPCAKVTETTHQAVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSSAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            F           F VVP
Sbjct  330  FG----------FGVVP  336



>emb|CDY02749.1| BnaC02g11400D [Brassica napus]
Length=259

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = -1

Query  426  GSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
            G + + MDREARVLRYREKRKNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE E++   
Sbjct  183  GERPSSMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETEND---  239

Query  246  DTLFSSADSAADVGRFSVVP  187
            D  FS   ++A  G++ VVP
Sbjct  240  DVFFSQVYASA--GQYGVVP  257



>gb|AJR28715.1| CONSTANS-like 3 protein [Gossypium hirsutum]
Length=338

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTITDISVPCAKVTETTHQAVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSSAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            F           F VVP
Sbjct  330  FG----------FGVVP  336



>ref|XP_006844170.1| hypothetical protein AMTR_s00006p00262710 [Amborella trichopoda]
 gb|ERN05845.1| hypothetical protein AMTR_s00006p00262710 [Amborella trichopoda]
Length=378

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q+  MDREARVLRYREKRK RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE E D   
Sbjct  303  QFTPMDREARVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVD---  359

Query  240  LFSSADSAADVGRFSVVP  187
             F SA   A+ G + VVP
Sbjct  360  QFYSASLVAETG-YGVVP  376



>ref|NP_001235828.1| CONSTANS-like 2a [Glycine max]
 gb|ABD17253.1| CONSTANS-like 2a [Glycine max]
 gb|ACJ65311.1| CONSTANS protein [Glycine max]
Length=348

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 102/183 (56%), Gaps = 33/183 (18%)
 Frame = -1

Query  681  SHQNQ---------YNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSN---LTSYNSGFTK  538
            SHQ+Q         Y  D VVP+Q            +HF++     N     SYN+    
Sbjct  179  SHQHQHFGVVSHKSYAGDSVVPVQ----------HHQHFQLGLEFDNSKAAFSYNAS-VN  227

Query  537  pslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYR  376
             S+SVSS     V         I +     G++D   G      S ++ MDREARVLRYR
Sbjct  228  QSVSVSSMDIGVVPESPMRDVSIGHTRTPKGTIDLFSGPPIQVPSHFSPMDREARVLRYR  287

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D +FS+     +VG + 
Sbjct  288  EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQMFSTT-LITEVG-YG  343

Query  195  VVP  187
            +VP
Sbjct  344  IVP  346



>ref|XP_010525138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Tarenaya 
hassleriana]
 gb|ABD96940.1| hypothetical protein [Cleome spinosa]
Length=381

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 103/191 (54%), Gaps = 26/191 (14%)
 Frame = -1

Query  729  SDNFLDF-EYPVSWE-------SNSHQN------QYNSDRVVPIQTIKTSAPIIPQEKHF  592
            +D +LD  EY  S E       S  HQ+       +  D VVP+Q  ++   +  +++ F
Sbjct  179  ADEYLDLVEYNSSMENQFSDQYSQYHQDCGVPQKSFGGDGVVPLQVEESRGQLHHEQQSF  238

Query  591  EIDFTRSN----LTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG  424
            ++  T  +      SYN          S  + V      S ++ +S      G+ D   G
Sbjct  239  QLAITYGSPGALYGSYNGSMNHSVSMSSMDIVVVPESTASDMAVVSQLRAPKGTTDLLIG  298

Query  423  S------QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE  262
                   Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT++E
Sbjct  299  PPIQMMPQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIE  358

Query  261  SESDIDTLFSS  229
            +E  +D  FS+
Sbjct  359  AE--VDQAFST  367



>ref|XP_006483500.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Citrus sinensis]
 gb|KDO67358.1| hypothetical protein CISIN_1g019028mg [Citrus sinensis]
Length=347

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 106/190 (56%), Gaps = 19/190 (10%)
 Frame = -1

Query  726  DNFLDFEY---PVSWESNSHQNQYNSDRVVPIQTIKTSA-PIIPQEKHFEIDF--TRSNL  565
            D +LD +Y       E+   QN   +D VVP+QT   +A   +  +  F++DF  ++S  
Sbjct  165  DPYLDLDYGHVDTKLEAQ-EQNSSGTDGVVPVQTRNVNANGHLVNDACFDLDFPGSKSYG  223

Query  564  TSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDRE  397
              YNS     S SVSSS     V    S +     N  G  V    G+Q     +  DRE
Sbjct  224  YGYNSHSQCLSQSVSSSSLEVGVVPDGSSAMTDITNPYGKGVGVEAGNQTVVQISAADRE  283

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSA  217
            ARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT++E E         AD +
Sbjct  284  ARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDLEVE--------PADRS  335

Query  216  ADVGRFSVVP  187
            + +  F +VP
Sbjct  336  SSIYGFGIVP  345



>gb|AJR28859.1| CONSTANS-like 6 protein [Thespesia populneoides]
Length=314

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 93/171 (54%), Gaps = 27/171 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSG  547
            D F++F Y     S+ H +    D VVP+QT K   P+I     F+         SY + 
Sbjct  153  DPFIEFGY---LNSSQHLHDAAMDSVVPVQTPKPVIPLINDGNCFDT-------FSYQT-  201

Query  546  FTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKR  367
                                SS  E+     G       GGS    +DREARVLRY+EKR
Sbjct  202  -----------QSSLSHSVSSSSLEVGTVPDGNYQATQVGGS----IDREARVLRYKEKR  246

Query  366  KNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAA  214
            KNRKFEKTIRYASRKAYAE+RPRIKGRFAKRTE  ++ D+D +F+++ S A
Sbjct  247  KNRKFEKTIRYASRKAYAESRPRIKGRFAKRTETHND-DVDHMFNNSSSFA  296



>ref|XP_007215513.1| hypothetical protein PRUPE_ppa007007mg [Prunus persica]
 gb|EMJ16712.1| hypothetical protein PRUPE_ppa007007mg [Prunus persica]
Length=386

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 100/171 (58%), Gaps = 19/171 (11%)
 Frame = -1

Query  678  HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLT-SYNSGFTKpslsvsssldvg  502
            H+N Y  D VVP+Q  K S           +++  S    SYN G    ++SVSS     
Sbjct  226  HKN-YGGDSVVPVQMQKQSF------HQLGLEYESSKAAYSYN-GSLSNTVSVSSMDVGV  277

Query  501  vvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTI  340
            V     S   IS+     G++D   G      SQ + +DREARVLRYREK+K RKFEKTI
Sbjct  278  VPDSTMSDISISHPRTPKGTIDLFSGPPIQMPSQLSPLDREARVLRYREKKKTRKFEKTI  337

Query  339  RYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            RYASRKAYAETRPRIKGRFAKRTE+E E  +D +FS+   A +   + +VP
Sbjct  338  RYASRKAYAETRPRIKGRFAKRTEMEVE--VDQMFSTTLMAEN--GYGIVP  384



>ref|XP_008230340.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Prunus mume]
Length=386

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 102/170 (60%), Gaps = 17/170 (10%)
 Frame = -1

Query  678  HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYNSGFTKpslsvsssldvgv  499
            H+N Y  D VVP+Q  K S      +   E + +++   SYN G    ++SVSS     V
Sbjct  226  HKN-YGGDSVVPVQMQKQSF----HQLGLEYESSKAAY-SYN-GSLSNTVSVSSMDVGVV  278

Query  498  vpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIR  337
                 S   IS+     G++D   G      SQ + +DREARVLRYREK+K RKFEKTIR
Sbjct  279  PDSTMSDISISHPRTPKGTIDLFSGPPIQMPSQLSPLDREARVLRYREKKKTRKFEKTIR  338

Query  336  YASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            YASRKAYAETRPRIKGRFAKRTE+E E  +D +FS+   A +   + +VP
Sbjct  339  YASRKAYAETRPRIKGRFAKRTEMEVE--VDQMFSTTLMAEN--GYGIVP  384



>gb|AFY06686.1| constans [Nicotiana tabacum]
Length=403

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 16/103 (16%)
 Frame = -1

Query  468  SYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAET  307
            S+  +  G++D   G      +Q   MDREARVLRYREK++NRKFEKTIRYASRKAYAET
Sbjct  306  SHPRLPKGTIDLFSGPPIQMPTQLTPMDREARVLRYREKKRNRKFEKTIRYASRKAYAET  365

Query  306  RPRIKGRFAKRTEVESESDIDTLFSS---ADSAADVGRFSVVP  187
            RPRIKGRFAKRT+VE+E  +D +FS+   ADS+     + +VP
Sbjct  366  RPRIKGRFAKRTDVEAE--VDQMFSTQLIADSS-----YGIVP  401



>gb|AJR28731.1| CONSTANS-like 3 protein [Gossypium hirsutum subsp. latifolium]
 gb|AJR28735.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28737.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28739.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28741.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28743.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28745.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28747.1| CONSTANS-like 3 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28749.1| CONSTANS-like 3 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28751.1| CONSTANS-like 3 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28755.1| CONSTANS-like 3 protein [Gossypium mustelinum]
Length=338

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 101/196 (52%), Gaps = 32/196 (16%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT     +
Sbjct  157  DPYLDLDYGHVDPKMETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFT-----T  210

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVD------------SRGGSQW  415
              +     + + + +         SS  ++     GG ++             +    Q 
Sbjct  211  PKAFPYGYNYNCNYNPHCLRHSVSSSSLDVGVVPDGGSTITDISVPCAKVTETTHQAVQL  270

Query  414  NGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLF  235
            +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +F
Sbjct  271  SSAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNMF  330

Query  234  SSADSAADVGRFSVVP  187
                       F VVP
Sbjct  331  G----------FGVVP  336



>ref|NP_001233839.1| CONSTANS 1 [Solanum lycopersicum]
 gb|AAS67376.1| CONSTANS 1 [Solanum lycopersicum]
 gb|AAS67377.1| CONSTANS 1 [Solanum lycopersicum]
Length=391

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 2/64 (3%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q   MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D 
Sbjct  316  QLTPMDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQ  373

Query  240  LFSS  229
            +FS+
Sbjct  374  MFST  377



>ref|XP_004291989.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Fragaria vesca 
subsp. vesca]
Length=312

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 102/185 (55%), Gaps = 30/185 (16%)
 Frame = -1

Query  726  DNFLDFEY--PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY  556
            D++LD +Y  P   ++ +  QN   +D VVP+Q+ K++ P     + FE++   S    Y
Sbjct  151  DSYLDLDYGTPADPKTEAQEQNSSATDGVVPVQS-KSAQP-----QSFEMELPGSKPFIY  204

Query  555  NSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVD--SRGGSQWNGMDREARVLR  382
             S     S    S +  G + D        Y      +VD  S    Q +  DREARVLR
Sbjct  205  LSQSVSSSPLDVSIVPDGNMSD-------PYPKSISSAVDQLSHPTVQISSADREARVLR  257

Query  381  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGR  202
            YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVE E            A  + R
Sbjct  258  YREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVEIE------------AERLCR  305

Query  201  FSVVP  187
            + VVP
Sbjct  306  YGVVP  310



>emb|CAP09655.1| CONSTANS protein [Solanum tuberosum subsp. andigenum]
Length=410

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 2/64 (3%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q   MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D 
Sbjct  335  QLTPMDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQ  392

Query  240  LFSS  229
            +FS+
Sbjct  393  MFST  396



>gb|ADU05552.1| CONSTANS-like protein [Dendrobium loddigesii]
Length=325

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 96/177 (54%), Gaps = 42/177 (24%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLT-SYNS  550
            D +LD EY  S E+      Y+SD VVP     +   ++       +DF +S  T SY  
Sbjct  159  DPYLDLEYASSVEAGF----YHSDSVVPAGGGASPGFVM-------LDFAKSKPTHSYTV  207

Query  549  GFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNG----------MDR  400
              +                   S SE++    GGGS  +   +   G          MDR
Sbjct  208  SHS------------------MSSSEVAVVPDGGGSAMADTSTCAGGGGGGGERPAIMDR  249

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            EARV+RYREKRK+R+FEKTIRYASRKAYAE RPRIKGRFAKRTEVESE  ID ++SS
Sbjct  250  EARVMRYREKRKSRRFEKTIRYASRKAYAEARPRIKGRFAKRTEVESE--IDQIYSS  304



>ref|XP_009378312.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X2 
[Pyrus x bretschneideri]
Length=397

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 72/101 (71%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   GS      Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  299  ISHPRTPKGTIDLFSGSSIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  358

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +FS+   A +   + +VP
Sbjct  359  TRPRIKGRFAKRTEMEVE--VDQMFSTTLMAEN--GYGIVP  395



>ref|XP_009378311.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X1 
[Pyrus x bretschneideri]
Length=411

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 72/101 (71%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   GS      Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  313  ISHPRTPKGTIDLFSGSSIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  372

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +FS+   A +   + +VP
Sbjct  373  TRPRIKGRFAKRTEMEVE--VDQMFSTTLMAEN--GYGIVP  409



>gb|AJR28757.1| CONSTANS-like 3 protein [Gossypium darwinii]
Length=338

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTITDISVPCAKVTETTHQAVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSSAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            +           F VVP
Sbjct  330  YG----------FGVVP  336



>gb|AGW80455.1| constans-like protein [Mangifera indica]
Length=322

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 102/183 (56%), Gaps = 20/183 (11%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNSH-QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D +LD +Y PV  +  +  QN   +D VVP+Q+     P++  +  F++D   S   S+ 
Sbjct  155  DPYLDLDYGPVDPKLEAQEQNSSGTDGVVPVQSQTAPVPLV-NDHCFDLD--SSGPKSFG  211

Query  552  SGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGS-QWNGMDREARVLRYR  376
             G+        S     +               G  + +S   + Q +  DREARVLRYR
Sbjct  212  YGYNNTQCLSHSVSSSSLDVGVVPD--------GSATTESTNQTVQLSSADREARVLRYR  263

Query  375  EKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFS  196
            EKRKNRKFEKTIRYASRKAYAE  PRIKGRFAKRT+++ E+D      S++S++  G F 
Sbjct  264  EKRKNRKFEKTIRYASRKAYAEMTPRIKGRFAKRTDMDVEAD-----RSSNSSSIYG-FG  317

Query  195  VVP  187
            VVP
Sbjct  318  VVP  320



>gb|ACB36912.1| CONSTANS-like protein 2 [Oxybasis rubra]
Length=336

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q + +DREARV+RYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D
Sbjct  260  TQLSPLDREARVMRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--MD  317

Query  243  TLFSSADSAADVGRFSVVP  187
             +F+  +S    G + +VP
Sbjct  318  QMFT--NSLMSDGGYGIVP  334



>ref|XP_007032965.1| Zinc finger protein CONSTANS-LIKE 2 [Theobroma cacao]
 gb|EOY03891.1| Zinc finger protein CONSTANS-LIKE 2 [Theobroma cacao]
Length=382

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 106/192 (55%), Gaps = 29/192 (15%)
 Frame = -1

Query  726  DNFLDF-EYPVSWESN-----SHQNQ--------YNSDRVVPIQT-----IKTSAPIIPQ  604
            D++LD  EY  S E++     + Q Q        Y  D VVPIQ+              Q
Sbjct  180  DDYLDIVEYNSSVENHITDQYNQQQQHYSVPNKSYGGDSVVPIQSGEAKDHLQQQQHQQQ  239

Query  603  EKHFEIDFTRSNLT-SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRG  427
               F +D+  S    SYN G    S+S+SS     V     S   IS+R    G++D   
Sbjct  240  TLQFGLDYESSKAAYSYN-GSVSHSVSLSSVDVGIVPESTMSDISISHRRPPKGTIDLFS  298

Query  426  G------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEV  265
            G      +Q   MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT+V
Sbjct  299  GPSIQMPTQLTPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV  358

Query  264  ESESDIDTLFSS  229
            E E  +D +FS+
Sbjct  359  EVE--VDQMFST  368



>gb|ACB36911.2| CONSTANS-like protein 1 [Oxybasis rubra]
Length=365

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q + +DREARV+RYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D
Sbjct  289  TQLSPLDREARVMRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--MD  346

Query  243  TLFSSADSAADVGRFSVVP  187
             +F+  +S    G + +VP
Sbjct  347  QMFT--NSLMSDGGYGIVP  363



>emb|CBI16899.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 8/87 (9%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      +Q   MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  340  ISHPRPPKGTIDLFSGPPIQMPTQLTPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  399

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSS  229
            TRPRIKGRFAKRT+VE E  +D +FS+
Sbjct  400  TRPRIKGRFAKRTDVEVE--VDQMFST  424



>ref|XP_002324936.1| CONSTANS-like protein 2 [Populus trichocarpa]
 gb|EEF03501.1| CONSTANS-like protein 2 [Populus trichocarpa]
Length=350

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 109/194 (56%), Gaps = 25/194 (13%)
 Frame = -1

Query  726  DNFLDFEYPVS--WESNSHQNQYNSDRVVPIQTIKT---SAPIIPQEKHFEIDFTRSNLT  562
            D +LD +  V    E     +   +D VVP+Q+ K    S  ++     +E+DF+  +  
Sbjct  166  DPYLDLDPYVDPKVEVQEQNSSGTTDGVVPVQSNKLGFQSPALVNDHCCYELDFSTGS-K  224

Query  561  SYNSGF-----TKpslsvsssldvgvvpdgssvSEIS----YRNIGGGSVDSRGGSQWNG  409
            S+  G+     ++   S S  + V     GS++++IS     R++  G   +    Q + 
Sbjct  225  SFGGGYGYNSLSQSVSSSSLDVGVVPDGSGSTLTDISNPYCSRSVCNGMESANQTVQLSA  284

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            +DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ E E D  +L+  
Sbjct  285  VDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDTEVEVDRSSLYG-  343

Query  228  ADSAADVGRFSVVP  187
                     F VVP
Sbjct  344  ---------FGVVP  348



>gb|ADL36670.1| COL domain class transcription factor [Malus domestica]
Length=364

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 4/85 (5%)
 Frame = -1

Query  435  SRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE  256
            S+  +Q  G++REARVLRYREKRKNRKF+KTIRYASRKAYAETRPRIKGRFAKRT+ E+E
Sbjct  280  SQPATQLCGLNREARVLRYREKRKNRKFQKTIRYASRKAYAETRPRIKGRFAKRTKTETE  339

Query  255  SDIDTLFSSADSAADVG--RFSVVP  187
            +  D ++ S  SA  +   +F VVP
Sbjct  340  T-FDLIYGSG-SATFISDPQFGVVP  362



>gb|ACV88633.1| CONSTANS [Magnolia virginiana]
Length=365

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q++ MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE E  + 
Sbjct  289  AQFSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVE--VH  346

Query  243  TLFSSADSAADVGRFSVVP  187
             +FS+   A    R+S+VP
Sbjct  347  QMFSTTVMAE--SRYSIVP  363



>ref|XP_010694604.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Beta vulgaris 
subsp. vulgaris]
 gb|ACC95129.1| COL1 [Beta vulgaris subsp. vulgaris]
Length=367

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q + +DREARV+RYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D
Sbjct  291  TQLSPLDREARVMRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--MD  348

Query  243  TLFSSADSAADVGRFSVVP  187
             +F+++   AD G + +VP
Sbjct  349  QMFTNS-LMADSG-YGIVP  365



>ref|XP_008379481.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Malus domestica]
Length=392

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 71/101 (70%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G+ D   GS      Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  294  ISHPRTPTGTXDLFSGSSIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  353

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +FS+   A +   + +VP
Sbjct  354  TRPRIKGRFAKRTEMEVE--VDQMFSTTLMAEN--GYGIVP  390



>gb|ADZ72833.1| CONSTANS-like protein [Aquilegia formosa]
Length=381

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q++ MDREARVLRYREKRK RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE E  +D
Sbjct  305  AQFSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVE--VD  362

Query  243  TLFSSADSAADVGRFSVVP  187
             +F+++   A+ G + +VP
Sbjct  363  QMFATS-VMAESG-YGIVP  379



>gb|KEH21799.1| zinc finger constans-like protein [Medicago truncatula]
Length=396

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            ++Y     G++D   G      S ++ MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  298  MTYSRPPKGTIDLFSGPSIQMSSHFSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  357

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRT+VE+E  +D +FS++    +VG + +VP
Sbjct  358  TRPRIKGRFAKRTDVEAE--VDQMFSTS-LITEVG-YGIVP  394



>gb|ABK96477.1| unknown [Populus trichocarpa x Populus deltoides]
Length=350

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 109/194 (56%), Gaps = 25/194 (13%)
 Frame = -1

Query  726  DNFLDFEYPVS--WESNSHQNQYNSDRVVPIQTIKTS--AP-IIPQEKHFEIDFTRSNLT  562
            D +LD +  V    E     +   +D VVP+Q+ K    AP ++     +E+DF+  +  
Sbjct  166  DPYLDLDPYVDPKVEVQEQNSSGTTDGVVPVQSNKLGFQAPALVNDNCCYELDFSTGS-K  224

Query  561  SYNSGF-----TKpslsvsssldvgvvpdgssvSEIS----YRNIGGGSVDSRGGSQWNG  409
            S+  G+     +    S S  + V     GS++++IS     R++  G   +    Q + 
Sbjct  225  SFGGGYGYNSLSHSVSSSSLDVGVVPDGSGSTLTDISNPYCSRSVSNGMESANQTVQLSA  284

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            +DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ E E D  +L+  
Sbjct  285  VDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDTEVEVDRSSLYG-  343

Query  228  ADSAADVGRFSVVP  187
                     F VVP
Sbjct  344  ---------FGVVP  348



>ref|XP_004491763.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Cicer arietinum]
Length=377

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            ++Y     G++D   G      S ++ MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  279  MTYSRPPKGTIDLFSGPPIQMTSHFSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  338

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRT+VE+E  +D +FSS     ++G + +VP
Sbjct  339  TRPRIKGRFAKRTDVEAE--VDQMFSST-LITEIG-YGIVP  375



>ref|XP_010421344.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Camelina 
sativa]
Length=360

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 104/167 (62%), Gaps = 9/167 (5%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNS-HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTR-SNLTSY  556
            D +LD +Y  V  +  S  QN   +D VVP++      P +  E  FE+DFT  S   +Y
Sbjct  178  DPYLDLDYGSVDPKVESLEQNSSGTDGVVPVENHTVRVPTV-NENCFELDFTGGSKGFAY  236

Query  555  NSGF-TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDREAR  391
              G+        SSS++VGVVPDG SV+++SY   G  +  +  GSQ        +REAR
Sbjct  237  GGGYNCISHSVSSSSMEVGVVPDGGSVADVSYPYGGSATSGADPGSQRAVPLTSAEREAR  296

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            V+RYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+    +D
Sbjct  297  VMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDTTESND  343



>gb|KJB68430.1| hypothetical protein B456_010G245200 [Gossypium raimondii]
 gb|KJB68431.1| hypothetical protein B456_010G245200 [Gossypium raimondii]
 gb|AJR28711.1| CONSTANS-like 3 protein [Gossypium raimondii]
Length=338

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 95/191 (50%), Gaps = 22/191 (12%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKIETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFTTPKALP  215

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVD-------SRGGSQWNGMDR  400
            Y   +         S  V        V       I   SV        +    Q +  +R
Sbjct  216  YGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTITDISVPCAKVTETTHQAVQLSSAER  275

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS  220
            EARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   ++     
Sbjct  276  EARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNMYG----  331

Query  219  AADVGRFSVVP  187
                  F VVP
Sbjct  332  ------FGVVP  336



>gb|AJR28758.1| CONSTANS-like 3 protein [Thespesia populneoides]
 gb|AJR28759.1| CONSTANS-like 3 protein [Thespesia populneoides]
Length=338

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP++  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETQDQEQNSSGTDGVVPVQSNTVQAPMV-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTMTDISVPCAKVTETTHQTVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSSAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            +           F VVP
Sbjct  330  YG----------FGVVP  336



>ref|XP_011085568.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Sesamum 
indicum]
Length=354

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 104/191 (54%), Gaps = 23/191 (12%)
 Frame = -1

Query  729  SDNFLDFEYPVSWESNSHQNQYNSDRVVPIQTIK----TSAPIIPQEKHFEIDFTRSNLT  562
            +D +L  +Y  S ++N   N Y+ ++  P Q+       S  ++P    +          
Sbjct  175  ADEYLALDYYNSCQNNQFNNGYSINQQQPCQSFPQRSYCSDSVVPIPPAY----------  224

Query  561  SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDR  400
            SY +  ++           GV    +S   +S      G+++   G      +Q +  DR
Sbjct  225  SYPASISQTVALPLMDHVGGVPEPATSEVSVSQTRPPKGTIELFSGPPVQIPTQLSPTDR  284

Query  399  EARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADS  220
            EARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKR+  ++E+++D LFS+  S
Sbjct  285  EARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSG-DAEAEVDQLFST--S  341

Query  219  AADVGRFSVVP  187
                  FSVVP
Sbjct  342  LVSESAFSVVP  352



>ref|XP_011044957.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Populus 
euphratica]
 ref|XP_011044958.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Populus 
euphratica]
 ref|XP_011012138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Populus euphratica]
Length=350

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 65/92 (71%), Gaps = 10/92 (11%)
 Frame = -1

Query  462  RNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRF  283
            R++  G   +    Q + +DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRF
Sbjct  267  RSVSNGMESANQTVQLSAVDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRF  326

Query  282  AKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            AKRT+ E E D  +L++          F VVP
Sbjct  327  AKRTDTEVEVDRSSLYA----------FGVVP  348



>gb|AEJ84000.1| CONSTANS protein [Nicotiana tabacum]
Length=403

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 16/103 (16%)
 Frame = -1

Query  468  SYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAET  307
            S+  +  G++D   G      +Q   MDREARVLRYRE+++NRKFEKTIRYASRKAYAET
Sbjct  306  SHPRLPKGTIDLFSGPPIQMPTQLTPMDREARVLRYREEKRNRKFEKTIRYASRKAYAET  365

Query  306  RPRIKGRFAKRTEVESESDIDTLFSS---ADSAADVGRFSVVP  187
            RPRIKGRFAKRT+VE+E  +D +FS+   ADS+     + +VP
Sbjct  366  RPRIKGRFAKRTDVEAE--VDQMFSTQLIADSS-----YGIVP  401



>gb|AAS67379.1| CONSTANS 3 [Solanum lycopersicum]
Length=409

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 2/60 (3%)
 Frame = -1

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D +FS+
Sbjct  338  MDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQMFST  395



>ref|XP_004232119.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
lycopersicum]
Length=409

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 2/60 (3%)
 Frame = -1

Query  408  MDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSS  229
            MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +D +FS+
Sbjct  338  MDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VDQMFST  395



>ref|XP_008341185.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5 isoform X1 [Malus 
domestica]
Length=424

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 4/85 (5%)
 Frame = -1

Query  435  SRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESE  256
            S+  +Q  G++REARVLRYREKRKNRKF+KTIRYASRKAYAETRPRIKGRFAKRT+ E+E
Sbjct  340  SQPATQLCGLNREARVLRYREKRKNRKFQKTIRYASRKAYAETRPRIKGRFAKRTKTETE  399

Query  255  SDIDTLFSSADSAADVG--RFSVVP  187
            +  D ++ S  SA  +   +F VVP
Sbjct  400  T-FDLIYGSG-SATFISDPQFGVVP  422



>ref|XP_009777143.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Nicotiana 
sylvestris]
Length=336

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 109/172 (63%), Gaps = 21/172 (12%)
 Frame = -1

Query  678  HQNQYNSDRVVP-IQT---IKTSAPIIPQEKHFEIDFTRSNLTSYN-SGFTKpslsvsss  514
            H  +Y  D VVP +Q    I    P++     +E+D + S    YN S  +      SSS
Sbjct  176  HVQEYKDDCVVPHVQNKNEIHLQGPVVNGYPTYEMDLSGSKPFMYNFSSQSISQSVSSSS  235

Query  513  ldvgvvpdgssvSEIS---YRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKT  343
            ++VGVVPD ++++++S    RN   G +     +  + +DREARVLRYREKRKNRKFEKT
Sbjct  236  MEVGVVPDHNTMADVSNTFVRNSSTGGL----PNPLSNLDREARVLRYREKRKNRKFEKT  291

Query  342  IRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            IRYASRKAYAETRPRIKGRFAKRTE E    +D+L +S+D++     + VVP
Sbjct  292  IRYASRKAYAETRPRIKGRFAKRTENE----VDSLIASSDAS-----YGVVP  334



>ref|XP_008341828.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Malus domestica]
 ref|XP_008368480.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Malus domestica]
Length=393

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  295  ISHPRTPKGTIDLFSGPTIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  354

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +F+++  A +   + +VP
Sbjct  355  TRPRIKGRFAKRTEMEVE--VDQMFATSLMAEN--GYGIVP  391



>ref|XP_009373735.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Pyrus x bretschneideri]
Length=397

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  299  ISHPRTPKGTIDLFSGPTIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  358

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +F+++  A +   + +VP
Sbjct  359  TRPRIKGRFAKRTEMEVE--VDQMFATSLMAEN--GYGIVP  395



>ref|XP_004173366.1| PREDICTED: zinc finger protein CONSTANS-like [Cucumis sativus]
Length=125

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  426  GSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
             +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE + D
Sbjct  48   AAQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVQLD  106



>gb|ADL36677.1| COL domain class transcription factor [Malus domestica]
Length=393

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 10/101 (10%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  295  ISHPRTPKGTIDLFSGPTIQMPTQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  354

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            TRPRIKGRFAKRTE+E E  +D +F+++  A +   + +VP
Sbjct  355  TRPRIKGRFAKRTEMEVE--VDQMFATSLMAEN--GYGIVP  391



>gb|ADO61394.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61395.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=144

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  78   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDMDIEVD  137

Query  243  TLFSSA  226
             +FS++
Sbjct  138  QMFSTS  143



>ref|NP_001274795.1| CONSTANS [Solanum tuberosum]
 gb|ABF56053.2| CONSTANS [Solanum tuberosum]
Length=413

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 2/64 (3%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q   MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+V++E  +D 
Sbjct  338  QLTPMDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVKAE--VDQ  395

Query  240  LFSS  229
            +FS+
Sbjct  396  MFST  399



>emb|CAN74840.1| hypothetical protein VITISV_035527 [Vitis vinifera]
Length=449

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 8/87 (9%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      +Q   MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  351  ISHPRPPKGTIDLFSGPPIQMPTQLTPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  410

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSS  229
            TRPRIKGRFAKRT+VE E  +D +FS+
Sbjct  411  TRPRIKGRFAKRTDVEVE--VDQMFST  435



>ref|XP_002282509.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Vitis vinifera]
Length=391

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 8/87 (9%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      +Q   MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  293  ISHPRPPKGTIDLFSGPPIQMPTQLTPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  352

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSS  229
            TRPRIKGRFAKRT+VE E  +D +FS+
Sbjct  353  TRPRIKGRFAKRTDVEVE--VDQMFST  377



>ref|XP_002532886.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF29491.1| zinc finger protein, putative [Ricinus communis]
Length=378

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 101/174 (58%), Gaps = 14/174 (8%)
 Frame = -1

Query  678  HQNQYNSDRVVPIQTIKTSAP-IIPQEKH---FEIDFTRSNLTSYNSGFTKpslsvsssl  511
            HQ  +  D VVP++    +    + Q+ H     ++F  S      +G    S+S+S   
Sbjct  207  HQKSHEGDSVVPVRCGDGAGKDHVHQQYHNFQLGLEFESSKAAYSYNGSISHSVSISPMD  266

Query  510  dvgvvpdgssvSEISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFE  349
               V     S + IS+     G++D   G      SQ +  DREARVLRYREK+K RKFE
Sbjct  267  VGVVPDSTMSEASISHPRPPKGTIDLFSGPPIQMPSQLSPRDREARVLRYREKKKTRKFE  326

Query  348  KTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            KTIRYASRKAYAETRPRIKGRFAKRT+VE E  +D +FS+A   A+ G + +VP
Sbjct  327  KTIRYASRKAYAETRPRIKGRFAKRTDVEVE--VDQIFSTA-LMAETG-YGIVP  376



>gb|AFK08986.1| CO-like protein [Fragaria x ananassa]
Length=382

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT++E E  +D
Sbjct  306  TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVE--MD  363

Query  243  TLFSSADSAADVGRFSVVP  187
             +FS++    + G +S+VP
Sbjct  364  QIFSTS-LMGETG-YSIVP  380



>ref|XP_002872134.1| hypothetical protein ARALYDRAFT_489353 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48393.1| hypothetical protein ARALYDRAFT_489353 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 103/167 (62%), Gaps = 8/167 (5%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNS-HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSYN  553
            D +LD +Y  V  +  S  QN   +D VVP++      P +  E  +E+DFT  +     
Sbjct  179  DPYLDLDYGSVDPKVESLEQNSSGTDGVVPVENRTVRVPTV-NENCYEMDFTGGSKGFAY  237

Query  552  SGF-TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDREARV  388
             G+        SSS++VGVVPDG SV+++SY   G  +  +  GSQ        +REARV
Sbjct  238  GGYNCISHSVSSSSMEVGVVPDGGSVADVSYPYGGPATSGADPGSQRAVPLTSAEREARV  297

Query  387  LRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
            +RYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+    SD+
Sbjct  298  MRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDTSESSDV  344



>ref|XP_010257847.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Nelumbo nucifera]
Length=365

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 108/199 (54%), Gaps = 32/199 (16%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYN-------------SDRVVPIQTIKTSAPIIPQEKHFEI  586
            D +LD    V + S +  NQYN             SD VVP+Q +        Q  H ++
Sbjct  178  DEYLDL---VDYSSCT-DNQYNQQQHYSVQHKNDGSDSVVPVQCLAVKEEQQQQNLHLDM  233

Query  585  DFTRSNLTSYNSGFTKpslsvsssldvgvvpdgssv-SEISYRNIGGGSVDSRGGS----  421
            D+  S       GF+       SS+D  VVPD        S+     G++D         
Sbjct  234  DYDASK-----PGFSYSHSVSLSSMDASVVPDAMMNDISNSHSRPPKGTIDLFSSPLAMP  288

Query  420  -QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
             Q+  MDREA+VLRYREKRK RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE E  ++
Sbjct  289  PQFTPMDREAKVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVE--VE  346

Query  243  TLFSSADSAADVGRFSVVP  187
             +FS+    A+ G + VVP
Sbjct  347  QMFSTT-VLAESG-YGVVP  363



>gb|AJR28808.1| CONSTANS-like 5 protein [Thespesia populneoides]
Length=335

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 92/165 (56%), Gaps = 15/165 (9%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTSY--NSGFTKpslsvsssldvg  502
            QN   +D VVP+Q+    A     +  F++DFT S   SY  N  F   S+S SS     
Sbjct  182  QNSSGTDGVVPVQSKNVQA-TSANDHCFDLDFTGSKPFSYGYNPNFISHSVSSSSLDVGV  240

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRK  322
            V    +   +IS      G   +    Q +  DREARVLRYREKRKNRKFEKTIRYASRK
Sbjct  241  VPDGSAMT-DIS-NPYARGPESTHQMVQLSPADREARVLRYREKRKNRKFEKTIRYASRK  298

Query  321  AYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            AYAE RPRIKGRFAKRT++E E D   ++           F VVP
Sbjct  299  AYAEMRPRIKGRFAKRTDIEVEVDRSNMYG----------FGVVP  333



>gb|ACZ67161.1| GATA-4/5/6 transcription factor, partial [Populus deltoides]
Length=117

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESD  250
            SQ + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPR+KGRFAKR +VE E D
Sbjct  43   SQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRVKGRFAKRKDVEVEDD  100



>ref|XP_010261698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Nelumbo 
nucifera]
 ref|XP_010261708.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Nelumbo 
nucifera]
Length=367

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q+  MDREA+VLRYREKRK RKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE E  +D 
Sbjct  292  QFTPMDREAKVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVE--VDQ  349

Query  240  LFSSADSAADVGRFSVVP  187
            +FS+    A+ G + +VP
Sbjct  350  MFSTT-VLAESG-YGIVP  365



>ref|XP_002309695.1| CONSTANS-like protein 2 [Populus trichocarpa]
 gb|EEE93218.1| CONSTANS-like protein 2 [Populus trichocarpa]
Length=348

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 96/179 (54%), Gaps = 18/179 (10%)
 Frame = -1

Query  699  VSWESNSHQNQYNSDRVVPIQTIKTS--AP-IIPQEKHFEIDFTRSNLT-----SYNSGF  544
            V  E     +   +D VVP+Q+ K    AP ++     FE+DF+  + T      YNS  
Sbjct  178  VEVEVQEQNSSGTTDGVVPVQSNKLGFQAPALVNDNCCFELDFSAGSKTFAGGYGYNSLS  237

Query  543  TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQWNGMDREARVLRYREKRK  364
               S S      V      + +S    R++  G   +    Q + +DREARVLRYREKRK
Sbjct  238  HSVSSSSLDVGVVPDGSTLTDISNPYSRSVSNGMESANQTVQLSAVDREARVLRYREKRK  297

Query  363  NRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            NRKFEKTIRYASRKAYAETRPRIKGRFAKRT+   E D  +++           F VVP
Sbjct  298  NRKFEKTIRYASRKAYAETRPRIKGRFAKRTDSGVEVDRSSIYG----------FGVVP  346



>gb|ADO61376.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61377.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61399.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=143

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  77   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  136

Query  243  TLFSSA  226
             +FS++
Sbjct  137  QMFSTS  142



>sp|Q940T9.2|COL4_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 4 [Arabidopsis 
thaliana]
 dbj|BAH30595.1| hypothetical protein [Arabidopsis thaliana]
Length=362

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 105/168 (63%), Gaps = 9/168 (5%)
 Frame = -1

Query  726  DNFLDFEYP-VSWESNS-HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTR-SNLTSY  556
            D +LD +Y  V  +  S  QN   +D VVP++      P +  E  FE+DFT  S   +Y
Sbjct  180  DPYLDLDYGNVDPKVESLEQNSSGTDGVVPVENRTVRIPTV-NENCFEMDFTGGSKGFTY  238

Query  555  NSGF-TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDREAR  391
              G+        SSS++VGVVPDG SV+++SY   G  +  +  G+Q        +REAR
Sbjct  239  GGGYNCISHSVSSSSMEVGVVPDGGSVADVSYPYGGPATSGADPGTQRAVPLTSAEREAR  298

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
            V+RYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+    +D+
Sbjct  299  VMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDTNESNDV  346



>gb|ADO61292.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61293.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61296.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61297.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61304.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61305.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61308.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61309.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61316.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61317.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61320.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61321.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61322.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61324.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61325.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61328.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61329.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61332.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61333.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61338.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61339.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61375.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=143

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  77   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  136

Query  243  TLFSSA  226
             +FS++
Sbjct  137  QMFSTS  142



>gb|ADO61362.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61363.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61365.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61366.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61367.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61368.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61369.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61378.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61380.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61381.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61390.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61391.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61392.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61393.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61398.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=143

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  77   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  136

Query  243  TLFSSA  226
             +FS++
Sbjct  137  QMFSTS  142



>gb|ADO61323.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61342.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61343.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61344.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61355.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61356.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61357.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61360.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61361.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61385.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=144

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  78   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  137

Query  243  TLFSSA  226
             +FS++
Sbjct  138  QMFSTS  143



>gb|ADO61359.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61387.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=143

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  77   AQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  136

Query  243  TLFSSA  226
             +FS++
Sbjct  137  QMFSTS  142



>gb|ADO61370.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61371.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=144

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  78   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  137

Query  243  TLFSSA  226
             +FS++
Sbjct  138  QMFSTS  143



>gb|ADO61358.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61382.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61383.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=143

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  77   AQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  136

Query  243  TLFSSA  226
             +FS++
Sbjct  137  QMFSTS  142



>gb|ACJ06578.1| CONSTANS [Fragaria x ananassa]
Length=384

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 2/66 (3%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT++E E  +D
Sbjct  308  TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVE--VD  365

Query  243  TLFSSA  226
             +FS++
Sbjct  366  QMFSTS  371



>gb|ADO61364.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=141

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  75   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  134

Query  243  TLFSSA  226
             +FS++
Sbjct  135  QMFSTS  140



>gb|ADO61298.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61299.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61345.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61346.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61347.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61348.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61349.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61350.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61351.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61352.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61353.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61354.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61372.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61373.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61374.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61379.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61384.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61386.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61388.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61389.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61396.1| CONSTANS-like 1, partial [Helianthus annuus]
 gb|ADO61397.1| CONSTANS-like 1, partial [Helianthus annuus]
Length=141

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  75   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  134

Query  243  TLFSSA  226
             +FS++
Sbjct  135  QMFSTS  140



>gb|ADO61280.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61281.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61282.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61283.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61284.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61285.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61286.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61287.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61288.1| CONSTANS-like 1, partial [Helianthus argophyllus]
 gb|ADO61289.1| CONSTANS-like 1, partial [Helianthus argophyllus]
Length=143

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q   +DREARVLRYREK+K RKFEKTIRYASRKAYAETRPRI+GRFAKRT ++ + ++D
Sbjct  77   TQLTPIDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIQGRFAKRTNLDIDIEVD  136

Query  243  TLFSSA  226
             +FS++
Sbjct  137  QMFSTS  142



>gb|AJR28626.1| CONSTANS-like 1 protein [Gossypium hirsutum]
Length=374

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 103/190 (54%), Gaps = 27/190 (14%)
 Frame = -1

Query  726  DNFLDF-EYPVSWE---SNSHQNQ--------YNSDRVVPIQT-----IKTSAPIIPQEK  598
            D++LD  EY  S E   ++ HQ Q        Y  D VVP+Q+              Q  
Sbjct  176  DDYLDLVEYNSSVENQFTDQHQQQHYGVPHKSYGGDSVVPVQSGEAKDHFQQQQQQHQNF  235

Query  597  HFEIDFTRSNLT-SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG-  424
             + +D+  S    SYN   T+     S  + +      S +S IS+     G++D   G 
Sbjct  236  QYGLDYDASKAAYSYNGSITRTVSLSSVDVGIVPESTMSDIS-ISHPRPPKGTIDLFSGP  294

Query  423  -----SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVES  259
                 +Q   M+REARVLRYREK+K RKFEKTIRYASRKAYAE RPRIKGRFAKRT+VE 
Sbjct  295  PTQMPTQLAPMEREARVLRYREKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDVEV  354

Query  258  ESDIDTLFSS  229
            E  +D +FS+
Sbjct  355  E--VDQMFST  362



>gb|KJB48246.1| hypothetical protein B456_008G059900 [Gossypium raimondii]
 gb|AJR28611.1| CONSTANS-like 1 protein [Gossypium raimondii]
 gb|AJR28613.1| CONSTANS-like 1 protein [Gossypium hirsutum]
 gb|AJR28615.1| CONSTANS-like 1 protein [Gossypium hirsutum]
 gb|AJR28617.1| CONSTANS-like 1 protein [Gossypium hirsutum]
 gb|AJR28619.1| CONSTANS-like 1 protein [Gossypium hirsutum]
 gb|AJR28629.1| CONSTANS-like 1 protein [Gossypium hirsutum var. marie-galante]
Length=374

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 103/190 (54%), Gaps = 27/190 (14%)
 Frame = -1

Query  726  DNFLDF-EYPVSWE---SNSHQNQ--------YNSDRVVPIQT-----IKTSAPIIPQEK  598
            D++LD  EY  S E   ++ HQ Q        Y  D VVP+Q+              Q  
Sbjct  176  DDYLDLVEYNSSVENQFTDQHQQQHYGVPHKSYGGDSVVPVQSGEAKDHFQQQQQQHQNF  235

Query  597  HFEIDFTRSNLT-SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG-  424
             + +D+  S    SYN   T+     S  + +      S +S IS+     G++D   G 
Sbjct  236  QYGLDYDASKAAYSYNGSITRTVSLSSVDVGIVPESTMSDIS-ISHPRPPKGTIDLFSGP  294

Query  423  -----SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVES  259
                 +Q   M+REARVLRYREK+K RKFEKTIRYASRKAYAE RPRIKGRFAKRT+VE 
Sbjct  295  PTQMPTQLAPMEREARVLRYREKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDVEV  354

Query  258  ESDIDTLFSS  229
            E  +D +FS+
Sbjct  355  E--VDQMFST  362



>gb|AJR28623.1| CONSTANS-like 1 protein [Gossypium hirsutum]
 gb|AJR28627.1| CONSTANS-like 1 protein [Gossypium hirsutum]
Length=374

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 103/190 (54%), Gaps = 27/190 (14%)
 Frame = -1

Query  726  DNFLDF-EYPVSWE---SNSHQNQ--------YNSDRVVPIQT-----IKTSAPIIPQEK  598
            D++LD  EY  S E   ++ HQ Q        Y  D VVP+Q+              Q  
Sbjct  176  DDYLDLVEYNSSVENQFTDQHQQQHYGVPHKSYGGDSVVPVQSGEAKDHFQQQQQQHQNF  235

Query  597  HFEIDFTRSNLT-SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG-  424
             + +D+  S    SYN   T+     S  + +      S +S IS+     G++D   G 
Sbjct  236  QYGLDYDASKAAYSYNGSITRTVSLSSVDVGIVPESTMSDIS-ISHPRPPKGTIDLFSGP  294

Query  423  -----SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVES  259
                 +Q   M+REARVLRYREK+K RKFEKTIRYASRKAYAE RPRIKGRFAKRT+VE 
Sbjct  295  PTQMPTQLAPMEREARVLRYREKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDVEV  354

Query  258  ESDIDTLFSS  229
            E  +D +FS+
Sbjct  355  E--VDQMFST  362



>gb|ABK95723.1| unknown [Populus trichocarpa]
Length=244

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            SQ + M+REARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT+V+ E  +D
Sbjct  168  SQLSPMEREARVLRYREKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVE--VD  225

Query  243  TLFSSADSAADVGRFSVVP  187
             +FSS   A     + +VP
Sbjct  226  QMFSSTLMAETA--YGIVP  242



>gb|ACZ67163.1| GATA-4/5/6 transcription factor, partial [Populus balsamifera]
 gb|AFZ84540.1| GATA-4/5/6 transcription factor, partial [Populus trichocarpa]
 gb|AFZ84542.1| GATA-4/5/6 transcription factor, partial [Populus maximowiczii]
Length=109

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 63/92 (68%), Gaps = 10/92 (11%)
 Frame = -1

Query  462  RNIGGGSVDSRGGSQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRF  283
            R++  G   +    Q + +DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRF
Sbjct  26   RSVSNGMESANQTVQLSAVDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRF  85

Query  282  AKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            AKRT+   E D  +++           F VVP
Sbjct  86   AKRTDSGVEVDRSSIYG----------FGVVP  107



>ref|XP_010493742.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Camelina sativa]
Length=358

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 108/170 (64%), Gaps = 13/170 (8%)
 Frame = -1

Query  726  DNFLDFEY-PVSWESNS-HQNQYNSDRVVPIQ--TIKTSAPIIPQEKHFEIDFTR-SNLT  562
            D +LD +Y  V  +  S  QN   +D VVP++  T++ S      E  FE+DFT  S   
Sbjct  176  DPYLDLDYGSVDPKVESLEQNSSGTDGVVPVENRTVRVS---TVNENCFELDFTGGSKGF  232

Query  561  SYNSGF-TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDRE  397
            +Y+ G+        SSS++VGVVPDG SV+++SY   G  +  +  GSQ        +RE
Sbjct  233  AYSGGYNCISHSVSSSSMEVGVVPDGGSVADVSYPYGGSATSGADPGSQRAVPLTSAERE  292

Query  396  ARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
            ARV+RYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+    +D+
Sbjct  293  ARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDTSESNDV  342



>ref|XP_006338763.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
tuberosum]
Length=279

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 65/81 (80%), Gaps = 10/81 (12%)
 Frame = -1

Query  420  QWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDT  241
            Q   MDREARVLRYREK+KNRKFEKTIRYASRKAYAETRPRIKGRFAKRT+VE+E  +  
Sbjct  204  QLTPMDREARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAE--VYQ  261

Query  240  LFSS---ADSAADVGRFSVVP  187
            +FS+   ADS+     + +VP
Sbjct  262  MFSTQLMADSS-----YRIVP  277



>gb|AJR28712.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28714.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28716.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28718.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28722.1| CONSTANS-like 3 protein [Gossypium hirsutum]
 gb|AJR28726.1| CONSTANS-like 3 protein [Gossypium hirsutum]
Length=338

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP+I  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETPDQDQNSSGTDGVVPVQSNTVQAPMI-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTITDVSVPCAKVTETTYQTVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSLAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            +           F VVP
Sbjct  330  YG----------FGVVP  336



>gb|AJR28734.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28736.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28742.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28748.1| CONSTANS-like 3 protein [Gossypium barbadense var. peruvianum]
Length=338

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP+I  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETPDQDQNSSGTDGVVPVQSNTVQAPMI-NDHCFDMEFTAPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTITDVSVPCAKVTETTYQTVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSLAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            +           F VVP
Sbjct  330  YG----------FGVVP  336



>gb|AFK08985.1| CONSTANTS-like protein [Fragaria x ananassa]
Length=381

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 2/66 (3%)
 Frame = -1

Query  423  SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDID  244
            +Q + MDREARVLRYREK+K RKFEKTIRYASRKAYAETRPRIKGRFAKRT++E E  +D
Sbjct  305  TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVE--VD  362

Query  243  TLFSSA  226
             +FS++
Sbjct  363  QMFSTS  368



>gb|AJR28738.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28740.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28744.1| CONSTANS-like 3 protein [Gossypium barbadense]
 gb|AJR28746.1| CONSTANS-like 3 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28750.1| CONSTANS-like 3 protein [Gossypium barbadense var. brasiliense]
 gb|AJR28754.1| CONSTANS-like 3 protein [Gossypium mustelinum]
Length=338

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -1

Query  726  DNFLDFEY----PVSWESNSHQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTRSNLTS  559
            D +LD +Y    P     +  QN   +D VVP+Q+    AP+I  +  F+++FT      
Sbjct  157  DPYLDLDYGHVDPKMETPDQDQNSSGTDGVVPVQSNTVQAPMI-NDHCFDMEFTTPK---  212

Query  558  YNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSV-------------DSRGGSQ  418
                F        +     +    SS S        GGS               +    Q
Sbjct  213  ---AFPYGYNYNCNYNPHCLSHSVSSSSLDVGVVPDGGSTITDVSVPCAKVTETTYQTVQ  269

Query  417  WNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDIDTL  238
             +  +REARVLRYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKR++VE E D   +
Sbjct  270  LSLAEREARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRSDVEVEVDGGNM  329

Query  237  FSSADSAADVGRFSVVP  187
            +           F VVP
Sbjct  330  YG----------FGVVP  336



>ref|XP_006430882.1| hypothetical protein CICLE_v10012022mg [Citrus clementina]
 gb|ESR44122.1| hypothetical protein CICLE_v10012022mg [Citrus clementina]
Length=365

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 98/171 (57%), Gaps = 12/171 (7%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEI--DFTRSNLTSYNSGFTKpslsvsssldvg  502
            Q  Y  D VVP+Q    +      +++F++  D+  S      +G    S+SVSS+    
Sbjct  197  QKGYVGDSVVPVQCELANKDHHRHQQNFQLGLDYDSSKAGYSYNGSISHSVSVSSTDLGV  256

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTI  340
            V     S   IS+     G++D   G       Q   MDREARVLRYREK+K RKFEKTI
Sbjct  257  VPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQLTPMDREARVLRYREKKKTRKFEKTI  316

Query  339  RYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            RYASRKAYAETRPRIKGRFAKRT+ E E  +D +F SA    D G + +VP
Sbjct  317  RYASRKAYAETRPRIKGRFAKRTDAEVE--VDQMF-SATLMTDPG-YGIVP  363



>gb|KDO58878.1| hypothetical protein CISIN_1g017819mg [Citrus sinensis]
Length=365

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 98/171 (57%), Gaps = 12/171 (7%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFEI--DFTRSNLTSYNSGFTKpslsvsssldvg  502
            Q  Y  D VVP+Q    +      +++F++  D+  S      +G    S+SVSS+    
Sbjct  197  QKGYVGDSVVPVQCELANKDHHRHQQNFQLGLDYDSSKAGYSYNGSISHSVSVSSTDLGV  256

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTI  340
            V     S   IS+     G++D   G       Q   MDREARVLRYREK+K RKFEKTI
Sbjct  257  VPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQLTPMDREARVLRYREKKKTRKFEKTI  316

Query  339  RYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            RYASRKAYAETRPRIKGRFAKRT+ E E  +D +F SA    D G + +VP
Sbjct  317  RYASRKAYAETRPRIKGRFAKRTDAEVE--VDQMF-SATLMTDPG-YGIVP  363



>ref|XP_006482341.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Citrus sinensis]
Length=365

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 98/171 (57%), Gaps = 12/171 (7%)
 Frame = -1

Query  675  QNQYNSDRVVPIQTIKTSAPIIPQEKHFE--IDFTRSNLTSYNSGFTKpslsvsssldvg  502
            Q  Y  D VVP+Q    +      +++F+  +D+  S      +G    S+SVSS+    
Sbjct  197  QKGYVGDSVVPVQCELANKDHHRHQQNFQMGLDYDSSKAGYSYNGSISHSVSVSSTDLGV  256

Query  501  vvpdgssvSEISYRNIGGGSVDSRGGS------QWNGMDREARVLRYREKRKNRKFEKTI  340
            V     S   IS+     G++D   G       Q   MDREARVLRYREK+K RKFEKTI
Sbjct  257  VPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQLTPMDREARVLRYREKKKTRKFEKTI  316

Query  339  RYASRKAYAETRPRIKGRFAKRTEVESESDIDTLFSSADSAADVGRFSVVP  187
            RYASRKAYAETRPRIKGRFAKRT+ E E  +D +F SA    D G + +VP
Sbjct  317  RYASRKAYAETRPRIKGRFAKRTDAEVE--VDQMF-SATLMTDPG-YGIVP  363



>gb|AJR28647.1| CONSTANS-like 1 protein [Gossypium barbadense var. peruvianum]
 gb|AJR28651.1| CONSTANS-like 1 protein [Gossypium barbadense var. brasiliense]
Length=374

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 103/190 (54%), Gaps = 27/190 (14%)
 Frame = -1

Query  726  DNFLDF-EYPVSWE---SNSHQNQ--------YNSDRVVPIQT-----IKTSAPIIPQEK  598
            D++LD  EY  S E   ++ HQ Q        Y  D VVP+Q+              Q  
Sbjct  176  DDYLDLVEYNSSVENQFTDQHQQQHYGVPHKSYGGDSVVPVQSGEAKDHFQQQQQQHQNF  235

Query  597  HFEIDFTRSNLT-SYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGG-  424
             + +D+  S    SYN   T+     S  + +      S +S IS+     G++D   G 
Sbjct  236  QYGLDYDASKAAYSYNGSITRTVSLSSVDVGIVPESTMSDIS-ISHPRPPKGTIDLFSGP  294

Query  423  -----SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVES  259
                 +Q   M+REARVLRYREK+K RKFEKTIRYASRKAYAE RPRIKGRFAKRT+VE 
Sbjct  295  PTQMPNQLAPMEREARVLRYREKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDVEV  354

Query  258  ESDIDTLFSS  229
            E  +D +FS+
Sbjct  355  E--VDQMFST  362



>ref|NP_197875.2| zinc finger protein CONSTANS-LIKE 4 [Arabidopsis thaliana]
 gb|AED93379.1| zinc finger protein CONSTANS-LIKE 4 [Arabidopsis thaliana]
Length=406

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 105/168 (63%), Gaps = 9/168 (5%)
 Frame = -1

Query  726  DNFLDFEYP-VSWESNS-HQNQYNSDRVVPIQTIKTSAPIIPQEKHFEIDFTR-SNLTSY  556
            D +LD +Y  V  +  S  QN   +D VVP++      P +  E  FE+DFT  S   +Y
Sbjct  224  DPYLDLDYGNVDPKVESLEQNSSGTDGVVPVENRTVRIPTV-NENCFEMDFTGGSKGFTY  282

Query  555  NSGF-TKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQ----WNGMDREAR  391
              G+        SSS++VGVVPDG SV+++SY   G  +  +  G+Q        +REAR
Sbjct  283  GGGYNCISHSVSSSSMEVGVVPDGGSVADVSYPYGGPATSGADPGTQRAVPLTSAEREAR  342

Query  390  VLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
            V+RYREKRKNRKFEKTIRYASRKAYAE RPRIKGRFAKRT+    +D+
Sbjct  343  VMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDTNESNDV  390



>ref|XP_010029446.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Eucalyptus grandis]
 gb|KCW56361.1| hypothetical protein EUGRSUZ_I02094 [Eucalyptus grandis]
Length=387

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 8/87 (9%)
 Frame = -1

Query  471  ISYRNIGGGSVDSRGG------SQWNGMDREARVLRYREKRKNRKFEKTIRYASRKAYAE  310
            IS+     G++D   G      SQ + MDREARVLRYREK+K RKFEKTIRYASRKAYAE
Sbjct  289  ISHPRPPKGTIDLFSGPPIQMPSQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  348

Query  309  TRPRIKGRFAKRTEVESESDIDTLFSS  229
            TRPRIKGRFAKRT+V+ E  +D +FS+
Sbjct  349  TRPRIKGRFAKRTDVDIE--VDQMFSA  373



>emb|CDP14453.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 94/179 (53%), Gaps = 26/179 (15%)
 Frame = -1

Query  726  DNFLDFEYPVSWESNSHQNQYN------------SDRVVPIQT----IKTSAPIIPQEKH  595
            D +LD +  +S +   H  QY             SD VVP+Q          P++     
Sbjct  163  DPYLDMDL-ISSDQKPHVVQYQNHHHNHVHQQHNSDGVVPVQNKNDPTHLPGPVVDGFPT  221

Query  594  FEIDFTRSNLTSYNSGFTKpslsvsssldvgvvpdgssvSEISYRNIGGGSVDSRGGSQW  415
            +E+DF  S    YN      S SVSSS     V    +       N       SR  +  
Sbjct  222  YEMDFAGSKSFMYNFSSQSISQSVSSSSMEVGVVPDHNAMADVSNNF------SRSDAVT  275

Query  414  N---GMDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEVESESDI  247
            N   G+DREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR EVE ES I
Sbjct  276  NPVSGVDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRAEVEIESLI  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470