BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF017A09

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15807.1|  unnamed protein product                                328   2e-107   Coffea canephora [robusta coffee]
ref|XP_009623694.1|  PREDICTED: kynurenine--oxoglutarate transami...    328   1e-106   Nicotiana tomentosiformis
ref|XP_009784157.1|  PREDICTED: kynurenine--oxoglutarate transami...    328   1e-106   Nicotiana sylvestris
ref|XP_007223278.1|  hypothetical protein PRUPE_ppa005521mg             327   5e-106   Prunus persica
ref|XP_006342816.1|  PREDICTED: kynurenine--oxoglutarate transami...    323   6e-106   Solanum tuberosum [potatoes]
emb|CBI19046.3|  unnamed protein product                                323   1e-105   Vitis vinifera
ref|XP_006383469.1|  hypothetical protein POPTR_0005s15870g             318   3e-105   
ref|XP_006351874.1|  PREDICTED: kynurenine--oxoglutarate transami...    324   5e-105   Solanum tuberosum [potatoes]
ref|XP_008219754.1|  PREDICTED: kynurenine--oxoglutarate transami...    323   8e-105   Prunus mume [ume]
ref|XP_004250335.1|  PREDICTED: kynurenine--oxoglutarate transami...    323   1e-104   Solanum lycopersicum
ref|XP_010664229.1|  PREDICTED: kynurenine--oxoglutarate transami...    323   1e-104   Vitis vinifera
ref|XP_009340883.1|  PREDICTED: kynurenine--oxoglutarate transami...    322   2e-104   
ref|XP_009344105.1|  PREDICTED: kynurenine--oxoglutarate transami...    322   4e-104   Pyrus x bretschneideri [bai li]
ref|XP_007019005.1|  Pyridoxal phosphate (PLP)-dependent transfer...    319   4e-104   
ref|XP_002306622.2|  hypothetical protein POPTR_0005s15890g             320   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_007019003.1|  Pyridoxal phosphate-dependent transferases s...    320   3e-103   
ref|XP_010999356.1|  PREDICTED: kynurenine--oxoglutarate transami...    320   3e-103   Populus euphratica
ref|XP_011069560.1|  PREDICTED: kynurenine--oxoglutarate transami...    318   3e-103   Sesamum indicum [beniseed]
ref|XP_008388248.1|  PREDICTED: kynurenine--oxoglutarate transami...    319   4e-103   
gb|KJB29235.1|  hypothetical protein B456_005G090600                    319   5e-103   Gossypium raimondii
ref|XP_011074863.1|  PREDICTED: kynurenine--oxoglutarate transami...    318   1e-102   Sesamum indicum [beniseed]
ref|XP_002302248.2|  hypothetical protein POPTR_0002s08650g             317   3e-102   Populus trichocarpa [western balsam poplar]
ref|XP_004290845.1|  PREDICTED: kynurenine--oxoglutarate transami...    316   5e-102   Fragaria vesca subsp. vesca
ref|XP_011027573.1|  PREDICTED: kynurenine--oxoglutarate transami...    316   6e-102   Populus euphratica
ref|XP_011027572.1|  PREDICTED: kynurenine--oxoglutarate transami...    316   6e-102   Populus euphratica
ref|XP_010678294.1|  PREDICTED: kynurenine--oxoglutarate transami...    315   1e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010939394.1|  PREDICTED: kynurenine--oxoglutarate transami...    315   2e-101   Elaeis guineensis
ref|XP_004499406.1|  PREDICTED: probable N-succinyldiaminopimelat...    314   3e-101   Cicer arietinum [garbanzo]
gb|KDP32776.1|  hypothetical protein JCGZ_12068                         314   3e-101   Jatropha curcas
ref|XP_008444130.1|  PREDICTED: kynurenine--oxoglutarate transami...    313   6e-101   Cucumis melo [Oriental melon]
ref|XP_008797287.1|  PREDICTED: kynurenine--oxoglutarate transami...    313   6e-101   Phoenix dactylifera
ref|XP_002513782.1|  Aminotransferase ybdL, putative                    313   7e-101   Ricinus communis
ref|XP_010063369.1|  PREDICTED: kynurenine--oxoglutarate transami...    313   8e-101   Eucalyptus grandis [rose gum]
ref|XP_006472747.1|  PREDICTED: kynurenine--oxoglutarate transami...    313   8e-101   Citrus sinensis [apfelsine]
ref|XP_010272813.1|  PREDICTED: kynurenine--oxoglutarate transami...    313   9e-101   Nelumbo nucifera [Indian lotus]
ref|XP_004142619.1|  PREDICTED: methionine aminotransferase-like ...    313   1e-100   Cucumis sativus [cucumbers]
ref|XP_010272812.1|  PREDICTED: kynurenine--oxoglutarate transami...    312   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_003601072.1|  Kynurenine-oxoglutarate transaminase               309   4e-100   
gb|KHG09776.1|  putative N-succinyldiaminopimelate aminotransfera...    311   5e-100   Gossypium arboreum [tree cotton]
gb|ACJ84430.1|  unknown                                                 307   5e-100   Medicago truncatula
gb|KFK42160.1|  hypothetical protein AALP_AA2G219100                    309   8e-100   Arabis alpina [alpine rockcress]
ref|XP_006390068.1|  hypothetical protein EUTSA_v10018556mg             310   9e-100   Eutrema salsugineum [saltwater cress]
ref|XP_010091367.1|  Methionine aminotransferase                        310   2e-99    Morus notabilis
gb|AES71323.2|  aspartate aminotransferase family protein               309   2e-99    Medicago truncatula
gb|AFK42780.1|  unknown                                                 305   5e-99    Medicago truncatula
ref|XP_009399718.1|  PREDICTED: kynurenine--oxoglutarate transami...    307   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR25585.1|  aspartate aminotransferase                              300   2e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_009399719.1|  PREDICTED: kynurenine--oxoglutarate transami...    307   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007137384.1|  hypothetical protein PHAVU_009G122900g             306   2e-98    Phaseolus vulgaris [French bean]
dbj|BAK03435.1|  predicted protein                                      305   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11157.1|  Aminotransferase ybdL                                   305   2e-98    
dbj|BAE86874.1|  putative asparate aminotransferase                     305   4e-98    Hordeum vulgare [barley]
gb|AFK38988.1|  unknown                                                 305   4e-98    Lotus japonicus
ref|XP_006660686.1|  PREDICTED: kynurenine--oxoglutarate transami...    306   4e-98    Oryza brachyantha
ref|XP_003578218.1|  PREDICTED: kynurenine--oxoglutarate transami...    306   5e-98    Brachypodium distachyon [annual false brome]
gb|EYU23901.1|  hypothetical protein MIMGU_mgv1a005453mg                306   8e-98    Erythranthe guttata [common monkey flower]
gb|AET06147.1|  PLP-dependent aminotransferase                          305   9e-98    Papaver somniferum
dbj|BAG99582.1|  unnamed protein product                                302   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010416722.1|  PREDICTED: kynurenine--oxoglutarate transami...    304   2e-97    Camelina sativa [gold-of-pleasure]
gb|AAM67247.1|  putative aminotransferase                               303   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KHN09186.1|  Methionine aminotransferase                             303   2e-97    Glycine soja [wild soybean]
ref|XP_003526620.1|  PREDICTED: kynurenine--oxoglutarate transami...    303   3e-97    Glycine max [soybeans]
gb|AFK47441.1|  unknown                                                 304   3e-97    Lotus japonicus
ref|XP_003523457.1|  PREDICTED: kynurenine--oxoglutarate transami...    303   3e-97    Glycine max [soybeans]
ref|XP_010471962.1|  PREDICTED: kynurenine--oxoglutarate transami...    303   4e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010428850.1|  PREDICTED: kynurenine--oxoglutarate transami...    303   4e-97    Camelina sativa [gold-of-pleasure]
gb|AFK34714.1|  unknown                                                 294   4e-97    Medicago truncatula
gb|EPS67132.1|  hypothetical protein M569_07644                         301   6e-97    Genlisea aurea
gb|EEE69839.1|  hypothetical protein OsJ_29606                          303   7e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956995.1|  PREDICTED: kynurenine--oxoglutarate transami...    303   8e-97    Setaria italica
gb|EEC84693.1|  hypothetical protein OsI_31623                          302   9e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_009104610.1|  PREDICTED: kynurenine--oxoglutarate transami...    302   1e-96    Brassica rapa
ref|XP_002460319.1|  hypothetical protein SORBIDRAFT_02g026430          302   1e-96    Sorghum bicolor [broomcorn]
ref|NP_001063347.1|  Os09g0453800                                       302   2e-96    
ref|NP_177890.1|  putative aminotransferase                             301   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845935.1|  hypothetical protein AMTR_s00157p00073660          301   3e-96    Amborella trichopoda
ref|XP_002889153.1|  hypothetical protein ARALYDRAFT_339926             298   7e-96    
ref|XP_010534655.1|  PREDICTED: kynurenine--oxoglutarate transami...    299   3e-95    Tarenaya hassleriana [spider flower]
gb|AAL67016.1|  putative aminotransferase                               298   3e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDX79227.1|  BnaC06g20760D                                          298   4e-95    
emb|CDY69561.1|  BnaCnng64190D                                          298   4e-95    Brassica napus [oilseed rape]
ref|NP_001143647.1|  uncharacterized protein LOC100276369               290   5e-92    Zea mays [maize]
gb|AES71324.2|  aspartate aminotransferase family protein               288   6e-92    Medicago truncatula
tpg|DAA61742.1|  TPA: aspartate aminotransferase isoform 1              290   1e-91    
gb|AFK46586.1|  unknown                                                 287   2e-91    Medicago truncatula
ref|XP_003601073.1|  Aspartate aminotransferase                         289   3e-91    
ref|XP_007137383.1|  hypothetical protein PHAVU_009G122800g             286   5e-91    Phaseolus vulgaris [French bean]
ref|XP_006300478.1|  hypothetical protein CARUB_v10020303mg             285   3e-90    Capsella rubella
gb|ABR16855.1|  unknown                                                 285   6e-90    Picea sitchensis
ref|XP_001771268.1|  predicted protein                                  274   3e-86    
ref|XP_001763726.1|  predicted protein                                  271   4e-85    
gb|KDO80718.1|  hypothetical protein CISIN_1g013883mg                   258   1e-79    Citrus sinensis [apfelsine]
ref|XP_006434152.1|  hypothetical protein CICLE_v10001202mg             252   2e-77    
gb|KHN09185.1|  Methionine aminotransferase                             246   8e-76    Glycine soja [wild soybean]
gb|EMS66098.1|  Aminotransferase YbdL                                   240   2e-73    Triticum urartu
ref|XP_002990980.1|  hypothetical protein SELMODRAFT_161313             238   5e-72    
ref|XP_002982875.1|  hypothetical protein SELMODRAFT_422162             238   5e-72    
ref|XP_010999404.1|  PREDICTED: kynurenine--oxoglutarate transami...    196   3e-58    Populus euphratica
emb|CDX88383.1|  BnaC06g38270D                                          189   8e-57    
ref|WP_019888156.1|  aminotransferase                                   192   1e-54    
ref|WP_030383719.1|  aminotransferase                                   191   3e-54    Streptomyces sp. NRRL S-241
ref|WP_013940377.1|  aminotransferase                                   189   1e-53    Myxococcus macrosporus
ref|WP_030781937.1|  aminotransferase                                   189   2e-53    
ref|WP_042423565.1|  aminotransferase                                   188   2e-53    Streptacidiphilus anmyonensis
ref|WP_031133913.1|  aminotransferase                                   188   2e-53    Streptomyces
ref|WP_027748891.1|  aminotransferase                                   189   3e-53    Streptomyces sp. CNH287
ref|WP_035951716.1|  aminotransferase                                   187   6e-53    
gb|EFC83773.1|  aminotransferase class I and II                         187   9e-53    Frankia sp. EUN1f
ref|WP_042378863.1|  aminotransferase                                   186   1e-52    Streptacidiphilus melanogenes
ref|WP_030645179.1|  aminotransferase                                   186   1e-52    Streptomyces rimosus
ref|WP_034089273.1|  aminotransferase                                   185   3e-52    Streptacidiphilus albus
ref|WP_004985468.1|  aminotransferase                                   185   4e-52    Streptomyces viridosporus
ref|WP_030590168.1|  aminotransferase                                   185   4e-52    Streptomyces
ref|WP_030086097.1|  aminotransferase                                   181   4e-52    
ref|WP_032916916.1|  aminotransferase                                   185   4e-52    Streptomyces rimosus
gb|KEF21180.1|  aminotransferase                                        185   4e-52    Streptomyces rimosus
ref|WP_003979925.1|  MULTISPECIES: aminotransferase                     185   4e-52    Streptomycetaceae
ref|WP_042453819.1|  aminotransferase                                   185   5e-52    Streptacidiphilus jiangxiensis
ref|WP_030709223.1|  aminotransferase                                   185   6e-52    Streptomyces sp. NRRL F-2580
ref|WP_031172603.1|  aminotransferase                                   184   9e-52    Streptomyces durhamensis
ref|WP_037892802.1|  aminotransferase                                   184   1e-51    Streptomyces xanthophaeus
ref|WP_030199323.1|  aminotransferase                                   184   1e-51    Streptomyces sp. NRRL S-87
ref|WP_042820109.1|  aminotransferase                                   183   2e-51    
ref|WP_030299152.1|  aminotransferase                                   183   2e-51    
ref|WP_018092406.1|  aminotransferase                                   183   2e-51    Streptomyces sp. FxanaC1
ref|WP_030870913.1|  aminotransferase                                   183   2e-51    
ref|WP_030957921.1|  aminotransferase                                   183   2e-51    Streptomyces sp. NRRL S-378
ref|WP_030056597.1|  MULTISPECIES: aminotransferase                     183   2e-51    
ref|WP_030152887.1|  aminotransferase                                   183   2e-51    
ref|WP_011553764.1|  aminotransferase                                   183   3e-51    Myxococcus xanthus
ref|WP_030620605.1|  aminotransferase                                   183   3e-51    Streptomyces achromogenes
ref|WP_033208187.1|  aminotransferase                                   183   3e-51    Streptomyces bikiniensis
ref|WP_030790852.1|  aminotransferase                                   183   3e-51    Streptomyces lavenduligriseus
ref|WP_030726560.1|  aminotransferase                                   183   3e-51    Streptomyces sp. NRRL S-237
ref|WP_037575899.1|  aminotransferase                                   183   3e-51    Streptacidiphilus oryzae
ref|WP_019524271.1|  aminotransferase                                   182   5e-51    Streptomyces sp. FxanaD5
ref|WP_033818282.1|  aminotransferase                                   182   6e-51    Kitasatospora sp. MBT63
ref|WP_018558364.1|  aminotransferase                                   182   7e-51    Streptomyces sp. BoleA5
ref|WP_043221284.1|  aminotransferase                                   182   7e-51    Streptomyces sp. NRRL F-5193
ref|WP_030010115.1|  aminotransferase                                   182   7e-51    
ref|WP_028964077.1|  aminotransferase                                   182   7e-51    Streptomyces thermolilacinus
ref|WP_033215091.1|  aminotransferase                                   182   8e-51    Streptomyces virginiae
ref|WP_030838833.1|  aminotransferase                                   182   9e-51    Streptomyces sp. NRRL F-4474
ref|WP_031005109.1|  aminotransferase                                   181   1e-50    
ref|WP_030232948.1|  aminotransferase                                   181   1e-50    Streptomyces sp. NRRL S-350
ref|WP_023418492.1|  aminotransferase                                   181   1e-50    
ref|WP_037601224.1|  aminotransferase                                   181   1e-50    Streptacidiphilus rugosus
ref|WP_031037202.1|  aminotransferase                                   181   2e-50    Streptomyces
ref|WP_032760413.1|  aminotransferase                                   181   2e-50    Streptomyces alboviridis
ref|WP_007496557.1|  aminotransferase                                   181   2e-50    Streptomyces zinciresistens
ref|WP_030982006.1|  aminotransferase                                   181   2e-50    Streptomyces sp. NRRL WC-3744
ref|WP_030495875.1|  aminotransferase                                   181   2e-50    
ref|WP_042801172.1|  aminotransferase                                   181   2e-50    
ref|WP_030307008.1|  aminotransferase                                   181   2e-50    Streptomyces
ref|WP_037969753.1|  aminotransferase                                   181   2e-50    
gb|EFL16084.1|  aminotransferase                                        181   2e-50    Streptomyces sp. C
ref|WP_031050364.1|  aminotransferase                                   181   2e-50    Streptomyces ochraceiscleroticus
ref|WP_015609568.1|  Aminotransferase                                   180   2e-50    Streptomyces fulvissimus
ref|WP_028959526.1|  aminotransferase                                   181   3e-50    Streptomyces sp. UNC401CLCol
ref|WP_035799511.1|  aminotransferase                                   180   3e-50    Kitasatospora mediocidica
ref|WP_030342399.1|  aminotransferase                                   180   3e-50    Streptomyces
ref|WP_003949184.1|  MULTISPECIES: aminotransferase                     180   3e-50    Streptomyces
ref|WP_037844089.1|  aminotransferase                                   180   3e-50    Streptomyces
ref|WP_030817408.1|  MULTISPECIES: aminotransferase                     180   4e-50    
ref|WP_035864299.1|  aminotransferase                                   180   4e-50    Kitasatospora cheerisanensis
ref|WP_037850792.1|  aminotransferase                                   180   4e-50    Streptomyces sp. NRRL S-340
ref|WP_030026710.1|  aminotransferase                                   180   4e-50    
ref|WP_037960119.1|  aminotransferase                                   180   4e-50    Streptomyces violens
ref|WP_037920790.1|  aminotransferase                                   180   4e-50    
ref|WP_030258006.1|  aminotransferase                                   180   4e-50    Streptacidiphilus jeojiense
ref|WP_008408921.1|  MULTISPECIES: aminotransferase                     180   4e-50    Streptomyces
ref|WP_010644765.1|  aminotransferase                                   180   4e-50    
ref|WP_030696112.1|  aminotransferase                                   180   4e-50    Streptomyces
ref|WP_031091937.1|  MULTISPECIES: aminotransferase                     180   4e-50    Streptomyces
ref|WP_014673961.1|  aminotransferase                                   180   5e-50    Streptomyces
ref|WP_037782835.1|  aminotransferase                                   180   5e-50    
ref|WP_023422382.1|  MULTISPECIES: aminotransferase                     179   5e-50    Streptomyces
gb|KIX77321.1|  aminotransferase                                        179   5e-50    Streptomyces sp. MBRL 601
ref|WP_042836185.1|  aminotransferase                                   176   5e-50    
ref|WP_041819600.1|  aminotransferase                                   179   6e-50    Streptomyces davaonensis
ref|WP_033040348.1|  aminotransferase                                   179   6e-50    Streptomyces monomycini
ref|WP_030372953.1|  aminotransferase                                   179   6e-50    Streptomyces
emb|CCK28600.1|  Aminotransferase YbdL                                  179   6e-50    Streptomyces davaonensis JCM 4913
ref|WP_030755723.1|  MULTISPECIES: aminotransferase                     179   7e-50    Streptomyces
ref|WP_028415999.1|  aminotransferase                                   179   7e-50    Streptomyces sp. SolWspMP-sol2th
ref|WP_037681133.1|  aminotransferase                                   179   7e-50    Streptomyces albus
gb|EWM62867.1|  aminotransferase, class I                               175   7e-50    Micromonospora sp. M42
ref|WP_018489581.1|  aminotransferase                                   179   7e-50    Streptomyces sp. CcalMP-8W
ref|WP_030304478.1|  aminotransferase                                   179   8e-50    Streptomyces sp. NRRL F-6131
ref|WP_003955095.1|  aminotransferase                                   173   8e-50    
ref|WP_043331252.1|  aminotransferase                                   175   8e-50    Micromonospora sp. M42
ref|WP_032776204.1|  aminotransferase                                   179   8e-50    Streptomyces
ref|WP_030827723.1|  aminotransferase                                   179   9e-50    Streptomyces
ref|WP_018386236.1|  aminotransferase                                   179   9e-50    Streptomyces vitaminophilus
ref|WP_009309336.1|  aminotransferase                                   179   1e-49    Streptomyces ipomoeae
ref|WP_006126313.1|  MULTISPECIES: aminotransferase                     179   1e-49    Streptomyces
ref|WP_018845927.1|  aminotransferase                                   179   1e-49    Streptomyces sp. CNT372
ref|WP_037933570.1|  aminotransferase                                   179   1e-49    Streptomyces toyocaensis
ref|WP_032772659.1|  aminotransferase                                   179   1e-49    Streptomyces
ref|WP_030274595.1|  aminotransferase                                   179   1e-49    Streptomyces sp. NRRL B-24484
ref|WP_043463625.1|  aminotransferase                                   178   1e-49    Streptomyces
gb|KDS87996.1|  aminotransferase                                        178   1e-49    
ref|WP_030747570.1|  aminotransferase                                   179   1e-49    
ref|WP_016906034.1|  aminotransferase                                   179   1e-49    Streptomyces xiaopingdaonensis
ref|WP_026241844.1|  aminotransferase                                   178   1e-49    Streptomyces sp. ScaeMP-e10
ref|WP_023547956.1|  aminotransferase                                   178   2e-49    Streptomyces roseochromogenus
ref|WP_037793153.1|  aminotransferase                                   178   2e-49    
ref|WP_039820259.1|  aminotransferase                                   178   2e-49    Streptomyces xinghaiensis
ref|WP_030634727.1|  aminotransferase                                   178   2e-49    Streptomyces flavovirens
gb|EDX24378.1|  aminotransferase                                        178   2e-49    Streptomyces sp. Mg1
ref|WP_030997379.1|  aminotransferase                                   178   2e-49    Streptomyces sp. NRRL F-5630
ref|WP_015794539.1|  aminotransferase                                   178   2e-49    Catenulispora acidiphila
ref|WP_042371624.1|  aminotransferase                                   178   2e-49    Streptacidiphilus neutrinimicus
ref|WP_037658395.1|  aminotransferase                                   178   2e-49    Streptomyces
ref|WP_033250459.1|  aminotransferase                                   177   2e-49    Kitasatospora phosalacinea
ref|WP_028421112.1|  aminotransferase                                   178   3e-49    
ref|WP_030323594.1|  aminotransferase                                   177   3e-49    Streptomyces flavochromogenes
ref|WP_030648267.1|  MULTISPECIES: aminotransferase                     178   3e-49    Streptomyces
ref|WP_020119254.1|  aminotransferase                                   178   3e-49    Streptomyces canus
ref|WP_037829608.1|  aminotransferase                                   177   3e-49    
ref|WP_006604641.1|  aminotransferase                                   177   3e-49    Streptomyces auratus
ref|WP_037839822.1|  aminotransferase                                   177   3e-49    Streptomyces sp. NRRL S-1813
ref|WP_012827663.1|  aminotransferase                                   177   3e-49    Haliangium ochraceum
ref|WP_008747039.1|  aminotransferase                                   177   4e-49    Streptomyces sp. SPB074
gb|EPX56688.1|  Aspartate aminotransferase                              177   4e-49    Cystobacter fuscus DSM 2262
ref|WP_028457816.1|  aminotransferase                                   177   4e-49    Chloroflexus sp. Y-396-1
ref|WP_030647959.1|  MULTISPECIES: aminotransferase                     177   5e-49    
ref|WP_043434361.1|  aminotransferase                                   177   5e-49    Cystobacter fuscus
ref|WP_030553179.1|  aminotransferase                                   177   5e-49    Streptomyces exfoliatus
ref|WP_039650621.1|  MULTISPECIES: aminotransferase                     177   5e-49    Streptomyces
ref|WP_030690805.1|  aminotransferase                                   177   6e-49    Streptomyces globisporus
ref|WP_031008729.1|  aminotransferase                                   177   7e-49    Streptomyces sp. NRRL F-5727
ref|WP_043915295.1|  aminotransferase                                   176   7e-49    Kitasatospora griseola
ref|WP_031509962.1|  aminotransferase                                   177   7e-49    Streptomyces megasporus
ref|WP_031155146.1|  aminotransferase                                   177   7e-49    
ref|WP_007825090.1|  aminotransferase                                   176   9e-49    Streptomyces sp. Tu6071
ref|WP_019547998.1|  aminotransferase                                   176   9e-49    Streptomyces sulphureus
ref|WP_010278847.1|  aminotransferase                                   176   9e-49    Streptomyces
ref|WP_030284381.1|  aminotransferase                                   176   1e-48    Streptomyces catenulae
ref|WP_037795518.1|  aminotransferase                                   176   1e-48    Streptomyces sp. CNT360
ref|WP_043393165.1|  aminotransferase                                   176   1e-48    Archangium violaceum
gb|AGS70808.1|  aminotransferase                                        176   1e-48    Streptomyces collinus Tu 365
ref|WP_030209889.1|  aminotransferase                                   176   1e-48    Streptomyces griseoluteus
ref|WP_030407772.1|  MULTISPECIES: aminotransferase                     176   1e-48    Streptomyces
gb|KFK90027.1|  aminotransferase                                        176   1e-48    Streptomyces sp. JS01
ref|WP_031028283.1|  aminotransferase                                   176   2e-48    Streptomyces sp. NRRL F-5639
ref|WP_032782146.1|  aminotransferase                                   176   2e-48    Streptomyces sp. JS01
ref|WP_009067064.1|  aminotransferase                                   176   2e-48    Streptomyces sp. SPB78
gb|EPD91143.1|  hypothetical protein HMPREF1486_05075                   176   2e-48    Streptomyces sp. HPH0547
ref|WP_043476070.1|  aminotransferase                                   176   2e-48    Streptomyces collinus
ref|WP_033247846.1|  MULTISPECIES: aminotransferase                     176   2e-48    Streptomyces
ref|WP_030876183.1|  aminotransferase                                   176   2e-48    Streptomyces sp. NRRL B-24051
ref|WP_030122986.1|  aminotransferase [                                 176   2e-48    [Kitasatospora] papulosa
ref|WP_015577797.1|  aspartate aminotransferase                         176   2e-48    Streptomyces
ref|WP_028433681.1|  aminotransferase                                   176   2e-48    
ref|WP_040250408.1|  aminotransferase                                   175   2e-48    Streptomyces albus
ref|WP_014397063.1|  aminotransferase                                   176   2e-48    Corallococcus coralloides
ref|WP_014155387.1|  aminotransferase                                   176   2e-48    Streptomyces pratensis
gb|AJE83527.1|  aminotransferase                                        176   2e-48    Streptomyces albus
ref|WP_032769595.1|  aminotransferase                                   175   2e-48    Streptomyces
ref|WP_037686882.1|  aminotransferase                                   175   2e-48    
ref|WP_041129978.1|  aminotransferase                                   175   2e-48    
ref|WP_024755931.1|  aminotransferase                                   175   2e-48    
ref|WP_030734343.1|  aminotransferase                                   175   2e-48    Streptomyces sp. NRRL S-31
ref|WP_030578710.1|  aminotransferase                                   175   2e-48    Streptomyces globisporus
ref|WP_014046935.1|  MULTISPECIES: aminotransferase                     175   3e-48    Streptomyces
ref|WP_037721112.1|  aminotransferase                                   175   3e-48    
ref|WP_035847321.1|  aminotransferase                                   175   3e-48    Kitasatospora azatica
ref|WP_042405690.1|  aminotransferase                                   175   3e-48    Streptacidiphilus carbonis
ref|WP_020472752.1|  aminotransferase                                   175   3e-48    Zavarzinella formosa
ref|WP_032794672.1|  aminotransferase                                   175   3e-48    Streptomyces mediolani
ref|WP_031142299.1|  aminotransferase                                   175   3e-48    
ref|WP_030392500.1|  aminotransferase                                   175   4e-48    Kitasatospora purpeofusca
ref|WP_044375126.1|  aminotransferase                                   174   4e-48    Streptomyces
ref|WP_039947437.1|  aminotransferase                                   174   4e-48    
ref|WP_033214282.1|  aminotransferase                                   174   4e-48    Kitasatospora phosalacinea
ref|WP_041662567.1|  aminotransferase                                   174   5e-48    Streptomyces venezuelae
ref|WP_037776488.1|  aminotransferase                                   174   6e-48    
ref|WP_010063197.1|  aminotransferase                                   174   6e-48    Streptomyces globisporus
ref|WP_030836188.1|  aminotransferase                                   174   6e-48    
emb|CCA56708.1|  Aspartate aminotransferase                             174   6e-48    
ref|WP_008740642.1|  aminotransferase                                   174   7e-48    
ref|WP_010471750.1|  aminotransferase                                   174   7e-48    
ref|WP_037690714.1|  aminotransferase                                   174   7e-48    
ref|WP_029180619.1|  aminotransferase                                   174   8e-48    
ref|WP_030929313.1|  aminotransferase                                   174   8e-48    
ref|WP_043265062.1|  aminotransferase                                   174   8e-48    
ref|WP_011958814.1|  aminotransferase                                   174   9e-48    
ref|WP_015349746.1|  class I/II aminotransferase                        174   9e-48    
gb|EDY65198.1|  aminotransferase                                        174   1e-47    
ref|WP_039941462.1|  aminotransferase                                   173   1e-47    
ref|WP_033202351.1|  aminotransferase                                   173   1e-47    
ref|WP_026931055.1|  aminotransferase                                   173   1e-47    
ref|WP_030977695.1|  aminotransferase                                   173   1e-47    
ref|WP_016825328.1|  aminotransferase                                   173   1e-47    
ref|WP_031459409.1|  aminotransferase                                   173   1e-47    
ref|WP_037877937.1|  aminotransferase                                   173   1e-47    
ref|WP_030173910.1|  aminotransferase                                   174   1e-47    
gb|EFL24453.1|  aminotransferase, class I                               174   1e-47    
ref|WP_010350806.1|  aminotransferase                                   173   1e-47    
ref|WP_030771789.1|  aminotransferase                                   173   1e-47    
ref|WP_020269575.1|  putative N-succinyldiaminopimelate aminotran...    173   2e-47    
ref|WP_043466883.1|  aminotransferase                                   173   2e-47    
ref|WP_029182968.1|  aminotransferase                                   173   2e-47    
ref|WP_044184827.1|  aminotransferase                                   173   2e-47    
ref|WP_040246283.1|  aminotransferase                                   172   2e-47    
ref|WP_043442345.1|  aminotransferase                                   173   2e-47    
ref|WP_019983328.1|  aminotransferase                                   172   2e-47    
ref|WP_042496624.1|  aminotransferase                                   172   2e-47    
ref|WP_038273116.1|  aminotransferase                                   172   3e-47    
dbj|BAG20253.1|  putative aminotransferase                              172   3e-47    
ref|WP_023539827.1|  aminotransferase                                   172   3e-47    
ref|WP_003960967.1|  aminotransferase                                   173   3e-47    
ref|WP_032767062.1|  aminotransferase                                   172   3e-47    
ref|WP_018547834.1|  aminotransferase                                   172   3e-47    
ref|WP_003967567.1|  aminotransferase                                   172   3e-47    
ref|WP_014178253.1|  aminotransferase                                   172   3e-47    
ref|WP_037614642.1|  aminotransferase                                   172   3e-47    
ref|WP_031103075.1|  aminotransferase                                   167   3e-47    
ref|WP_030701129.1|  aminotransferase                                   172   3e-47    
ref|WP_037783390.1|  aminotransferase                                   172   3e-47    
gb|EPD56248.1|  hypothetical protein HMPREF1211_07367                   172   4e-47    
ref|XP_003601074.1|  Kynurenine-oxoglutarate transaminase               172   4e-47    
ref|WP_037738668.1|  aminotransferase                                   172   4e-47    
ref|WP_018839937.1|  MULTISPECIES: aminotransferase                     172   4e-47    
gb|KGA10490.1|  hypothetical protein GM44_3790                          172   4e-47    
ref|WP_028442027.1|  aminotransferase                                   172   4e-47    
ref|WP_032776755.1|  aminotransferase                                   172   4e-47    
ref|WP_037739101.1|  aminotransferase                                   171   5e-47    
ref|WP_030082041.1|  aminotransferase                                   172   5e-47    
ref|WP_031084017.1|  aminotransferase                                   172   5e-47    
ref|WP_024885720.1|  aminotransferase                                   172   5e-47    
ref|WP_037750388.1|  aminotransferase                                   171   5e-47    
ref|WP_030633554.1|  aminotransferase                                   172   5e-47    
ref|WP_030751383.1|  aminotransferase                                   171   5e-47    
ref|WP_030621456.1|  aminotransferase                                   172   5e-47    
ref|WP_026291052.1|  aminotransferase                                   172   5e-47    
ref|WP_037911796.1|  aminotransferase                                   171   6e-47    
ref|WP_030588690.1|  aminotransferase                                   172   6e-47    
ref|WP_042151449.1|  aminotransferase                                   171   6e-47    
gb|KIG16838.1|  Aspartate aminotransferase                              171   6e-47    
ref|WP_014144047.1|  aminotransferase                                   171   7e-47    
gb|AEM80268.1|  aminotransferase class I and II                         171   7e-47    
ref|WP_043235217.1|  aminotransferase                                   171   7e-47    
ref|WP_030278361.1|  aminotransferase                                   171   7e-47    
ref|WP_030552056.1|  MULTISPECIES: aminotransferase                     171   8e-47    
ref|WP_026245537.1|  aminotransferase                                   171   9e-47    
ref|WP_037702751.1|  aminotransferase                                   171   9e-47    
ref|WP_030191356.1|  aminotransferase                                   171   9e-47    
ref|WP_012257764.1|  MULTISPECIES: aminotransferase                     171   1e-46    
ref|WP_029733566.1|  aminotransferase                                   171   1e-46    
ref|WP_033346875.1|  aminotransferase                                   171   1e-46    
ref|WP_012616666.1|  aminotransferase                                   171   1e-46    
ref|WP_030214816.1|  aminotransferase                                   171   1e-46    
ref|WP_026058374.1|  aminotransferase                                   171   1e-46    
ref|WP_030573401.1|  aminotransferase                                   171   1e-46    
gb|ELP67735.1|  aminotransferase                                        171   2e-46    
ref|WP_033274803.1|  aminotransferase                                   171   2e-46    
ref|WP_044472367.1|  aminotransferase                                   171   2e-46    
ref|WP_037873971.1|  aminotransferase                                   170   2e-46    
ref|WP_043203390.1|  aminotransferase                                   170   2e-46    
ref|WP_018891993.1|  aminotransferase                                   170   2e-46    
ref|WP_017947887.1|  aminotransferase                                   170   2e-46    
ref|WP_030629079.1|  MULTISPECIES: aminotransferase                     170   2e-46    
ref|WP_037640781.1|  aminotransferase                                   170   2e-46    
gb|KIZ23387.1|  aminotransferase                                        170   2e-46    
ref|WP_030682682.1|  aminotransferase                                   170   2e-46    
ref|WP_040915367.1|  aminotransferase                                   170   2e-46    
ref|WP_031178930.1|  aminotransferase                                   170   2e-46    
ref|WP_030617341.1|  aminotransferase                                   170   2e-46    
ref|WP_041987804.1|  aminotransferase                                   170   3e-46    
ref|WP_030414449.1|  aminotransferase                                   170   3e-46    
ref|WP_037953240.1|  aminotransferase                                   170   3e-46    
ref|WP_018102087.1|  MULTISPECIES: aminotransferase                     169   3e-46    
gb|EIF91299.1|  aminotransferase                                        170   3e-46    
ref|WP_037899775.1|  aminotransferase                                   170   4e-46    
ref|WP_030420217.1|  aminotransferase                                   169   4e-46    
ref|WP_035741385.1|  aminotransferase                                   169   4e-46    
ref|WP_020869723.1|  aminotransferase                                   169   4e-46    
ref|WP_033524525.1|  aminotransferase                                   170   4e-46    
ref|WP_044572236.1|  aminotransferase                                   169   4e-46    
emb|CDR08143.1|  aminotransferase class I and II                        169   5e-46    
ref|WP_026004372.1|  aminotransferase                                   169   5e-46    
ref|WP_018551094.1|  aminotransferase                                   169   5e-46    
ref|WP_030245653.1|  MULTISPECIES: aminotransferase                     169   5e-46    
ref|WP_007383554.1|  aminotransferase                                   169   5e-46    
ref|WP_030667733.1|  aminotransferase                                   169   5e-46    
ref|WP_031075590.1|  aminotransferase                                   169   6e-46    
ref|WP_037822387.1|  MULTISPECIES: aminotransferase                     169   6e-46    
ref|WP_039933260.1|  aminotransferase                                   169   6e-46    
ref|WP_037718029.1|  aminotransferase                                   169   6e-46    
ref|WP_006135077.1|  aminotransferase                                   169   6e-46    
gb|EFL33691.1|  aminotransferase                                        169   6e-46    
ref|WP_030862993.1|  aminotransferase                                   169   6e-46    
ref|WP_037647463.1|  aminotransferase                                   169   6e-46    
ref|WP_028437524.1|  aminotransferase                                   169   6e-46    
ref|WP_030353186.1|  aminotransferase                                   169   7e-46    
gb|AIR99589.1|  putative N-succinyldiaminopimelate aminotransfera...    169   7e-46    
ref|WP_030942128.1|  aminotransferase                                   169   7e-46    
ref|WP_030053541.1|  aminotransferase                                   169   7e-46    
ref|WP_043502728.1|  aminotransferase                                   169   7e-46    
ref|WP_031017961.1|  MULTISPECIES: aminotransferase                     169   7e-46    
ref|WP_003999330.1|  putative Aminotransferase                          169   7e-46    
ref|WP_016579204.1|  MULTISPECIES: aminotransferase                     169   8e-46    
gb|EOS97120.2|  aminotransferase                                        169   8e-46    
ref|WP_011029150.1|  aminotransferase                                   169   8e-46    
ref|WP_030724914.1|  MULTISPECIES: aminotransferase                     169   9e-46    
ref|WP_003975280.1|  aminotransferase                                   168   1e-45    
ref|WP_018569014.1|  aminotransferase                                   168   1e-45    
ref|WP_030401417.1|  aminotransferase                                   168   1e-45    
ref|WP_030436548.1|  aminotransferase                                   168   1e-45    
ref|WP_020129183.1|  aminotransferase                                   168   1e-45    
ref|WP_032749572.1|  aminotransferase                                   168   1e-45    
ref|WP_027759812.1|  aminotransferase                                   168   1e-45    
ref|WP_030062261.1|  MULTISPECIES: aminotransferase                     168   1e-45    
ref|WP_030113465.1|  MULTISPECIES: aminotransferase                     168   1e-45    
ref|WP_043247756.1|  aminotransferase                                   168   1e-45    
ref|WP_030342479.1|  aminotransferase                                   168   1e-45    
ref|WP_030846349.1|  aminotransferase                                   168   1e-45    
ref|WP_033174896.1|  aminotransferase                                   168   1e-45    
ref|WP_029383849.1|  aminotransferase                                   168   1e-45    
ref|WP_030788893.1|  aminotransferase                                   168   1e-45    
ref|WP_030334671.1|  aminotransferase                                   168   2e-45    
ref|WP_033268144.1|  aminotransferase                                   168   2e-45    
ref|WP_030319779.1|  aminotransferase                                   168   2e-45    
ref|WP_030945438.1|  aminotransferase                                   167   2e-45    
ref|WP_030901978.1|  aminotransferase                                   168   2e-45    
ref|WP_038520314.1|  aminotransferase                                   167   2e-45    
ref|WP_044382502.1|  aminotransferase                                   167   2e-45    
ref|WP_027734287.1|  aminotransferase                                   167   2e-45    
ref|WP_020134430.1|  aminotransferase                                   167   2e-45    
ref|WP_005483718.1|  aspartate aminotransferase                         167   2e-45    
ref|WP_018217012.1|  aminotransferase                                   167   3e-45    
ref|WP_031106391.1|  aminotransferase                                   167   3e-45    
ref|WP_002617504.1|  aminotransferase                                   167   3e-45    
ref|WP_037676835.1|  aminotransferase                                   167   3e-45    
ref|WP_006974760.1|  aminotransferase                                   167   3e-45    
ref|WP_033296615.1|  aminotransferase                                   167   3e-45    
ref|WP_004928674.1|  aminotransferase                                   167   3e-45    
ref|WP_030816537.1|  aminotransferase                                   167   3e-45    
ref|WP_030872060.1|  aminotransferase                                   167   3e-45    
ref|WP_013001914.1|  aminotransferase                                   167   3e-45    
ref|WP_033322114.1|  aminotransferase                                   167   4e-45    
ref|WP_030362064.1|  MULTISPECIES: aminotransferase                     167   4e-45    
ref|WP_039702849.1|  aminotransferase                                   167   4e-45    
ref|WP_031085144.1|  MULTISPECIES: aminotransferase                     167   4e-45    
ref|WP_037894312.1|  aminotransferase                                   167   4e-45    
ref|WP_030044869.1|  aminotransferase                                   166   5e-45    
ref|WP_018539379.1|  aminotransferase                                   166   5e-45    
ref|WP_030066248.1|  aminotransferase                                   166   5e-45    
ref|WP_037657241.1|  aminotransferase                                   167   5e-45    
gb|EPH46364.1|  putative N-succinyldiaminopimelate aminotransfera...    167   5e-45    
ref|WP_043376818.1|  aminotransferase                                   166   6e-45    
ref|WP_012119736.1|  aminotransferase                                   166   6e-45    
gb|KFG74772.1|  aminotransferase                                        166   6e-45    
ref|WP_010985942.1|  aminotransferase                                   166   9e-45    
ref|WP_011720956.1|  aminotransferase                                   166   1e-44    
ref|WP_037866302.1|  aminotransferase                                   166   1e-44    
ref|WP_037765303.1|  aminotransferase                                   166   1e-44    
ref|WP_028568797.1|  aminotransferase                                   166   1e-44    
ref|WP_018833415.1|  MULTISPECIES: aminotransferase                     166   1e-44    
ref|WP_028568069.1|  aminotransferase                                   166   1e-44    
ref|WP_035953556.1|  aminotransferase                                   165   1e-44    
ref|WP_028565642.1|  aminotransferase                                   166   1e-44    
ref|WP_031142424.1|  aminotransferase                                   166   1e-44    
gb|KDN75468.1|  aminotransferase                                        166   1e-44    
ref|WP_031520100.1|  aminotransferase                                   165   1e-44    
ref|WP_040836988.1|  aminotransferase                                   165   2e-44    
ref|WP_032792577.1|  aminotransferase                                   165   2e-44    
ref|WP_029023771.1|  aminotransferase                                   165   2e-44    
ref|WP_033284795.1|  aminotransferase                                   165   2e-44    
ref|WP_018798050.1|  aminotransferase                                   165   2e-44    
ref|WP_018583935.1|  aminotransferase                                   165   2e-44    
ref|WP_030295402.1|  MULTISPECIES: aminotransferase                     165   2e-44    
ref|WP_019901129.1|  aminotransferase                                   165   2e-44    
ref|WP_018790178.1|  aminotransferase                                   165   2e-44    
gb|EHM27403.1|  aminotransferase                                        164   2e-44    
ref|WP_027426947.1|  aminotransferase                                   165   2e-44    
ref|WP_019030491.1|  aminotransferase                                   165   2e-44    
ref|WP_018791917.1|  aminotransferase                                   165   2e-44    
ref|WP_028186406.1|  aminotransferase                                   165   2e-44    
ref|WP_012184270.1|  aminotransferase                                   165   2e-44    
ref|WP_018831273.1|  aminotransferase                                   165   2e-44    
ref|WP_012874390.1|  aminotransferase                                   164   2e-44    
ref|WP_026924486.1|  aminotransferase                                   164   3e-44    
ref|WP_030898738.1|  aminotransferase                                   164   3e-44    
ref|WP_024494509.1|  aminotransferase                                   164   3e-44    
ref|WP_010585304.1|  aminotransferase                                   164   3e-44    
ref|WP_031043088.1|  aminotransferase                                   164   3e-44    
ref|WP_018801032.1|  aminotransferase                                   164   3e-44    
ref|WP_020677106.1|  hypothetical protein                               164   3e-44    
ref|WP_026322515.1|  aminotransferase                                   164   4e-44    
ref|WP_026272857.1|  aminotransferase                                   164   4e-44    
ref|WP_038675208.1|  hypothetical protein                               164   4e-44    
ref|WP_018222627.1|  aminotransferase                                   164   4e-44    
gb|AIF52360.1|  Kynurenine--oxoglutarate transaminase                   164   4e-44    
ref|WP_027647277.1|  aminotransferase                                   164   4e-44    
ref|WP_028191082.1|  aminotransferase                                   164   4e-44    
ref|WP_026273986.1|  aminotransferase                                   164   4e-44    
ref|WP_038845221.1|  aminotransferase                                   164   4e-44    



>emb|CDP15807.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQYAAATA
Sbjct  246  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQYAAATA  305

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELK DY AKKAILVDGLKAAGF V+PSSGTYF++VDHTPFGL++DVAFCEY
Sbjct  306  LRAPDSYYEELKTDYMAKKAILVDGLKAAGFIVFPSSGTYFIMVDHTPFGLENDVAFCEY  365

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLRSAVERM
Sbjct  366  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRSAVERM  409



>ref|XP_009623694.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Nicotiana 
tomentosiformis]
Length=452

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQYAAATA
Sbjct  282  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQYAAATA  341

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAILV+GLKAAGFTVYPSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  342  LRAPDSYYEELKRDYSAKKAILVEGLKAAGFTVYPSSGTYFVVVDHTPFGLENDIAFCEY  401

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKD+ TL+SAV+RM
Sbjct  402  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDDDTLKSAVQRM  445



>ref|XP_009784157.1| PREDICTED: kynurenine--oxoglutarate transaminase [Nicotiana sylvestris]
Length=456

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQYAAATA
Sbjct  286  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQYAAATA  345

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAILV+GLKAAGFTVYPSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  346  LRAPDSYYEELKRDYSAKKAILVEGLKAAGFTVYPSSGTYFVVVDHTPFGLENDIAFCEY  405

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKE+GVVAIPTSVFYLNPE+GKNLVRFTFCKD+ TL+SAV+RM
Sbjct  406  LIKEIGVVAIPTSVFYLNPEEGKNLVRFTFCKDDDTLKSAVQRM  449



>ref|XP_007223278.1| hypothetical protein PRUPE_ppa005521mg [Prunus persica]
 gb|EMJ24477.1| hypothetical protein PRUPE_ppa005521mg [Prunus persica]
Length=456

 Score =   327 bits (837),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQ+AAATA
Sbjct  287  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQWAAATA  346

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  347  LRAPDSYYVELKRDYQAKKAILVEGLKAVGFKVYPSSGTYFVVVDHTPFGLENDVAFCEY  406

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  407  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRAAVDRM  450



>ref|XP_006342816.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Solanum 
tuberosum]
Length=368

 Score =   323 bits (828),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQYA+ATA
Sbjct  198  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQYASATA  257

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYY ELKRDYSAKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGL +D+AFCEY
Sbjct  258  LRTPDSYYEELKRDYSAKKAILVEGLKAVGFIVYPSSGTYFVVVDHTPFGLDNDIAFCEY  317

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLRSAV+RM
Sbjct  318  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLRSAVQRM  361



>emb|CBI19046.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGW +APPHLTWG+RQAHSFLTFAT TPMQ+AAATA
Sbjct  238  LPGMYERTVTMNSLGKTFSLTGWKIGWTVAPPHLTWGVRQAHSFLTFATCTPMQWAAATA  297

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGLKDD+AFCEY
Sbjct  298  LRAPDSYYEELKRDYSAKKAILVEGLKAVGFRVYPSSGTYFVVVDHTPFGLKDDIAFCEY  357

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYL+PEDGKNLVRFTFCKDE TLR+AVERM
Sbjct  358  LIKEVGVVAIPTSVFYLHPEDGKNLVRFTFCKDEGTLRAAVERM  401



>ref|XP_006383469.1| hypothetical protein POPTR_0005s15870g [Populus trichocarpa]
 gb|ERP61266.1| hypothetical protein POPTR_0005s15870g [Populus trichocarpa]
Length=269

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  99   LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  158

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYYVELKRDY AKK ILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  159  LRAPESYYVELKRDYMAKKEILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  218

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE+TL++AVERM
Sbjct  219  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEETLKAAVERM  262



>ref|XP_006351874.1| PREDICTED: kynurenine--oxoglutarate transaminase 3-like [Solanum 
tuberosum]
Length=456

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQYA+ATA
Sbjct  286  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQYASATA  345

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYY ELKRDYSAKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGL +D+AFCEY
Sbjct  346  LRTPDSYYEELKRDYSAKKAILVEGLKAVGFIVYPSSGTYFVVVDHTPFGLDNDIAFCEY  405

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLRSAV+RM
Sbjct  406  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLRSAVQRM  449



>ref|XP_008219754.1| PREDICTED: kynurenine--oxoglutarate transaminase [Prunus mume]
Length=456

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQ+AAATA
Sbjct  287  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQWAAATA  346

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            +RAPDSYYVELKRDY AKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  347  IRAPDSYYVELKRDYQAKKAILVEGLKAVGFKVYPSSGTYFVVVDHTPFGLENDVAFCEY  406

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFY NPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  407  LIKEVGVVAIPTSVFYFNPEDGKNLVRFTFCKDEGTLRAAVDRM  450



>ref|XP_004250335.1| PREDICTED: kynurenine--oxoglutarate transaminase [Solanum lycopersicum]
Length=452

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHS+LTFATSTPMQYA+ATA
Sbjct  282  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSYLTFATSTPMQYASATA  341

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYY ELKRDYSAKK ILV+GL  AGFTVYPSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  342  LRTPDSYYEELKRDYSAKKEILVEGLMKAGFTVYPSSGTYFVVVDHTPFGLENDIAFCEY  401

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLRSAV+RM
Sbjct  402  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLRSAVQRM  445



>ref|XP_010664229.1| PREDICTED: kynurenine--oxoglutarate transaminase 1 [Vitis vinifera]
Length=450

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGW +APPHLTWG+RQAHSFLTFAT TPMQ+AAATA
Sbjct  279  LPGMYERTVTMNSLGKTFSLTGWKIGWTVAPPHLTWGVRQAHSFLTFATCTPMQWAAATA  338

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGLKDD+AFCEY
Sbjct  339  LRAPDSYYEELKRDYSAKKAILVEGLKAVGFRVYPSSGTYFVVVDHTPFGLKDDIAFCEY  398

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYL+PEDGKNLVRFTFCKDE TLR+AVERM
Sbjct  399  LIKEVGVVAIPTSVFYLHPEDGKNLVRFTFCKDEGTLRAAVERM  442



>ref|XP_009340883.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Pyrus 
x bretschneideri]
Length=457

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHL+WG+RQAHS+LTFATSTPMQ+AAATA
Sbjct  288  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHSYLTFATSTPMQWAAATA  347

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AKKAILV+GLK+ GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  348  LRAPDSYYVELKRDYQAKKAILVEGLKSVGFEVYPSSGTYFVVVDHTPFGLENDVAFCEY  407

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  408  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRAAVDRM  451



>ref|XP_009344105.1| PREDICTED: kynurenine--oxoglutarate transaminase 1-like [Pyrus 
x bretschneideri]
Length=461

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHL+WG+RQAHSFLTFATSTPMQ+AAATA
Sbjct  292  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHSFLTFATSTPMQWAAATA  351

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AKKAILV+GLK+ GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  352  LRAPDSYYVELKRDYQAKKAILVEGLKSVGFKVYPSSGTYFVVVDHTPFGLENDVAFCEY  411

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYL+PEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  412  LIKEVGVVAIPTSVFYLDPEDGKNLVRFTFCKDEGTLRAAVDRM  455



>ref|XP_007019005.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY16230.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein isoform 3 [Theobroma cacao]
Length=388

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  218  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  277

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AKKAILV+GL+  GF V+PSSGTYFV+VDHTPFGL++D+ FCEY
Sbjct  278  LRAPDSYYVELKRDYMAKKAILVEGLEDVGFKVFPSSGTYFVVVDHTPFGLENDIVFCEY  337

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLRSAVERM
Sbjct  338  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRSAVERM  381



>ref|XP_002306622.2| hypothetical protein POPTR_0005s15890g [Populus trichocarpa]
 gb|EEE93618.2| hypothetical protein POPTR_0005s15890g [Populus trichocarpa]
Length=468

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  298  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  357

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYYVELKRDY AKK ILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  358  LRAPESYYVELKRDYMAKKEILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  417

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE+TL++AVERM
Sbjct  418  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEETLKAAVERM  461



>ref|XP_007019003.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
 ref|XP_007019004.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY16228.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY16229.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
Length=464

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  294  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  353

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AKKAILV+GL+  GF V+PSSGTYFV+VDHTPFGL++D+ FCEY
Sbjct  354  LRAPDSYYVELKRDYMAKKAILVEGLEDVGFKVFPSSGTYFVVVDHTPFGLENDIVFCEY  413

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLRSAVERM
Sbjct  414  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRSAVERM  457



>ref|XP_010999356.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Populus 
euphratica]
Length=468

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  298  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  357

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYYVELKRDY AKK ILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  358  LRAPESYYVELKRDYMAKKEILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  417

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE+TL++AVERM
Sbjct  418  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEETLKAAVERM  461



>ref|XP_011069560.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Sesamum 
indicum]
 ref|XP_011069561.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Sesamum 
indicum]
Length=411

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAP HLTWGIRQAHSFLTFATSTPMQYAAATA
Sbjct  240  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPAHLTWGIRQAHSFLTFATSTPMQYAAATA  299

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+ EL+RDY  KKAILV+GLK+ GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  300  LRAPDSYFKELRRDYMVKKAILVEGLKSVGFIVYPSSGTYFVVVDHTPFGLENDVAFCEY  359

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLR+AV+RM
Sbjct  360  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRTAVKRM  403



>ref|XP_008388248.1| PREDICTED: kynurenine--oxoglutarate transaminase 1-like [Malus 
domestica]
Length=457

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQ+AAA A
Sbjct  288  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQWAAAIA  347

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY VELKRDY AKKAILV+GLK+ GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  348  LRAPDSYXVELKRDYQAKKAILVEGLKSVGFKVYPSSGTYFVVVDHTPFGLENDVAFCEY  407

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  408  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRAAVDRM  451



>gb|KJB29235.1| hypothetical protein B456_005G090600 [Gossypium raimondii]
 gb|KJB29236.1| hypothetical protein B456_005G090600 [Gossypium raimondii]
Length=469

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQYAA  A
Sbjct  299  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQYAATVA  358

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+APDSY+ ELKRDY AKKAILV GLK  GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  359  LQAPDSYFAELKRDYMAKKAILVQGLKDVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  418

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE+TLRSAVERM
Sbjct  419  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEETLRSAVERM  462



>ref|XP_011074863.1| PREDICTED: kynurenine--oxoglutarate transaminase 1-like [Sesamum 
indicum]
Length=478

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGM+ERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATSTPMQYAAATA
Sbjct  308  VPGMFERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSTPMQYAAATA  367

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKKAILV+GLK+ GFTVYPSSGTYFV+VDHTPFG ++D+AFCEY
Sbjct  368  LRAPDSYYEELKRDYKAKKAILVEGLKSVGFTVYPSSGTYFVVVDHTPFGHENDIAFCEY  427

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLN EDGKNLVRFTFCK+E+TLRSAVERM
Sbjct  428  LIKEVGVVAIPTSVFYLNAEDGKNLVRFTFCKEEETLRSAVERM  471



>ref|XP_002302248.2| hypothetical protein POPTR_0002s08650g [Populus trichocarpa]
 gb|EEE81521.2| hypothetical protein POPTR_0002s08650g [Populus trichocarpa]
Length=464

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  294  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  353

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SY+VELKRDY AKK ILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  354  LRAPESYFVELKRDYMAKKEILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  413

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  414  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRAAVDRM  457



>ref|XP_004290845.1| PREDICTED: kynurenine--oxoglutarate transaminase 1 [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHL+WG+RQAHS+LTFATSTPMQ+AAATA
Sbjct  285  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHSYLTFATSTPMQWAAATA  344

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+VELKRDY AKK ILV+GLKA GF VYPSSGTYFV+VDHTPFGL +DVAFCEY
Sbjct  345  LRAPDSYFVELKRDYLAKKEILVEGLKAVGFKVYPSSGTYFVVVDHTPFGLPNDVAFCEY  404

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNP DGKNLVRFTFCKDE TLR+AVERM
Sbjct  405  LIKEVGVVAIPTSVFYLNPGDGKNLVRFTFCKDEGTLRAAVERM  448



>ref|XP_011027573.1| PREDICTED: kynurenine--oxoglutarate transaminase 1-like isoform 
X2 [Populus euphratica]
Length=464

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  294  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  353

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYYVELKRDY AKK ILV+GL+A GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  354  LRAPESYYVELKRDYMAKKEILVEGLEAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  413

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  414  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRAAVDRM  457



>ref|XP_011027572.1| PREDICTED: kynurenine--oxoglutarate transaminase 1-like isoform 
X1 [Populus euphratica]
Length=465

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  295  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAAAVA  354

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYYVELKRDY AKK ILV+GL+A GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  355  LRAPESYYVELKRDYMAKKEILVEGLEAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  414

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  415  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRAAVDRM  458



>ref|XP_010678294.1| PREDICTED: kynurenine--oxoglutarate transaminase 1 [Beta vulgaris 
subsp. vulgaris]
Length=466

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+R AHS+LTFATSTPMQYAAATA
Sbjct  298  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRLAHSYLTFATSTPMQYAAATA  357

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYY ELK+DY AKK ILV+GLK AGF V+PSSGTYFVIVDHTPFG KDDVAFCEY
Sbjct  358  LRAPNSYYEELKKDYKAKKDILVEGLKDAGFKVFPSSGTYFVIVDHTPFGQKDDVAFCEY  417

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  418  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLRAAVQRM  461



>ref|XP_010939394.1| PREDICTED: kynurenine--oxoglutarate transaminase [Elaeis guineensis]
Length=464

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAP HLTWG+RQAHSFLTFATSTPMQ+AAATA
Sbjct  294  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPEHLTWGVRQAHSFLTFATSTPMQWAAATA  353

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKKAILV+GL+A GF VYPSSGTYF++VDHTPFGL++DVAFCEY
Sbjct  354  LRAPDSYYEELKRDYMAKKAILVEGLEAVGFVVYPSSGTYFIVVDHTPFGLENDVAFCEY  413

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TL++AV RM
Sbjct  414  LIQEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLKAAVHRM  457



>ref|XP_004499406.1| PREDICTED: probable N-succinyldiaminopimelate aminotransferase 
DapC-like [Cicer arietinum]
Length=451

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAI+PPHLTWG+RQAH+FLTFATS PMQ+AAA A
Sbjct  282  LPGMFERTVTMNSLGKTFSLTGWKIGWAISPPHLTWGVRQAHAFLTFATSNPMQWAAAVA  341

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY+ELKRDY  K+AILV+GLKA GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  342  LRAPDSYYIELKRDYMEKRAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDVAFCEY  401

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AVERM
Sbjct  402  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRAAVERM  445



>gb|KDP32776.1| hypothetical protein JCGZ_12068 [Jatropha curcas]
Length=447

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATSTPMQ+AAA A
Sbjct  277  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSTPMQWAAAVA  336

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELK+DY AKK ILV+GLKA GF V+PSSGTYFV+VDHTPFG ++D+AFCEY
Sbjct  337  LRAPDSYYAELKKDYLAKKTILVEGLKAVGFEVFPSSGTYFVVVDHTPFGHENDIAFCEY  396

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLRSAVERM
Sbjct  397  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRSAVERM  440



>ref|XP_008444130.1| PREDICTED: kynurenine--oxoglutarate transaminase [Cucumis melo]
Length=449

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATSTPMQ AAATA
Sbjct  278  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSTPMQSAAATA  337

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYY ELK+DY +KKAIL +GLKA GF V+PSSGTYF+IVDHTPFGLK+DV FCEY
Sbjct  338  LRAPESYYEELKKDYLSKKAILEEGLKAVGFKVFPSSGTYFIIVDHTPFGLKNDVDFCEY  397

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AV+RM
Sbjct  398  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDENTLRAAVDRM  441



>ref|XP_008797287.1| PREDICTED: kynurenine--oxoglutarate transaminase 1 [Phoenix dactylifera]
Length=466

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAP HLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  296  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPEHLTWGVRQAHSFLTFATSTPMQWAAAAA  355

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AKKAILV+GLKA GF VYPSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  356  LRAPDSYYVELKRDYMAKKAILVEGLKAVGFVVYPSSGTYFVVVDHTPFGLENDVAFCEY  415

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TL++AV+RM
Sbjct  416  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLKAAVQRM  459



>ref|XP_002513782.1| Aminotransferase ybdL, putative [Ricinus communis]
 gb|EEF48365.1| Aminotransferase ybdL, putative [Ricinus communis]
Length=462

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATSTPMQ+AA+ A
Sbjct  292  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSTPMQWAASVA  351

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+ ELKRDY AKKAILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCE+
Sbjct  352  LRAPDSYFEELKRDYMAKKAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEH  411

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AVERM
Sbjct  412  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRTAVERM  455



>ref|XP_010063369.1| PREDICTED: kynurenine--oxoglutarate transaminase [Eucalyptus 
grandis]
 gb|KCW70582.1| hypothetical protein EUGRSUZ_F03770 [Eucalyptus grandis]
Length=457

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT+TP Q+AAA A
Sbjct  287  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATNTPGQWAAAAA  346

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYYVELKRDY+AKK ILV+GLK AGF V+PSSGTYFV+VDHTPFGL++D+AFCE+
Sbjct  347  LRTPDSYYVELKRDYAAKKQILVEGLKEAGFKVFPSSGTYFVVVDHTPFGLENDIAFCEF  406

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKN+VRFTFCKDE TLRSAVERM
Sbjct  407  LIKEVGVVAIPTSVFYLNPEEGKNIVRFTFCKDEGTLRSAVERM  450



>ref|XP_006472747.1| PREDICTED: kynurenine--oxoglutarate transaminase 3-like [Citrus 
sinensis]
Length=469

 Score =   313 bits (803),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AA  A
Sbjct  299  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAATAA  358

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP++YY ELKRDYSAKKAILV+GL A GF V+PSSGTYFV+VDHTPFG + D+AFCEY
Sbjct  359  LRAPETYYEELKRDYSAKKAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHETDIAFCEY  418

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLRSAV+RM
Sbjct  419  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEGTLRSAVDRM  462



>ref|XP_010272813.1| PREDICTED: kynurenine--oxoglutarate transaminase 3 isoform X2 
[Nelumbo nucifera]
Length=445

 Score =   313 bits (801),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTF+TS PMQYAAA A
Sbjct  275  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFSTSNPMQYAAAAA  334

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKKAILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  335  LRAPDSYYEELKRDYMAKKAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  394

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TL+ AVERM
Sbjct  395  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLKGAVERM  438



>ref|XP_004142619.1| PREDICTED: methionine aminotransferase-like isoform 1 [Cucumis 
sativus]
 ref|XP_004142620.1| PREDICTED: methionine aminotransferase-like isoform 2 [Cucumis 
sativus]
 ref|XP_004172559.1| PREDICTED: methionine aminotransferase-like isoform 1 [Cucumis 
sativus]
 ref|XP_004172560.1| PREDICTED: methionine aminotransferase-like isoform 2 [Cucumis 
sativus]
 gb|KGN54581.1| hypothetical protein Csa_4G371570 [Cucumis sativus]
Length=449

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATSTPMQ AAATA
Sbjct  278  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSTPMQSAAATA  337

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP+SYY ELK+DY +KKAIL +GLKA GF V+PSSGTYF+IVDHTPFGLK+DV FCEY
Sbjct  338  LRAPESYYEELKKDYLSKKAILEEGLKAVGFKVFPSSGTYFIIVDHTPFGLKNDVDFCEY  397

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGK+LVRFTFCKDE TLR+AVERM
Sbjct  398  LIKEVGVVAIPTSVFYLNPEDGKDLVRFTFCKDENTLRAAVERM  441



>ref|XP_010272812.1| PREDICTED: kynurenine--oxoglutarate transaminase 1 isoform X1 
[Nelumbo nucifera]
Length=461

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTF+TS PMQYAAA A
Sbjct  291  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFSTSNPMQYAAAAA  350

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKKAILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D+AFCEY
Sbjct  351  LRAPDSYYEELKRDYMAKKAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDIAFCEY  410

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TL+ AVERM
Sbjct  411  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTLKGAVERM  454



>ref|XP_003601072.1| Kynurenine-oxoglutarate transaminase [Medicago truncatula]
Length=396

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATS PMQ+AAA A
Sbjct  227  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSNPMQWAAAVA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AK++ILV+GLKA GF V+PSSGTYFV+VDHTPFG ++D+AFCEY
Sbjct  287  LRAPDSYYTELKRDYMAKRSILVEGLKAVGFKVFPSSGTYFVVVDHTPFGHENDIAFCEY  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  347  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRAAVDRM  390



>gb|KHG09776.1| putative N-succinyldiaminopimelate aminotransferase DapC [Gossypium 
arboreum]
Length=469

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQYAA  A
Sbjct  299  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQYAATVA  358

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+APDSY+ ELK DY AKKAILV GLK  GF V+PSSGTYFV+VDHT FGL +D+AFCEY
Sbjct  359  LQAPDSYFAELKTDYMAKKAILVQGLKDVGFKVFPSSGTYFVVVDHTRFGLDNDIAFCEY  418

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE+TLRSAVERM
Sbjct  419  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEETLRSAVERM  462



>gb|ACJ84430.1| unknown [Medicago truncatula]
Length=349

 Score =   307 bits (787),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG RQAH+FLTFATS PMQ+AAA A
Sbjct  180  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGARQAHAFLTFATSNPMQWAAAVA  239

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AK++ILV+GLKA GF V+PSSGTYFV+VDHTPFG ++D+AFCEY
Sbjct  240  LRAPDSYYTELKRDYMAKRSILVEGLKAVGFKVFPSSGTYFVVVDHTPFGHENDIAFCEY  299

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  300  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRAAVDRM  343



>gb|KFK42160.1| hypothetical protein AALP_AA2G219100 [Arabis alpina]
Length=403

 Score =   309 bits (791),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQ AA  A
Sbjct  232  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQCAAVAA  291

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SY+ ELKRDY+AKK ILV GL   GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  292  LKAPESYFKELKRDYNAKKEILVKGLTEVGFKVFPSSGTYFVVVDHTPFGLENDVAFCEY  351

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLR AVERM
Sbjct  352  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRGAVERM  395



>ref|XP_006390068.1| hypothetical protein EUTSA_v10018556mg [Eutrema salsugineum]
 gb|ESQ27354.1| hypothetical protein EUTSA_v10018556mg [Eutrema salsugineum]
Length=444

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAP HLTWGIRQAHS+LTFATSTPMQ AA  A
Sbjct  273  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPTHLTWGIRQAHSYLTFATSTPMQSAAIAA  332

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SY+ ELKRDY+AKK ILV GLK  GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  333  LKAPESYFKELKRDYNAKKEILVKGLKEVGFEVFPSSGTYFVVVDHTPFGLENDVAFCEY  392

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLRSAVERM
Sbjct  393  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRSAVERM  436



>ref|XP_010091367.1| Methionine aminotransferase [Morus notabilis]
 gb|EXB44357.1| Methionine aminotransferase [Morus notabilis]
Length=457

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATSTPMQ+AAATA
Sbjct  286  LPGMWERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSTPMQWAAATA  345

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFG-LKDDVAFCE  398
            LRAPDSYY ELKRDY AKKAILV+GLKA GF V+PSSGTYFV+VDHTPFG   +D+ FCE
Sbjct  346  LRAPDSYYEELKRDYMAKKAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGRANNDIEFCE  405

Query  397  YLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            YLIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AVERM
Sbjct  406  YLIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRAAVERM  450



>gb|AES71323.2| aspartate aminotransferase family protein [Medicago truncatula]
Length=445

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATS PMQ+AAA A
Sbjct  276  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSNPMQWAAAVA  335

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AK++ILV+GLKA GF V+PSSGTYFV+VDHTPFG ++D+AFCEY
Sbjct  336  LRAPDSYYTELKRDYMAKRSILVEGLKAVGFKVFPSSGTYFVVVDHTPFGHENDIAFCEY  395

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  396  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRAAVDRM  439



>gb|AFK42780.1| unknown [Medicago truncatula]
Length=349

 Score =   305 bits (780),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG RQAH+FLTFATS PMQ+AAA A
Sbjct  180  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGARQAHAFLTFATSNPMQWAAAVA  239

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AK++ILV+GLKA GF V+P SGTYFV+VDHTPFG ++D+AFCEY
Sbjct  240  LRAPDSYYTELKRDYMAKRSILVEGLKAVGFKVFPFSGTYFVVVDHTPFGHENDIAFCEY  299

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  300  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRAAVDRM  343



>ref|XP_009399718.1| PREDICTED: kynurenine--oxoglutarate transaminase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=457

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNS+GKTFSLTGWKIGWAIAPPHLTWG RQAHSFLTFATSTPMQ+AA+ A
Sbjct  287  LPGMYERTVTMNSIGKTFSLTGWKIGWAIAPPHLTWGFRQAHSFLTFATSTPMQWAASVA  346

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+APD+Y+ ELKRDY  KK ILV+GLKAAGF VYPSSGTYFV+VDHTPFG ++DVAFCEY
Sbjct  347  LKAPDTYFEELKRDYLVKKEILVEGLKAAGFIVYPSSGTYFVVVDHTPFGYENDVAFCEY  406

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYL+PE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  407  LIREVGVVAIPTSVFYLDPEEGKNLVRFTFCKDEDTLRAAVKRM  450



>gb|ABR25585.1| aspartate aminotransferase [Oryza sativa Indica Group]
Length=248

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  78   IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAA  137

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDY AKKA+LV+GLK AGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  138  LRAPDSYYEELRRDYGAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  197

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD++TLR+AVERM
Sbjct  198  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDETLRAAVERM  241



>ref|XP_009399719.1| PREDICTED: kynurenine--oxoglutarate transaminase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=455

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNS+GKTFSLTGWKIGWAIAPPHLTWG RQAHSFLTFATSTPMQ+AA+ A
Sbjct  285  LPGMYERTVTMNSIGKTFSLTGWKIGWAIAPPHLTWGFRQAHSFLTFATSTPMQWAASVA  344

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+APD+Y+ ELKRDY  KK ILV+GLKAAGF VYPSSGTYFV+VDHTPFG ++DVAFCEY
Sbjct  345  LKAPDTYFEELKRDYLVKKEILVEGLKAAGFIVYPSSGTYFVVVDHTPFGYENDVAFCEY  404

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYL+PE+GKNLVRFTFCKDE TLR+AV+RM
Sbjct  405  LIREVGVVAIPTSVFYLDPEEGKNLVRFTFCKDEDTLRAAVKRM  448



>ref|XP_007137384.1| hypothetical protein PHAVU_009G122900g [Phaseolus vulgaris]
 gb|ESW09378.1| hypothetical protein PHAVU_009G122900g [Phaseolus vulgaris]
Length=451

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNS+GKTFSLTGWKIGWAIAPPHL+WG+RQAH++LTFATS P Q AAA A
Sbjct  282  LPGMFERTVTMNSMGKTFSLTGWKIGWAIAPPHLSWGVRQAHAYLTFATSHPFQCAAAVA  341

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY E+KRDY AK+AILV+GLKA GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  342  LRAPDSYYAEVKRDYMAKRAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDVAFCEY  401

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPEDGKNLVRFTF KDE+T+RSAVERM
Sbjct  402  LVKEVGVVAIPTSVFYLNPEDGKNLVRFTFAKDEETIRSAVERM  445



>dbj|BAK03435.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ AAA A
Sbjct  245  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQSAAAAA  304

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+ ELKRDY AKKA+LVDGLKAAGF VYPSSGTYFV+VDHTPFG  +DV FCEY
Sbjct  305  LRAPDSYFEELKRDYGAKKALLVDGLKAAGFIVYPSSGTYFVMVDHTPFGFDNDVEFCEY  364

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD+ TLR+AV+RM
Sbjct  365  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDDTLRAAVDRM  408



>gb|EMT11157.1| Aminotransferase ybdL [Aegilops tauschii]
Length=399

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ AAA A
Sbjct  229  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQSAAAAA  288

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+ ELKRDY AKKA+LVDGLKAAGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  289  LRAPDSYFEELKRDYGAKKALLVDGLKAAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  348

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD+ TLR+AV+RM
Sbjct  349  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDDTLRAAVDRM  392



>dbj|BAE86874.1| putative asparate aminotransferase [Hordeum vulgare]
Length=415

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ AAA A
Sbjct  245  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQSAAAAA  304

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+ ELKRDY AKKA+LVDGLKAAGF VYPSSGTYF++VDHTPFG  +DV FCEY
Sbjct  305  LRAPDSYFEELKRDYGAKKALLVDGLKAAGFIVYPSSGTYFIMVDHTPFGFDNDVEFCEY  364

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD+ TLR+AV+RM
Sbjct  365  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDDTLRAAVDRM  408



>gb|AFK38988.1| unknown [Lotus japonicus]
Length=403

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATS   Q+AAA A
Sbjct  234  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSNANQWAAAVA  293

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+V+LKRDY AK+AILV+GL A GF V+PSSGTYFV+VDHTPFG ++DVAFCEY
Sbjct  294  LRAPDSYFVDLKRDYLAKRAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHENDVAFCEY  353

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGV AIPTSVFYLNPE+GKNLVRFTFCKDE+TLR+AVERM
Sbjct  354  LIKEVGVAAIPTSVFYLNPEEGKNLVRFTFCKDEETLRAAVERM  397



>ref|XP_006660686.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Oryza 
brachyantha]
Length=462

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  292  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAA  351

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDYSAKKA+LV+GLK AGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  352  LRAPDSYYEELRRDYSAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  411

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD++TLR+AVERM
Sbjct  412  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDETLRAAVERM  455



>ref|XP_003578218.1| PREDICTED: kynurenine--oxoglutarate transaminase [Brachypodium 
distachyon]
Length=456

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ AAA A
Sbjct  286  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQSAAAAA  345

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+ ELKRDYSAKKA+LVDGLK AGF VYPSSGTYFV+VDHTPFG   D+ FCEY
Sbjct  346  LRAPDSYFEELKRDYSAKKALLVDGLKDAGFIVYPSSGTYFVMVDHTPFGFDSDIEFCEY  405

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD+ TLR+AVERM
Sbjct  406  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDDTLRAAVERM  449



>gb|EYU23901.1| hypothetical protein MIMGU_mgv1a005453mg [Erythranthe guttata]
Length=483

 Score =   306 bits (784),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVT+NSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQYAAA A
Sbjct  313  LPGMYERTVTLNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQYAAAAA  372

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDY++KK ILV+GLK+ GFTVYPSSGTYFV+VDHT FG+++DVAFCEY
Sbjct  373  LRAPDSYYEELRRDYNSKKNILVEGLKSVGFTVYPSSGTYFVVVDHTKFGMENDVAFCEY  432

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TL SAVERM
Sbjct  433  LIKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLISAVERM  476



>gb|AET06147.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=453

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFS+TGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQ+AAA A
Sbjct  284  LPGMYERTVTMNSLGKTFSVTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPMQFAAAEA  343

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR  ++YY E+K+DY  KK ILV+GLK  GF V+PSSGTYFVIVDHTPFG ++DVAFCEY
Sbjct  344  LRTSETYYEEMKKDYMHKKEILVEGLKDVGFVVHPSSGTYFVIVDHTPFGFENDVAFCEY  403

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE TLR+AVERM
Sbjct  404  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEDTLRAAVERM  447



>dbj|BAG99582.1| unnamed protein product [Oryza sativa Japonica Group]
Length=368

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  198  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAA  257

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDY AKKA+LV+GLK AGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  258  LRAPDSYYEELRRDYGAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  317

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD++TLR+AVERM
Sbjct  318  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDETLRAAVERM  361



>ref|XP_010416722.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Camelina 
sativa]
Length=447

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  276  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAIAA  335

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SYY ELKRDY+AKK ILV GLK  GFTV+PSSGTYFV  DHTPFGL++D+AFCEY
Sbjct  336  LKAPESYYKELKRDYAAKKEILVKGLKEVGFTVFPSSGTYFVTADHTPFGLENDIAFCEY  395

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TLR A+ERM
Sbjct  396  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAIERM  439



>gb|AAM67247.1| putative aminotransferase [Arabidopsis thaliana]
Length=404

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  229  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAVAA  288

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SY+ ELKRDY+AKK  LV GLK  GFTV+PSSGTYFV+ DHTPFG+++DVAFCEY
Sbjct  289  LKAPESYFKELKRDYNAKKETLVKGLKEVGFTVFPSSGTYFVVADHTPFGMENDVAFCEY  348

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TLR A+ERM
Sbjct  349  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAIERM  392



>gb|KHN09186.1| Methionine aminotransferase [Glycine soja]
Length=439

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVT+NSLGKTFSLTGWKIGWAIAPPHL+WG+RQAH+FLTFAT+ P Q AAA A
Sbjct  270  LPGMFERTVTLNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHAFLTFATAHPFQCAAAAA  329

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AK+AIL++GLKA GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  330  LRAPDSYYVELKRDYMAKRAILIEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDVAFCEY  389

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+T+RSAVERM
Sbjct  390  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETIRSAVERM  433



>ref|XP_003526620.1| PREDICTED: kynurenine--oxoglutarate transaminase 3-like [Glycine 
max]
Length=439

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVT+NSLGKTFSLTGWKIGWAIAPPHL+WG+RQAH+FLTFAT+ P Q AAA A
Sbjct  270  LPGMFERTVTLNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHAFLTFATAHPFQCAAAAA  329

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AK+AIL++GLKA GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  330  LRAPDSYYVELKRDYMAKRAILIEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDVAFCEY  389

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE+T+RSAVERM
Sbjct  390  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETIRSAVERM  433



>gb|AFK47441.1| unknown [Lotus japonicus]
Length=453

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATS   Q+AAA A
Sbjct  284  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSNANQWAAAVA  343

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSY+V+LKRDY AK+AILV+GL A GF V+PSSGTYFV+VDHTPFG ++DVAFCEY
Sbjct  344  LRAPDSYFVDLKRDYLAKRAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHENDVAFCEY  403

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGV AIPTSVFYLNPE+GKNLVRFTFCKDE+TLR+AVERM
Sbjct  404  LIKEVGVAAIPTSVFYLNPEEGKNLVRFTFCKDEETLRAAVERM  447



>ref|XP_003523457.1| PREDICTED: kynurenine--oxoglutarate transaminase 3-like [Glycine 
max]
 gb|KHN47044.1| Methionine aminotransferase [Glycine soja]
Length=450

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGKTFSLTGWKIGWAIAPPHL+WG+RQAH+FLTFAT+ P Q AAA A
Sbjct  281  LPGMFERTVTMNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHAFLTFATAHPFQCAAAAA  340

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AK+AILV+GLKA GF V+PSSGTYFV+VDHTPFGL++DVAFCEY
Sbjct  341  LRAPDSYYVELKRDYMAKRAILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLENDVAFCEY  400

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE T+RSAVERM
Sbjct  401  LVKEVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEDTIRSAVERM  444



>ref|XP_010471962.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Camelina 
sativa]
Length=446

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  275  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAIAA  334

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SYY ELKRDY+AKK ILV GLK  GFTV+PSSGTYFV  DHTPFGL++D+AFCEY
Sbjct  335  LKAPESYYKELKRDYAAKKEILVKGLKEVGFTVFPSSGTYFVTADHTPFGLENDIAFCEY  394

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE TLR A+ERM
Sbjct  395  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEDTLRGAIERM  438



>ref|XP_010428850.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Camelina 
sativa]
Length=445

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  274  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAIAA  333

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SYY ELKRDY+AKK ILV GLK  GF V+PSSGTYFV  DHTPFGL++DVAFCEY
Sbjct  334  LKAPESYYKELKRDYAAKKEILVKGLKEVGFKVFPSSGTYFVTADHTPFGLENDVAFCEY  393

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TLR A+ERM
Sbjct  394  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAIERM  437



>gb|AFK34714.1| unknown [Medicago truncatula]
Length=195

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  745  MYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATALRA  566
            M+ERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAH+FLTFATS PMQ+AAA ALRA
Sbjct  29   MFERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHAFLTFATSNPMQWAAAVALRA  88

Query  565  PDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYLIK  386
            PDSYY ELKRDY AK++ILV+GLKA GF V+PSSGTYFV VDHTPFG ++D+AFCEYL+K
Sbjct  89   PDSYYTELKRDYMAKRSILVEGLKAVGFKVFPSSGTYFVAVDHTPFGHENDIAFCEYLVK  148

Query  385  EVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            EVGVVAIPTSVFYLNPE+GKNLVRFTFCKDE TLR AV+ M
Sbjct  149  EVGVVAIPTSVFYLNPEEGKNLVRFTFCKDEGTLRVAVDGM  189



>gb|EPS67132.1| hypothetical protein M569_07644, partial [Genlisea aurea]
Length=383

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMY+RTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTPMQ+AAA A
Sbjct  213  IPGMYQRTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGLRQAHSYLTFATSTPMQHAAAAA  272

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKK ILV+GL +AGF VYPSSGTYFV+VDHTPFGL+ DV FCE+
Sbjct  273  LRAPDSYYEELKRDYEAKKRILVEGLNSAGFVVYPSSGTYFVVVDHTPFGLESDVDFCEF  332

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GK LVRFTFCKDE TLR+AV+RM
Sbjct  333  LIKEVGVVAIPTSVFYLNPEEGKKLVRFTFCKDEATLRNAVDRM  376



>gb|EEE69839.1| hypothetical protein OsJ_29606 [Oryza sativa Japonica Group]
Length=466

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  296  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAA  355

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDY AKKA+LV+GLK AGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  356  LRAPDSYYEELRRDYGAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  415

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD++TLR+AVERM
Sbjct  416  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDETLRAAVERM  459



>ref|XP_004956995.1| PREDICTED: kynurenine--oxoglutarate transaminase-like [Setaria 
italica]
Length=460

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  290  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGLRQAHSFLTFATCTPMQAAAAAA  349

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKKAIL++GLKAAGF VYPSSGTYF++VDHTPFG  +D+ FCEY
Sbjct  350  LRAPDSYYEELKRDYGAKKAILLEGLKAAGFIVYPSSGTYFIMVDHTPFGFHNDIEFCEY  409

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGV AIP SVFYLNPE+GKNLVRFTFCKDE TLR+AVERM
Sbjct  410  LIREVGVAAIPPSVFYLNPEEGKNLVRFTFCKDEDTLRAAVERM  453



>gb|EEC84693.1| hypothetical protein OsI_31623 [Oryza sativa Indica Group]
Length=447

 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  277  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAA  336

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDY AKKA+LV+GLK AGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  337  LRAPDSYYEELRRDYGAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  396

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD++TLR+AVERM
Sbjct  397  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDETLRAAVERM  440



>ref|XP_009104610.1| PREDICTED: kynurenine--oxoglutarate transaminase 1 [Brassica 
rapa]
Length=463

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWA+APPHLTWGIRQAHS+LTFATSTPMQ AA  A
Sbjct  292  LPGMYERTVTMNSLGKTFSLTGWKIGWAVAPPHLTWGIRQAHSYLTFATSTPMQAAAVAA  351

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L AP+SYY ELKRDYS KK ILV GLK  GF V+PSSGTYFV+VDHTPFG  DDVAFCEY
Sbjct  352  LEAPESYYTELKRDYSEKKEILVKGLKEVGFEVFPSSGTYFVVVDHTPFGFGDDVAFCEY  411

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRF FCKDE+TLRSA+ERM
Sbjct  412  LIKEVGVVAIPTSVFYLNPEDGKNLVRFAFCKDEETLRSAIERM  455



>ref|XP_002460319.1| hypothetical protein SORBIDRAFT_02g026430 [Sorghum bicolor]
 gb|EER96840.1| hypothetical protein SORBIDRAFT_02g026430 [Sorghum bicolor]
Length=469

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  299  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGLRQAHSFLTFATCTPMQAAAAAA  358

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAIL++GL+AAGF VYPSSGTYF++VDHTPFG  +D+ FCEY
Sbjct  359  LRAPDSYYEELKRDYSAKKAILLEGLEAAGFIVYPSSGTYFIMVDHTPFGFDNDIEFCEY  418

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGV AIP SVFYLNPE+GKNLVRFTFCKDE TLR AVERM
Sbjct  419  LIREVGVAAIPPSVFYLNPEEGKNLVRFTFCKDEDTLRGAVERM  462



>ref|NP_001063347.1| Os09g0453800 [Oryza sativa Japonica Group]
 dbj|BAD38029.1| putative cysteine conjugate beta-lyase [Oryza sativa Japonica 
Group]
 dbj|BAF25261.1| Os09g0453800 [Oryza sativa Japonica Group]
 tpd|FAA00314.1| TPA: aminotransferase [Oryza sativa Japonica Group]
 dbj|BAG99950.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  296  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAA  355

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY EL+RDY AKKA+LV+GLK AGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  356  LRAPDSYYEELRRDYGAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  415

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD++TLR+AVERM
Sbjct  416  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDETLRAAVERM  459



>ref|NP_177890.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AAG51669.1|AC010704_13 putative aminotransferase; 101422-99564 [Arabidopsis thaliana]
 gb|ABI49465.1| At1g77670 [Arabidopsis thaliana]
 gb|AEE36007.1| putative aminotransferase [Arabidopsis thaliana]
Length=440

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  269  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAVAA  328

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SY+ ELKRDY+ KK  LV GLK  GFTV+PSSGTYFV+ DHTPFG+++DVAFCEY
Sbjct  329  LKAPESYFKELKRDYNVKKETLVKGLKEVGFTVFPSSGTYFVVADHTPFGMENDVAFCEY  388

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TLR A+ERM
Sbjct  389  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAIERM  432



>ref|XP_006845935.1| hypothetical protein AMTR_s00157p00073660 [Amborella trichopoda]
 gb|ERN07610.1| hypothetical protein AMTR_s00157p00073660 [Amborella trichopoda]
Length=445

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERT+TMNSLGKTFSLTGWKIGWA+APPHLTWG+RQAHSFLTFATSTPMQ+AAA A
Sbjct  276  LPGMYERTITMNSLGKTFSLTGWKIGWAVAPPHLTWGVRQAHSFLTFATSTPMQWAAAEA  335

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDY AKKAILV+GL+  GFTVYPS GT+FV+VDHTPFG + D+ FC++
Sbjct  336  LRAPDSYYEELKRDYKAKKAILVNGLREVGFTVYPSQGTFFVVVDHTPFGFESDIEFCQH  395

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+ VGVVAIP SVFYL+PE+GK LVRFTFCKDE TLR AVERM
Sbjct  396  LIEHVGVVAIPASVFYLDPEEGKKLVRFTFCKDEDTLRKAVERM  439



>ref|XP_002889153.1| hypothetical protein ARALYDRAFT_339926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65412.1| hypothetical protein ARALYDRAFT_339926 [Arabidopsis lyrata subsp. 
lyrata]
Length=400

 Score =   298 bits (764),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  229  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAVAA  288

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SY+ ELKRDY+AKK ILV GLK  GF V+PSSGTYFV  DHT FGL++DVAFCEY
Sbjct  289  LKAPESYFNELKRDYAAKKEILVKGLKEVGFKVFPSSGTYFVTADHTAFGLENDVAFCEY  348

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TLR A+ERM
Sbjct  349  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAIERM  392



>ref|XP_010534655.1| PREDICTED: kynurenine--oxoglutarate transaminase [Tarenaya hassleriana]
Length=461

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIA P LT G+R AHS+LTFATSTPMQ+AA TA
Sbjct  290  LPGMYERTVTMNSLGKTFSLTGWKIGWAIASPELTRGVRLAHSYLTFATSTPMQWAAMTA  349

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+APDSYY ELKRDY AKK ILV GL+  GF VYPSSGTYFV+VDH+PFGL +DV FCEY
Sbjct  350  LKAPDSYYEELKRDYLAKKEILVTGLREVGFNVYPSSGTYFVVVDHSPFGLDNDVEFCEY  409

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKE+GVVAIPTSVFYLNPE+GKNLVRFTFCKDE+TLRSAVERM
Sbjct  410  LIKEIGVVAIPTSVFYLNPEEGKNLVRFTFCKDEETLRSAVERM  453



>gb|AAL67016.1| putative aminotransferase [Arabidopsis thaliana]
Length=440

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  269  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAVAA  328

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+AP+SY+ ELKRDY+ KK  LV GLK  GFTV+PSSGTYFV+ DHTPFG+++DVAFCEY
Sbjct  329  LKAPESYFKELKRDYNVKKETLVKGLKEVGFTVFPSSGTYFVVADHTPFGMENDVAFCEY  388

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNP +GKNLVRF FCKDE+TLR A+ERM
Sbjct  389  LIEEVGVVAIPTSVFYLNPGEGKNLVRFAFCKDEETLRGAIERM  432



>emb|CDX79227.1| BnaC06g20760D [Brassica napus]
Length=452

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWA+APPHLTWGIRQAHS+LTFATSTPMQ AA  A
Sbjct  281  LPGMYERTVTMNSLGKTFSLTGWKIGWAVAPPHLTWGIRQAHSYLTFATSTPMQAAAVAA  340

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L AP+SYY ELKRDYS KK ILV GLK  GF V+PS+GTYFV+VDHTPFG  DDVAFCEY
Sbjct  341  LEAPESYYTELKRDYSEKKEILVKGLKEVGFEVFPSNGTYFVVVDHTPFGFGDDVAFCEY  400

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TLRSA+ERM
Sbjct  401  LIKEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRSAIERM  444



>emb|CDY69561.1| BnaCnng64190D [Brassica napus]
Length=452

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWA+AP HLTWGIRQAHS+LTFATSTPMQ AA  A
Sbjct  281  LPGMYERTVTMNSLGKTFSLTGWKIGWAVAPAHLTWGIRQAHSYLTFATSTPMQAAAVAA  340

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L AP+SYY ELKRDYS KK ILV GLK  GF V+PSSGTYFV+VDHTPFG  DDVAFCEY
Sbjct  341  LEAPESYYTELKRDYSEKKEILVKGLKEVGFEVFPSSGTYFVVVDHTPFGFGDDVAFCEY  400

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKEVGVVAIPTSVFYLNPEDGKNLVRF FCKDE+TLRSA+ERM
Sbjct  401  LIKEVGVVAIPTSVFYLNPEDGKNLVRFAFCKDEETLRSAIERM  444



>ref|NP_001143647.1| uncharacterized protein LOC100276369 [Zea mays]
 gb|ACG33756.1| asparate aminotransferase [Zea mays]
Length=457

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  287  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGLRQAHSFLTFATCTPMQAAAAAA  346

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAIL++GL+AAGF VYPSSGTY+++VDHTPFG   DV FCEY
Sbjct  347  LRAPDSYYDELKRDYSAKKAILLEGLEAAGFIVYPSSGTYYIMVDHTPFGFDSDVEFCEY  406

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGV AIP SVFYL+PE+GK LVRFTF KDE TLR+AVER+
Sbjct  407  LIREVGVCAIPPSVFYLDPEEGKKLVRFTFSKDEGTLRAAVERL  450



>gb|AES71324.2| aspartate aminotransferase family protein [Medicago truncatula]
Length=402

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGK+FSLTGWK+GWAIAPPHL WG+RQAH+++ F+ S P+Q  AA A
Sbjct  233  LPGMFERTVTMNSLGKSFSLTGWKVGWAIAPPHLMWGVRQAHTYIAFSISHPLQCGAAAA  292

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AK+AILV+GLKA GF V+P++GT+FV+ DHTPFG ++DVAFCEY
Sbjct  293  LRAPDSYYVELKRDYIAKRAILVEGLKAVGFKVFPTNGTFFVLADHTPFGHENDVAFCEY  352

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKE+GV AIP SVFYLNPE+GKNLVRFTFCKDE+T+++AVERM
Sbjct  353  LIKEIGVAAIPLSVFYLNPEEGKNLVRFTFCKDEETIKAAVERM  396



>tpg|DAA61742.1| TPA: aspartate aminotransferase isoform 1 [Zea mays]
 tpg|DAA61743.1| TPA: aspartate aminotransferase isoform 2 [Zea mays]
Length=493

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFAT TPMQ AAA A
Sbjct  323  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGLRQAHSFLTFATCTPMQAAAAAA  382

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYY ELKRDYSAKKAIL++GL+AAGF VYPSSGTY+++VDHTPFG   DV FCEY
Sbjct  383  LRAPDSYYDELKRDYSAKKAILLEGLEAAGFIVYPSSGTYYIMVDHTPFGFDSDVEFCEY  442

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGV AIP SVFYL+PE+GK LVRFTF KDE TLR+AVER+
Sbjct  443  LIREVGVCAIPPSVFYLDPEEGKKLVRFTFSKDEGTLRAAVERL  486



>gb|AFK46586.1| unknown [Medicago truncatula]
Length=402

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM+ERTVTMNSLGK+FSLTGWK+GWAIAPPHL WG+RQAH+++ F+ S P+Q  AA AL
Sbjct  234  PGMFERTVTMNSLGKSFSLTGWKVGWAIAPPHLMWGVRQAHTYIAFSISHPLQCGAAAAL  293

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            RAPDSYYVELKRDY AK+AILV+GLKA GF V+P++GT+FV+ DHTPFG ++DVAFCEYL
Sbjct  294  RAPDSYYVELKRDYIAKRAILVEGLKAVGFKVFPTNGTFFVLADHTPFGHENDVAFCEYL  353

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            IKE+GV AIP SVFYLNPE+GKNLVRFTFCKDE+T+++AVERM
Sbjct  354  IKEIGVAAIPLSVFYLNPEEGKNLVRFTFCKDEETIKAAVERM  396



>ref|XP_003601073.1| Aspartate aminotransferase [Medicago truncatula]
Length=473

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSLGK+FSLTGWK+GWAIAPPHL WG+RQAH+++ F+ S P+Q  AA A
Sbjct  304  LPGMFERTVTMNSLGKSFSLTGWKVGWAIAPPHLMWGVRQAHTYIAFSISHPLQCGAAAA  363

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AK+AILV+GLKA GF V+P++GT+FV+ DHTPFG ++DVAFCEY
Sbjct  364  LRAPDSYYVELKRDYIAKRAILVEGLKAVGFKVFPTNGTFFVLADHTPFGHENDVAFCEY  423

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LIKE+GV AIP SVFYLNPE+GKNLVRFTFCKDE+T+++AVERM
Sbjct  424  LIKEIGVAAIPLSVFYLNPEEGKNLVRFTFCKDEETIKAAVERM  467



>ref|XP_007137383.1| hypothetical protein PHAVU_009G122800g [Phaseolus vulgaris]
 gb|ESW09377.1| hypothetical protein PHAVU_009G122800g [Phaseolus vulgaris]
Length=399

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERTVTMNSL KTFSLTGWKIGWA+AP HLTWG+R AHSF+TF+ +TP+Q AAA A
Sbjct  230  LPGMFERTVTMNSLAKTFSLTGWKIGWAVAPSHLTWGLRLAHSFITFSNATPLQCAAAVA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDSYYVELKRDY AK+AILV+GLKA GF V+P +GT+FV+ DHTPFGL++DVAFCEY
Sbjct  290  LRAPDSYYVELKRDYMAKRAILVEGLKAVGFKVFPPNGTFFVLADHTPFGLENDVAFCEY  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+KEVGV+AIP SVF  NPE+GKNLVRF FCKD++TLR AVERM
Sbjct  350  LLKEVGVLAIPCSVFSFNPEEGKNLVRFVFCKDDETLRVAVERM  393



>ref|XP_006300478.1| hypothetical protein CARUB_v10020303mg [Capsella rubella]
 gb|EOA33376.1| hypothetical protein CARUB_v10020303mg [Capsella rubella]
Length=443

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHS+LTFATSTP Q+AA  A
Sbjct  272  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAIAA  331

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L AP SYY ELKRDY+AKK ILV GLK  GFTV+PSSGTYFV  DHTPFGL++D+AFCEY
Sbjct  332  LNAPASYYKELKRDYAAKKEILVKGLKEVGFTVFPSSGTYFVTADHTPFGLENDIAFCEY  391

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIPTSVFYLNPE+GKNLVRF FCKDE+TL  A+ERM
Sbjct  392  LIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLLGAIERM  435



>gb|ABR16855.1| unknown [Picea sitchensis]
Length=447

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHL+WG+RQAHS+LTF+TSTPMQ+A+  A
Sbjct  278  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHSYLTFSTSTPMQWASVAA  337

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+APDSYY EL +DY AKK ILVDGLK  GF VY S GTYFV+VDHTPFG  +D+AFCE+
Sbjct  338  LQAPDSYYEELLKDYRAKKNILVDGLKTVGFKVYDSPGTYFVVVDHTPFGFDNDIAFCEH  397

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI++VGVVAIPTSVFY++P +GKNLVRFTF KDE TL+ A+ERM
Sbjct  398  LIEKVGVVAIPTSVFYVDPNEGKNLVRFTFAKDEDTLKQAIERM  441



>ref|XP_001771268.1| predicted protein [Physcomitrella patens]
 gb|EDQ63979.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            L GMYERTVTMNSLGKTFSLTGWKIGWA+APPHLT GIR AHS+LTFAT+TP+Q+A+  A
Sbjct  243  LDGMYERTVTMNSLGKTFSLTGWKIGWAVAPPHLTRGIRLAHSYLTFATATPLQWASVEA  302

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDS+Y EL + YSAKK ILV+GL + GF VY   GTYFV+VDHTPFG ++DVAFC+Y
Sbjct  303  LRAPDSFYAELIKSYSAKKDILVEGLNSVGFEVYEPEGTYFVMVDHTPFGFENDVAFCKY  362

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVG+ AIP SVFY NPEDGKNLVRF FCKDE+TL++AVER+
Sbjct  363  LIEEVGIAAIPPSVFYTNPEDGKNLVRFAFCKDEETLKTAVERL  406



>ref|XP_001763726.1| predicted protein [Physcomitrella patens]
 gb|EDQ71368.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            L GMYERTVTMNSLGKTFSLTGWKIGWA+APPHL  G+R AHS++TFAT+TP Q+AAA A
Sbjct  221  LDGMYERTVTMNSLGKTFSLTGWKIGWAVAPPHLMRGVRLAHSYITFATATPFQWAAAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAPDS+Y EL +DYSAKK ILV+GLK+ GF VY   GTYFV+VDHTPFG + DVAFC+Y
Sbjct  281  LRAPDSFYAELIKDYSAKKDILVEGLKSVGFEVYEPDGTYFVMVDHTPFGFESDVAFCKY  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVG+ AIP SVFY NP DGKNLVRF FCKDE+TL++AVE++
Sbjct  341  LIEEVGIAAIPPSVFYTNPVDGKNLVRFAFCKDEETLKAAVEKL  384



>gb|KDO80718.1| hypothetical protein CISIN_1g013883mg [Citrus sinensis]
Length=434

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AA  A
Sbjct  299  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAATAA  358

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP++YY ELKRDYSAKKAILV+GL A GF V+PSSGTYFV+VDHTPFG + D+AFCEY
Sbjct  359  LRAPETYYEELKRDYSAKKAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHETDIAFCEY  418

Query  394  LIKEVGVVAIPTSVFY  347
            LIKEVGVVAIPTSVFY
Sbjct  419  LIKEVGVVAIPTSVFY  434



>ref|XP_006434152.1| hypothetical protein CICLE_v10001202mg [Citrus clementina]
 gb|ESR47392.1| hypothetical protein CICLE_v10001202mg [Citrus clementina]
Length=434

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG+RQAHSFLTFATSTPMQ+AA  A
Sbjct  299  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAATAA  358

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LRAP++YY ELKRDYSAKKAILV+GL A GF V+PSSGTYFV+VDHTPFG + D+AFCEY
Sbjct  359  LRAPETYYEELKRDYSAKKAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHETDIAFCEY  418

Query  394  LIKEVGVVAIPTSVF  350
            LIKEVGVVAIPT+ F
Sbjct  419  LIKEVGVVAIPTAYF  433



>gb|KHN09185.1| Methionine aminotransferase [Glycine soja]
Length=365

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  709  KTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATALRAPDSYYVELKRDY  530
            +TF+LTGWKIGWAIAP HL+WG+RQAHSF+TF++   +Q AAA ALRAPDSYYVELKRDY
Sbjct  213  ETFNLTGWKIGWAIAPSHLSWGVRQAHSFVTFSSPNALQCAAAVALRAPDSYYVELKRDY  272

Query  529  SAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYLIKEVGVVAIPTSVF  350
             AK+AILV+GLKA GF V+P +GT+FV+ DHT FG+++DVAFC+YL KEVGVVAIP SVF
Sbjct  273  IAKRAILVEGLKAVGFKVFPPNGTFFVLADHTHFGMENDVAFCKYLHKEVGVVAIPCSVF  332

Query  349  YLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             LNPE+GK LVRF FCKDE+TLR+AVERM
Sbjct  333  CLNPEEGKKLVRFVFCKDEETLRAAVERM  361



>gb|EMS66098.1| Aminotransferase YbdL [Triticum urartu]
Length=367

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 125/164 (76%), Gaps = 32/164 (20%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG                       
Sbjct  229  IPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWG-----------------------  265

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
                     ELKRDY AKKA+LVDGLKAAGF VYPSSGTYFV+VDHTPFG  +D+ FCEY
Sbjct  266  ---------ELKRDYGAKKALLVDGLKAAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEY  316

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            LI+EVGVVAIP SVFYLNPEDGKNLVRFTFCKD+ TLR+AV+RM
Sbjct  317  LIREVGVVAIPPSVFYLNPEDGKNLVRFTFCKDDGTLRAAVDRM  360



>ref|XP_002990980.1| hypothetical protein SELMODRAFT_161313 [Selaginella moellendorffii]
 gb|EFJ08024.1| hypothetical protein SELMODRAFT_161313 [Selaginella moellendorffii]
Length=415

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            + GM+ERTVTM+S+GKT+S TGWK+GWAIAPPHL++GIRQAHS +TF+T+TP+Q+ A  A
Sbjct  246  IKGMFERTVTMSSMGKTYSFTGWKVGWAIAPPHLSYGIRQAHSNITFSTATPLQWGAVAA  305

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L AP+SYY +L+  Y A+K ILV GLK  GF VY   GTYFV+VDHTPFG KDD+ FC +
Sbjct  306  LEAPESYYQDLRSAYIARKDILVQGLKEVGFKVYEPQGTYFVMVDHTPFGFKDDMEFCMH  365

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+ +VGV AIP S FY +P+DGK+LVRF FCKDE TL++AV ++
Sbjct  366  LVHKVGVAAIPPSGFYEDPQDGKHLVRFAFCKDEDTLKAAVRKL  409



>ref|XP_002982875.1| hypothetical protein SELMODRAFT_422162 [Selaginella moellendorffii]
 gb|EFJ16120.1| hypothetical protein SELMODRAFT_422162 [Selaginella moellendorffii]
Length=415

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            + GM+ERTVTM+S+GKT+S TGWK+GWAIAPPHL++GIRQAHS +TF+T+TP+Q+ A  A
Sbjct  246  IKGMFERTVTMSSMGKTYSFTGWKVGWAIAPPHLSYGIRQAHSNITFSTATPLQWGAVAA  305

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L AP+SYY +L+  Y A+K ILV GLK  GF VY   GTYFV+VDHTPFG KDD+ FC +
Sbjct  306  LEAPESYYQDLRSAYIARKDILVQGLKEVGFKVYEPQGTYFVMVDHTPFGFKDDMEFCMH  365

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+ +VGV AIP S FY +P+DGK+LVRF FCKDE TL++AV ++
Sbjct  366  LVHKVGVAAIPPSGFYEDPQDGKHLVRFAFCKDEDTLKAAVRKL  409



>ref|XP_010999404.1| PREDICTED: kynurenine--oxoglutarate transaminase 1-like [Populus 
euphratica]
Length=211

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -2

Query  592  YAAATALRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDD  413
            +AAA ALRAP+SYYVELKRDY AKK ILV+GLKA GF V+PSSGTYFV+VDHTPFGL++D
Sbjct  95   WAAAFALRAPESYYVELKRDYMAKKEILVEGLKAVGFKVFPSSGTYFVVVDHTPFGLEND  154

Query  412  VAFCEYLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAV  272
            +AFCEYLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDE+TL++AV
Sbjct  155  IAFCEYLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEETLKAAV  201



>emb|CDX88383.1| BnaC06g38270D [Brassica napus]
Length=134

 Score =   189 bits (480),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 107/154 (69%), Gaps = 30/154 (19%)
 Frame = -2

Query  724  MNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATALRAPDSYYVE  545
            MNSLGKTFSLTGWK GWAIAPPHLTWGIRQA ++LTF TSTPMQYAA  AL AP  Y+ E
Sbjct  1    MNSLGKTFSLTGWKTGWAIAPPHLTWGIRQAQTYLTFRTSTPMQYAAVAALEAPGCYFKE  60

Query  544  LKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYLIKEVGVVAI  365
            L+RDYSAKK ILV                             +DVAFCEYLIKEVGVVA 
Sbjct  61   LRRDYSAKKEILVK---------------------------VNDVAFCEYLIKEVGVVA-  92

Query  364  PTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
              SVF+L+ E+GK+LVRF  C DE+ LRSAVERM
Sbjct  93   --SVFHLDKEEGKSLVRFALCNDEEKLRSAVERM  124



>ref|WP_019888156.1| aminotransferase [Streptomyces purpureus]
Length=391

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  APP LT  +R A  FLT+ +S P QYA A A
Sbjct  225  LPGMRERTVTIGSAGKTFSFTGWKVGWITAPPELTAAVRSAKQFLTYVSSGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+  L+ D SAK+ +L DGL  AGF V+  +GTYFV  D  PFG  D  AFC  
Sbjct  285  LRLPDSYFEGLRADLSAKRDLLSDGLAEAGFEVFRPAGTYFVTTDIRPFGESDGFAFCRA  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E  L+ AV R+
Sbjct  345  LPERCGVVAIPNAVFYDDREQGAPFVRFAFCKKESVLQEAVSRL  388



>ref|WP_030383719.1| aminotransferase [Streptomyces sp. NRRL S-241]
Length=393

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTFSFTGWKVGWVTAPPELVTAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY   + D +AK+ IL DGL AAGF VY   GTYF+  D TP G KD +AFC  
Sbjct  287  LALPDAYYDTFRADLAAKRDILADGLAAAGFEVYRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK E+ LR AVER+
Sbjct  347  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKREEVLREAVERL  390



>ref|WP_013940377.1| aminotransferase [Myxococcus fulvus]
 gb|AEI67275.1| class I/II aminotransferase [Myxococcus fulvus HW-1]
Length=396

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 4/167 (2%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPG+ ERTVT++S GKTFSLTGWK+GW IAPP L   +++AH F+TFAT+ P+Q A A A
Sbjct  224  LPGLAERTVTVSSGGKTFSLTGWKVGWVIAPPALRDAVQRAHQFVTFATAAPLQAAMAEA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+ EL   Y+AK+  L+ GL+ AG T +   G+YF++ D T  G  DDVAFC +
Sbjct  284  LRLPDAYFAELASSYAAKRGRLLTGLREAGLTPFAPEGSYFILADITRQGFADDVAFCRH  343

Query  394  LIKEVGVVAIPTSVFYLNPED---GKNLVRFTFCKDEQTLRSAVERM  263
            L+ EVGV AIP SVFY +PE    G+ L RF FCK E  L  AV R+
Sbjct  344  LVSEVGVAAIPPSVFY-SPEHRPLGQGLARFAFCKTEAVLDEAVRRL  389



>ref|WP_030781937.1| aminotransferase [Streptomyces sp. NRRL F-5008]
Length=398

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  230  LPGMRERTVTISSAGKTFSFTGWKVGWLTAPPELVAAVRSAKQFLTYVSSGPFQYAIAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD   FC  
Sbjct  290  LRLPDTYFDGFRADLLRKRDLLADGLRAAGFEVYLPRGTYFITTDITPFGEKDAHTFCRT  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY N E G+  VRF FCK ++ L  A +R+
Sbjct  350  LPERAGVVAIPNSVFYDNHEAGRTQVRFAFCKKDEVLTEAADRL  393



>ref|WP_042423565.1| aminotransferase [Streptacidiphilus anmyonensis]
Length=388

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  221  LPGMRERTVSISSAGKTFSFTGWKVGWVTATPELVAAVRTAKQYLTYVSAGPFQYAVAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+  L+ D   K+ +L  GL+AAGF VY   GTYF+  D  PFG KD  AFC  
Sbjct  281  LRLPDSYFATLRADLQRKRDLLGSGLRAAGFEVYEPQGTYFITTDTAPFGEKDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P+ G++ VRFTFCK +  L  AV R+
Sbjct  341  LPERCGVVAIPNSVFYDDPDAGRSQVRFTFCKQDSVLEDAVSRL  384



>ref|WP_031133913.1| aminotransferase [Streptomyces sp. NRRL WC-3719]
Length=393

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTF+ TGWK+GW  APP LT  +R A  +LT+  S P QYA A A
Sbjct  227  FPGMRERTVTISSAGKTFAFTGWKVGWLTAPPELTAAVRTAKQYLTYVASGPFQYAVAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P SY+  L+ D   K+ +L DGL AAGF VY  +GTYFV  D +  G KD VAFC  
Sbjct  287  LRLPQSYFDTLRADLEGKRDLLADGLAAAGFRVYRPAGTYFVTADISGLGEKDGVAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY +P  G++L+RF FCK E  LR A +R+
Sbjct  347  LPERCGVVAIPNAVFYDHPGAGRSLIRFAFCKKEAVLREAADRL  390



>ref|WP_027748891.1| aminotransferase [Streptomyces sp. CNH287]
Length=412

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTF+ TGWK+GW  APP L   +R A  +LT+ ++ P QYA A A
Sbjct  244  LPGMRERTVTISSAGKTFAFTGWKVGWVTAPPELVAAVRSAKQYLTYVSAGPFQYAVAEA  303

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+  L  D  AK+ +L  GL  AGFTVY  +GTYFV  D  P G +D  AFC  
Sbjct  304  LALPDSYFTSLGEDLRAKRDLLTAGLAEAGFTVYRPAGTYFVTADIRPLGERDGRAFCLA  363

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P SVFY +PE G++LVRF FCK  +TL  AV R+
Sbjct  364  LPERCGVVAVPNSVFYDDPEAGRSLVRFAFCKRRETLDEAVRRL  407



>ref|WP_035951716.1| aminotransferase [Frankia sp. EUN1f]
Length=388

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVTISSAGKTFSFTGWKVGWVTADGPLVSAVRTAKQYLTYVSAGPFQYAIAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  280  LRLPDSYFDRFRADLGRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P+ G++ VRFTFCK E  LR A  R+
Sbjct  340  LPERCGVVAIPNSVFYDDPDAGRSQVRFTFCKREDVLRDATARL  383



>gb|EFC83773.1| aminotransferase class I and II [Frankia sp. EUN1f]
Length=400

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  232  LPGMRERTVTISSAGKTFSFTGWKVGWVTADGPLVSAVRTAKQYLTYVSAGPFQYAIAEA  291

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  292  LRLPDSYFDRFRADLGRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  351

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P+ G++ VRFTFCK E  LR A  R+
Sbjct  352  LPERCGVVAIPNSVFYDDPDAGRSQVRFTFCKREDVLRDATARL  395



>ref|WP_042378863.1| aminotransferase [Streptacidiphilus melanogenes]
Length=388

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV+++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  221  FPGMRERTVSISSAGKTFSFTGWKVGWVTGTPELVAAVRTAKQYLTYVSAGPFQYAVADA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+  L+ D + K+ +L DGL+AAGF VY   GTYF+  D  PFG KD  AFC  
Sbjct  281  LRLPDSYFTTLRADLTRKRDLLADGLRAAGFEVYEPQGTYFITTDIAPFGEKDAYAFCRE  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP SVFY +P+ G++ VRFTFCK +  L  A  R+
Sbjct  341  LPARCGVVAIPNSVFYDDPDAGRSQVRFTFCKQDHVLEDAASRL  384



>ref|WP_030645179.1| aminotransferase [Streptomyces rimosus]
Length=392

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELVGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  286  LALPDSYYSGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK E+ LR AV+R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKQEKVLREAVDRL  389



>ref|WP_034089273.1| aminotransferase [Streptacidiphilus albus]
Length=388

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWVTASRELVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD Y+  L+ D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  280  LRLPDGYFTTLRTDLLRKRDLLADGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +PE G+  VRFTFCK +Q L  A  ++
Sbjct  340  LPERCGVVAIPNSVFYDDPEAGRTQVRFTFCKQDQVLADAAVQL  383



>ref|WP_004985468.1| aminotransferase [Streptomyces ghanaensis]
 gb|EFE68136.1| aminotransferase [Streptomyces ghanaensis ATCC 14672]
Length=396

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  228  FPGMRERTVTISSAGKTFSFTGWKVGWITAAPELVTAVRSAKQYLTYVSAGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+   + D   K+ +L DGL+AAGF VY   GTYFV  D TP G KD  AFC  
Sbjct  288  LALPDSYFDGFRSDLQRKRDLLGDGLRAAGFEVYQPQGTYFVTTDITPLGEKDAYAFCHA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY  P+ G+N VRF FCK + TL  AV+R+
Sbjct  348  LPERCGVVAIPNSVFYDAPDVGRNQVRFAFCKKDDTLSEAVDRL  391



>ref|WP_030590168.1| aminotransferase [Streptomyces rimosus]
Length=392

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELVGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  286  LALPDSYYTGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK E+ L+ AV+R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKQEKVLQEAVDRL  389



>ref|WP_030086097.1| aminotransferase, partial [Streptomyces decoyicus]
Length=254

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  APP L   +R A  FLT+ ++ P QYA A A
Sbjct  88   FPGMRERTVTIGSAGKTFSFTGWKVGWITAPPELVSAVRSAKQFLTYVSAGPFQYAVAEA  147

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ EL+ D  AK+ IL  GL  AGF V+  SGTYF+  D  P G +D  AFC  
Sbjct  148  LALPDSYFTELRDDLRAKRDILATGLTEAGFQVFRPSGTYFITTDIRPLGHEDGFAFCRA  207

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK +  LR AV R+
Sbjct  208  LPERAGVVAIPNAVFYDHKDQGAPYVRFAFCKQQSVLREAVGRL  251



>ref|WP_032916916.1| aminotransferase [Streptomyces rimosus]
Length=392

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELVGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  286  LALPDSYYTGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK E+ L+ AV+R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKQEKVLQEAVDRL  389



>gb|KEF21180.1| aminotransferase [Streptomyces rimosus]
Length=395

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  229  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELVGAVRSAKQFLTYVSAGPFQYAVAEA  288

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  289  LALPDSYYTGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  348

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK E+ L+ AV+R+
Sbjct  349  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKQEKVLQEAVDRL  392



>ref|WP_003979925.1| MULTISPECIES: aminotransferase [Streptomyces]
 gb|ELQ84290.1| aminotransferase [Streptomyces rimosus subsp. rimosus ATCC 10970]
 gb|KEF07842.1| aminotransferase [Streptomyces rimosus]
 gb|KEF14920.1| aminotransferase [Streptomyces rimosus R6-500]
Length=392

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELVGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  286  LALPDSYYTGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK E+ L+ AV+R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKQEKVLQEAVDRL  389



>ref|WP_042453819.1| aminotransferase [Streptacidiphilus jiangxiensis]
Length=388

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  221  LPGMRERTVTISSAGKTFSFTGWKVGWVTATPELVAAVRTAKQYLTYVSAGPFQYAVAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D + K+ +L DGL+ AGF VY   GTYF+  D  PFG KD  AFC  
Sbjct  281  LRLPDSYFAGFRTDLARKRDLLADGLRTAGFEVYEPQGTYFITTDIAPFGEKDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY + E G   VRFTFCK +  L  AV R+
Sbjct  341  LPERCGVVAIPNSVFYDDKEAGATQVRFTFCKQDHVLEEAVLRL  384



>ref|WP_030709223.1| aminotransferase [Streptomyces sp. NRRL F-2580]
Length=393

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTFSFTGWKVGWVTAPPELVTAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY   + D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LVLPDTYYEAFRADLAAKRDILADGLAAAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK E  LR A  R+
Sbjct  347  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKREDVLREAASRL  390



>ref|WP_031172603.1| aminotransferase [Streptomyces durhamensis]
Length=397

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P LT  +R    FLT+ +S P QYA A A
Sbjct  231  FPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELTAAVRSVKQFLTYVSSGPFQYAVAEA  290

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+Y+ E +R   A++ IL  GL  AGF V+  +GTYFV  D  P G KD  AFC  
Sbjct  291  LALPDTYFEEFRRSMLARRDILAQGLTEAGFEVFRPAGTYFVTTDIRPLGEKDGFAFCRA  350

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY + E G   VRF FCK E+TLR AVER+
Sbjct  351  LPHRAGVVAIPNAVFYDDREAGAPFVRFAFCKREETLREAVERL  394



>ref|WP_037892802.1| aminotransferase [Streptomyces xanthophaeus]
Length=394

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTYSFTGWKVGWVTAPPELVTAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY  L+ D +AK+ +L DGL AAGF VY   GTYFV  D TP G KD +AFC  
Sbjct  287  LALPDAYYENLRTDLAAKRDLLSDGLAAAGFEVYRPQGTYFVTTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK  + L+ AV R+
Sbjct  347  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKRTEVLQEAVARL  390



>ref|WP_030199323.1| aminotransferase [Streptomyces sp. NRRL S-87]
Length=401

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  233  LPGMRERTVTISSSGKTFSFTGWKVGWITAPPSLVTAVRTAKQFLTYVSSGPFQYAIAEA  292

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY   + +  AK+ IL DGL+AAGF V+   GTYF+  D TP G KD V FC  
Sbjct  293  LALPDAYYTGFREELRAKRDILSDGLRAAGFEVFRPRGTYFITTDITPLGEKDGVDFCRS  352

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY +   G++LVRF FCK    L  A +R+
Sbjct  353  LPERCGVVAIPNAVFYDDRAAGRSLVRFAFCKQTAVLEEAADRL  396



>ref|WP_042820109.1| aminotransferase [Streptomyces sp. RSD-27]
 gb|KIF00666.1| aminotransferase [Streptomyces sp. RSD-27]
Length=391

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  225  LPGMRERTVTISSAGKTFSFTGWKVGWITAPPALVSAVRSAKQFLTYVSSGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY   + D +AK+ +L +GL AAGF V+   GTYF+  D +P G KD +AFC  
Sbjct  285  LSLPDTYYDAFRADLAAKRDLLAEGLDAAGFRVFRPQGTYFITTDVSPLGEKDGLAFCRA  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY + E G   VR+ FCK  + LR AV+R+
Sbjct  345  LPERCGVVAIPNQVFYDDREAGATQVRWAFCKKTEVLREAVDRL  388



>ref|WP_030299152.1| aminotransferase [Streptomyces katrae]
Length=393

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTFSFTGWKVGWITAPPELVSAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY   + D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LDLPDSYYEGFRADLAAKRDILADGLTAAGFEVFRPRGTYFITTDITPLGEKDGLAFCRT  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK  + L  A ER+
Sbjct  347  LPERCGVVAIPNQVFYDHQSAGATQVRWAFCKKTEVLEEAAERL  390



>ref|WP_018092406.1| aminotransferase [Streptomyces sp. FxanaC1]
Length=395

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  AP  L   +R A  FLT+ ++ P QYA A A
Sbjct  226  FPGMRERTVTIGSAGKTFSFTGWKVGWVTAPAELVGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ EL+ D  AK+ +L  GL AAGF V+  SGTYF+  D  P G  D  AFC  
Sbjct  286  LALPDSYFTELRDDLRAKRDVLATGLTAAGFQVFRPSGTYFITTDIRPLGHDDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L + VGVVAIP +VFY + + G   VRF FCK E  LR A ER+
Sbjct  346  LPERVGVVAIPNAVFYDHKDQGAPYVRFAFCKQETVLREAAERL  389



>ref|WP_030870913.1| aminotransferase [Streptomyces sp. NRRL F-2747]
Length=393

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSSGKTFSFTGWKVGWITAPPELVSAVRSAKQFLTYVSSGPFQYAIAQA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD YY  L+ D +AK+ IL DGL AAGF VY   GTYF+  D TP G KD +AFC  
Sbjct  287  LQLPDGYYEGLRADLAAKRDILADGLAAAGFEVYRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK  + L  A  R+
Sbjct  347  LPERCGVVAIPNQVFYDDRAAGATQVRWAFCKKSEVLEEAAARL  390



>ref|WP_030957921.1| aminotransferase [Streptomyces sp. NRRL S-378]
Length=393

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  FPGMRERTVTIGSAGKTFSFTGWKVGWITAPPALVSAVRAAKQFLTYVSSGPFQYAVAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+YY   + D +AK+ IL DGL +AGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LQLPDAYYDAFRADLAAKRDILADGLASAGFQVFRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +   G   VR+ FCK  + L  AVER+
Sbjct  347  LPERCGVVAIPNSVFYDDKSAGAAQVRWAFCKKTEVLEEAVERL  390



>ref|WP_030056597.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=386

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVTISSAGKTFSFTGWKVGWVTASPALVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +LVDGL  AGF V+   GTYFV  D TP G KD + FC  
Sbjct  280  LRLPDSYFDGFRADLRRKRDLLVDGLAEAGFRVFTPEGTYFVTTDITPLGEKDGIEFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G++L+RFTFCK +  L+ AV R+
Sbjct  340  LPERCGVVAIPNAVFYDDADAGRSLIRFTFCKRDDVLQEAVARL  383



>ref|WP_030152887.1| aminotransferase [Streptomyces sp. NRRL S-244]
Length=393

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSSGKTFSFTGWKVGWITAPPELVSAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY + + D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LRLPDAYYEDFRADLAAKRDILADGLTAAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK  + L  A  R+
Sbjct  347  LPERCGVVAIPNQVFYDDRAAGATQVRWAFCKKTEVLEEAAARL  390



>ref|WP_011553764.1| aminotransferase [Myxococcus xanthus]
 gb|ABF86399.1| aminotransferase, classes I and II [Myxococcus xanthus DK 1622]
Length=396

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPG+ ERTVT++S GKTFSLTGWK+GW IAPP L   +++AH F+TFAT+ P+Q A A A
Sbjct  224  LPGLAERTVTVSSGGKTFSLTGWKVGWVIAPPPLRDAVQRAHQFVTFATAAPLQAAMAEA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+ EL   Y+AK+  L+ GL+ AG T +   G+YF++ D T  G  DDVAFC +
Sbjct  284  LRLPDAYFTELTASYAAKRERLLTGLREAGLTAFAPEGSYFILADITRQGFADDVAFCRH  343

Query  394  LIKEVGVVAIPTSVFY--LNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L+ +VGV AIP SVFY   +   G+ L RF FCK +  L  AV R+
Sbjct  344  LVSKVGVAAIPPSVFYGPAHRHLGQGLARFAFCKTDAVLDEAVRRL  389



>ref|WP_030620605.1| aminotransferase [Streptomyces achromogenes]
Length=394

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV++ S GKT+S TGWK+GW  A P L   +R A  FLT+  S P QYA A A
Sbjct  228  FPGMRERTVSIGSAGKTYSFTGWKVGWVTAAPELVGAVRSAKQFLTYVASGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY E +R   A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  288  LALPDSYYEEFRRGMLARREILAEGLTAAGFEVFRPAGTYFITTDIRPLGEKDGFAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E+ LR A ER+
Sbjct  348  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREEVLREAAERL  391



>ref|WP_033208187.1| aminotransferase [Streptomyces bikiniensis]
Length=389

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  222  LPGMRERTVTISSAGKTFSFTGWKVGWITASPELTSAVRSAKQFLTYVSSGPFQYAVAEA  281

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+  L+ D +AK+ +L +GL  AGF VY  SGTYFV  D  P G  D +AFC  
Sbjct  282  LRLPDTYFDALRADLAAKRDLLGEGLAQAGFEVYRPSGTYFVTTDVRPLGATDGLAFCRS  341

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L  AV R+
Sbjct  342  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKRTEVLEDAVSRL  385



>ref|WP_030790852.1| aminotransferase [Streptomyces lavenduligriseus]
Length=394

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV++ S GKT+S TGWK+GW  A P L   +R A  FLT+  S P QYA A A
Sbjct  228  FPGMRERTVSIGSAGKTYSFTGWKVGWVTAAPELVRAVRSAKQFLTYVASGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY E +R   A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  288  LALPDSYYEEFRRGMLARREILAEGLTAAGFEVFRPAGTYFITTDIRPLGEKDGFAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E+ LR A ER+
Sbjct  348  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREEVLREAAERL  391



>ref|WP_030726560.1| aminotransferase [Streptomyces sp. NRRL S-237]
Length=393

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTYSFTGWKVGWITASPELITAVRSVKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LALPDSYYDTLRADLAAKRDILADGLAAAGFDVFRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK E  LR A ER+
Sbjct  347  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKREDVLREAAERL  390



>ref|WP_037575899.1| aminotransferase [Streptacidiphilus oryzae]
Length=398

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  230  LPGMRERTVSISSAGKTFSFTGWKVGWVTAAAPLVAAVRTAKQYLTYVSAGPFQYAVAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY + +     ++ +L  GL+AAGF VY   GTYF+  D  PFG KD  AFC  
Sbjct  290  LRLPDAYYEDFRASLRRRRDLLDAGLRAAGFEVYEPQGTYFITTDIAPFGAKDAYAFCRS  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P SVFY +PE G++ VRFTFCK E+ LR A  R+
Sbjct  350  LPERCGVVAVPNSVFYDDPEAGRSQVRFTFCKKEEVLREAAARL  393



>ref|WP_019524271.1| aminotransferase [Streptomyces sp. FxanaD5]
Length=396

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 109/163 (67%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM +RTVT++S GKTFS TGWK+GWA     L   +R A  +LT+ ++ P QYA A AL
Sbjct  229  PGMRDRTVTISSAGKTFSFTGWKVGWATGSRELVTAVRTAKQYLTYVSAGPFQYAIAEAL  288

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  L
Sbjct  289  RLPDSYFDGFRADLRRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRAL  348

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVAIP SVFY +P+ G++ VRFTFCK ++ L  A  R+
Sbjct  349  PERCGVVAIPNSVFYDDPDAGRSQVRFTFCKRDEILDEATSRL  391



>ref|WP_033818282.1| aminotransferase [Kitasatospora sp. MBT63]
Length=386

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVTISSAGKTFSFTGWKVGWVTAVPALVSAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+   + D   K+ +L DGL AAGFTV+   GTYF+  D TP G KD + FC  
Sbjct  280  LRLPDAYFDSFRADLRRKRDLLCDGLSAAGFTVFRPEGTYFITTDITPLGEKDGLEFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP  VFY + E G++LVRFTFCK +  L  AV R+
Sbjct  340  LPGRCGVVAIPNVVFYDDTEAGRSLVRFTFCKRDDVLEEAVARL  383



>ref|WP_018558364.1| aminotransferase [Streptomyces sp. BoleA5]
Length=387

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 109/163 (67%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM +RTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A AL
Sbjct  222  PGMRDRTVTISSSGKTFSFTGWKVGWVTAAPALVSAVRAAKQYLTYVSAGPFQYAVAEAL  281

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY + + D   K+ +L DGL+ AGF V+   GTYFV  D  P   KD +AFC  L
Sbjct  282  RLPDAYYRDFREDLRRKRDLLSDGLEQAGFRVFRPEGTYFVTTDIRPLDEKDGLAFCRAL  341

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+P  +FY + E+G++LVRF FCK E  LR +VER+
Sbjct  342  PERCGVVAVPNVIFYDDAEEGRSLVRFAFCKREDVLRESVERL  384



>ref|WP_043221284.1| aminotransferase [Streptomyces sp. NRRL F-5193]
Length=392

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM +RTVT+ S GKT+S TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  225  FPGMRDRTVTIGSAGKTYSFTGWKVGWTTASPELTAAVRSAKQFLTYVSSGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYY  L+ D  AK+ +L DGL  AGFTVY   GTYFV  D  P G  D  AFC  
Sbjct  285  LRLPDSYYDGLRADLQAKRDLLSDGLARAGFTVYRPRGTYFVTTDIRPLGTDDGFAFCRS  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK    L+ AV+R+
Sbjct  345  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKRADVLQEAVDRL  388



>ref|WP_030010115.1| aminotransferase [Streptomyces lavendulae]
Length=395

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  AP  L   +R A  FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTFSFTGWKVGWVTAPAELITAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY   + D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LALPDSYYDTFRADLAAKRDILADGLAAAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G+  VR+ FCK    L+ AVER+
Sbjct  347  LPERCGVVAIPNQVFYDDKAAGRTQVRWAFCKRTVVLQEAVERL  390



>ref|WP_028964077.1| aminotransferase [Streptomyces thermolilacinus]
Length=395

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = -2

Query  748  GMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATALR  569
            GM ERTVT++S GKTFS TGWK+GW  APP LT  +R A  FLT+  S P Q+A A ALR
Sbjct  229  GMRERTVTISSAGKTFSFTGWKVGWLTAPPELTAAVRTAKQFLTYVASGPFQHAIAEALR  288

Query  568  APDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYLI  389
             P+SY+  L+ D   K+ IL+ GL AAGF VY   GTYF+  D    G KD VAFC  L 
Sbjct  289  LPESYFDTLRADLEGKRDILMAGLTAAGFEVYRPRGTYFITADIAGLGEKDGVAFCRALP  348

Query  388  KEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            +  GVVAIP +VFY + + G++L+RF FCK E  LR A +R+
Sbjct  349  ERCGVVAIPNAVFYDHADAGRSLIRFAFCKKEAVLREAADRL  390



>ref|WP_033215091.1| aminotransferase [Streptomyces virginiae]
Length=393

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTYSFTGWKVGWITASPELITAVRSVKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LALPDSYYDTLRADLAAKRDILADGLAAAGFEVFRPRGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP  VFY +   G   VR+ FCK E  LR A ER+
Sbjct  347  LPDRCGVVAIPNQVFYDDRSAGATQVRWAFCKREDVLREAAERL  390



>ref|WP_030838833.1| aminotransferase [Streptomyces sp. NRRL F-4474]
Length=398

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKT+S TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  230  FPGMRERTVTISSAGKTYSFTGWKVGWITAPPELVSAVRSAKQFLTYVSSGPFQYAIAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY  L+ D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  290  LHLPDAYYDALRADLAAKRDILADGLAAAGFQVFRPRGTYFITTDITPLGEKDGLAFCRA  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK    L+ AVER+
Sbjct  350  LPERCGVVAIPNQVFYDDKAAGATQVRWAFCKRTVVLQEAVERL  393



>ref|WP_031005109.1| aminotransferase [Streptomyces sp. NRRL WC-3773]
Length=392

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  FPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELIGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D   K+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  286  LALPDSYYAGLRDDLRTKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK E+ L+ AV+R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKQEKVLQEAVDRL  389



>ref|WP_030232948.1| aminotransferase [Streptomyces sp. NRRL S-350]
Length=386

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVTISSAGKTFSFTGWKVGWVTASPALVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD Y+   + D   K+ +L DGL AAGF V+   GTYF+  D TP G KD + FC  
Sbjct  280  LRLPDDYFDTFRADLLRKRDLLADGLSAAGFRVFAPEGTYFITTDITPLGEKDGIEFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY + E G++LVRFTFCK +  L  AV R+
Sbjct  340  LPGRCGVVAIPNAVFYDDTEAGRSLVRFTFCKKDAVLAEAVSRL  383



>ref|WP_023418492.1| aminotransferase [Streptomyces sp. PVA 94-07]
 gb|ESQ03805.1| aminotransferase [Streptomyces sp. PVA 94-07]
Length=367

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A   L   +R A  +LT+ +S P QYA A A
Sbjct  199  LPGMRERTVSISSAGKTFSFTGWKVGWVTANGPLVSAVRTAKQYLTYVSSGPFQYAIAEA  258

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYFV  D  P G KD  AFC  
Sbjct  259  LRLPDSYFDGFRADLRRKRDLLGDGLRAAGFEVYQPQGTYFVTTDIAPLGEKDAYAFCRA  318

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVA+P SVFY +PE G++ VRFTFCK    L+ AV R+
Sbjct  319  LPDRCGVVAVPNSVFYDDPEAGRSQVRFTFCKKVDVLQEAVSRL  362



>ref|WP_037601224.1| aminotransferase [Streptacidiphilus rugosus]
Length=389

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW      L   +R A  +LT+ ++ P QYA A A
Sbjct  221  LPGMRERTVSISSSGKTFSFTGWKVGWVTGTRELVAAVRTAKQYLTYVSAGPFQYAIADA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+ + + D   K+ +L  GL+AAGF VY   GTYF+  D TP G KD + FC  
Sbjct  281  LRLPDSYFADFRADLQRKRDLLDAGLRAAGFEVYEPQGTYFITTDITPLGEKDGLEFCRT  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +PE G++ VRFTFCK ++ L  A ER+
Sbjct  341  LPERCGVVAIPNSVFYDDPEAGRSQVRFTFCKRDEILADASERL  384



>ref|WP_031037202.1| aminotransferase [Streptomyces sp. NRRL WC-3774]
Length=396

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  228  FPGMRERTVTIGSAGKTFSFTGWKVGWITANGPLVSAVRTAKQYLTYVSAGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  288  LQLPDSYFDGFRTDLRRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P+ G++ VRFTFCK +  L+ A +R+
Sbjct  348  LPERCGVVAIPNSVFYDDPDAGRSQVRFTFCKKDDVLQEAADRL  391



>ref|WP_032760413.1| aminotransferase [Streptomyces alboviridis]
Length=388

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWKIGW      L   +R A  +LTF +  P QYA A A
Sbjct  221  LPGMRERTVSISSAGKTFSYTGWKIGWVTGDSALVTAVRSAKQYLTFVSGGPFQYAIAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+++ E +     ++ +L +GL++AGF VY   GTYF+  D +PFG +D  AFC  
Sbjct  281  LRLPDTFFTEFRESMRRRRDLLAEGLRSAGFRVYEPEGTYFITTDISPFGEEDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK E  L  AVER+
Sbjct  341  LPERCGVAAVPVSVFYDDPEAGRSQVRFTFCKREDVLEEAVERL  384



>ref|WP_007496557.1| aminotransferase [Streptomyces zinciresistens]
 gb|EGX58591.1| aminotransferase [Streptomyces zinciresistens K42]
Length=396

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  228  FPGMRERTVTIGSAGKTFSFTGWKVGWVTANGPLVSAVRTAKQYLTYVSAGPFQYAIAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  288  LRLPDSYFENFRADLRRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P  G++ VRFTFCK +  L+ A  R+
Sbjct  348  LPERCGVVAIPNSVFYDDPGAGRSQVRFTFCKKDDVLQEAAGRL  391



>ref|WP_030982006.1| aminotransferase [Streptomyces sp. NRRL WC-3744]
Length=397

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV++ S GKTFS TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  231  FPGMRERTVSIGSAGKTFSFTGWKVGWVTAAPELVSAVRAVKQFLTYVSSGPFQYAVAEA  290

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ E +RD  A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  291  LALPDSYFEEFRRDMLARREILAEGLTAAGFEVFRPAGTYFITTDIRPLGEKDGFAFCRA  350

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E  L  A ER+
Sbjct  351  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREDVLSEAAERL  394



>ref|WP_030495875.1| aminotransferase [Microtetraspora glauca]
Length=390

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM +RTVT+ S GKT+S TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  223  LPGMRDRTVTIGSAGKTYSFTGWKVGWTTASPELTAAVRSAKQFLTYVSSGPFQYAVAEA  282

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYY +L+    A++ +L DGL  AGF V+   GTYFV  D  P G +D +AFC  
Sbjct  283  LRLPDSYYDDLRAGLRARRDLLSDGLAEAGFAVHRPRGTYFVTTDIRPLGERDGIAFCRA  342

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK    L+ AV+R+
Sbjct  343  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKRADVLQEAVDRL  386



>ref|WP_042801172.1| aminotransferase [Streptomyces sp. C]
Length=391

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  225  LPGMRERTVTISSAGKTFSFTGWKVGWITAPPALVSAVRSAKQFLTYVSSGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ + + D +AK+ +L DGL AAGF V+   GTYF+  D +P G KD +AFC  
Sbjct  285  LALPDSYFDDFRADLAAKRDLLSDGLAAAGFEVFRPQGTYFITTDVSPLGEKDGLAFCRA  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP  VFY +   G   VR+ FCK    L+ AVER+
Sbjct  345  LPGRCGVVAIPNQVFYDDKSAGATQVRWAFCKRTDVLQEAVERL  388



>ref|WP_030307008.1| aminotransferase [Streptomyces albidoflavus]
 gb|KDR62782.1| aminotransferase [Streptomyces wadayamensis]
Length=392

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSTPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRNSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKPAGSPFVRFAFCKKDEVLNEAAERL  387



>ref|WP_037969753.1| aminotransferase [Streptomyces sp. PVA 94-07]
Length=388

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A   L   +R A  +LT+ +S P QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWVTANGPLVSAVRTAKQYLTYVSSGPFQYAIAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYFV  D  P G KD  AFC  
Sbjct  280  LRLPDSYFDGFRADLRRKRDLLGDGLRAAGFEVYQPQGTYFVTTDIAPLGEKDAYAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVA+P SVFY +PE G++ VRFTFCK    L+ AV R+
Sbjct  340  LPDRCGVVAVPNSVFYDDPEAGRSQVRFTFCKKVDVLQEAVSRL  383



>gb|EFL16084.1| aminotransferase [Streptomyces sp. C]
Length=394

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  228  LPGMRERTVTISSAGKTFSFTGWKVGWITAPPALVSAVRSAKQFLTYVSSGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ + + D +AK+ +L DGL AAGF V+   GTYF+  D +P G KD +AFC  
Sbjct  288  LALPDSYFDDFRADLAAKRDLLSDGLAAAGFEVFRPQGTYFITTDVSPLGEKDGLAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP  VFY +   G   VR+ FCK    L+ AVER+
Sbjct  348  LPGRCGVVAIPNQVFYDDKSAGATQVRWAFCKRTDVLQEAVERL  391



>ref|WP_031050364.1| aminotransferase [Streptomyces ochraceiscleroticus]
Length=396

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT+ S GKTFS TGWK+GW    P L   +R A  FLT+ ++ P QYA A AL
Sbjct  231  PGMRERTVTIGSAGKTFSFTGWKVGWVTGTPELVGAVRSAKQFLTYVSAGPFQYAVAEAL  290

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PD Y+  L+ D   K+ IL DGL  AGF V+  SGTYFV  D T  G KD +AFC  L
Sbjct  291  ALPDDYFHGLREDLRRKRDILSDGLAEAGFQVFRPSGTYFVTTDITALGEKDGLAFCLGL  350

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+P SVFY + E G++LVRF FCK ++ LR AV R+
Sbjct  351  PERCGVVAVPNSVFYDDKEAGRSLVRFAFCKQDEVLRDAVSRL  393



>ref|WP_015609568.1| Aminotransferase [Streptomyces fulvissimus]
 gb|AGK78213.1| Aminotransferase [Streptomyces fulvissimus DSM 40593]
Length=388

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWKIGW      L   +R A  +LTF +  P QYA A A
Sbjct  221  LPGMRERTVSISSAGKTFSYTGWKIGWVTGDSALVTAVRSAKQYLTFVSGGPFQYAIAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+++ E +     ++ +L +GL++AGF VY   GTYF+  D +PFG +D  AFC  
Sbjct  281  LRLPDTFFTEFRESMHRRRDLLAEGLRSAGFRVYEPEGTYFITTDISPFGEEDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK E  L  AVER+
Sbjct  341  LPERCGVAAVPVSVFYDDPEAGRSQVRFTFCKREDVLEEAVERL  384



>ref|WP_028959526.1| aminotransferase [Streptomyces sp. UNC401CLCol]
Length=396

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 109/163 (67%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM +RTVT++S GKTFS TGWK+GWA     L   +R A  +LT+ ++ P QYA A AL
Sbjct  229  PGMRDRTVTISSAGKTFSFTGWKVGWATGSRELVTAVRTAKQYLTYVSAGPFQYAIAEAL  288

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PDSY+   + D   K+ +L +GL+AAGF VY   GTYF+  D TPFG KD  AFC  L
Sbjct  289  RLPDSYFDGFRADLRRKRDLLGEGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCHAL  348

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVAIP SVFY +P+ G++ VRFTFCK ++ L  A  R+
Sbjct  349  PERCGVVAIPNSVFYDDPDAGRSQVRFTFCKRDEILDEATSRL  391



>ref|WP_035799511.1| aminotransferase [Kitasatospora mediocidica]
Length=386

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWVTAAPALLAAVRTAKQYLTYVSAGPFQYAVAQA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+  L+ D   K+ +L +GL AAGF V+  +GTYF+  D +P G KD + FC  
Sbjct  280  LHLPDSYFDTLRADLRRKRDLLAEGLSAAGFQVFEPAGTYFITTDISPLGEKDGIEFCRS  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY + E G++LVRFTFCK +  L  AV R+
Sbjct  340  LPARCGVVAIPNAVFYDDTEAGRSLVRFTFCKQDDVLNEAVARL  383



>ref|WP_030342399.1| aminotransferase [Streptomyces sp. NRRL S-1022]
Length=394

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV++ S GKTFS TGWK+GW  A P L   +R    FLT+  S P QYA A A
Sbjct  228  FPGMRERTVSIGSAGKTFSFTGWKVGWVTAAPALVSAVRSVKQFLTYVASGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ E +R   A++ IL +GL AAGF V+  +GTYFV  D  P G KD  AFC  
Sbjct  288  LALPDSYFEEFRRGMLARRDILAEGLTAAGFEVFRPAGTYFVTTDIRPLGEKDGFAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E+ LR A ER+
Sbjct  348  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREEILREAAERL  391



>ref|WP_003949184.1| MULTISPECIES: aminotransferase [Streptomyces]
 gb|EFE82307.1| aminotransferase [Streptomyces albus J1074]
 gb|AGI89532.1| Aminotransferase [Streptomyces albus J1074]
Length=398

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSAPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRDSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKPAGSPFVRFAFCKKDEVLNEAAERL  387



>ref|WP_037844089.1| aminotransferase [Streptomyces sp. NRRL F-6628]
Length=392

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSAPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRDSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKPAGSPFVRFAFCKKDEVLNEAAERL  387



>ref|WP_030817408.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=396

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  230  FPGMRERTVTISSAGKTFSFTGWKVGWLTAPPELVSAVRSAKQFLTYVSSGPFQYAIAQA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+YY   + D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  290  LQLPDAYYEAFRADLAAKRDILADGLAAAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK    L  A +R+
Sbjct  350  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKKTPVLEEAADRL  393



>ref|WP_035864299.1| aminotransferase [Kitasatospora cheerisanensis]
 gb|KDN84080.1| aminotransferase [Kitasatospora cheerisanensis KCTC 2395]
Length=386

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV ++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVAISSAGKTFSFTGWKVGWVTGAPELVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY + + D   K+ +L +GL  AGF V+   GTYFV  D TP G KD V FC  
Sbjct  280  LRLPDAYYADFRADLRRKRDLLTEGLAEAGFRVFEPQGTYFVTTDITPLGEKDGVEFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY   E G + VRF FCK E  LR AVER+
Sbjct  340  LPGRCGVVAIPNAVFYDRTELGLSQVRFAFCKRESVLREAVERL  383



>ref|WP_037850792.1| aminotransferase [Streptomyces sp. NRRL S-340]
Length=395

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A   L   +R A  FLT+ ++ P QYA A A
Sbjct  227  LPGMRERTVSISSSGKTFSFTGWKVGWVTAAAPLVTAVRSAKQFLTYVSAGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+  L+ D   K+ +L DGL+AAGF V+   GTYF+  D +PFG KD  AFC  
Sbjct  287  LRLPDSYFDGLRADLRRKRDLLGDGLRAAGFQVHQPQGTYFITTDISPFGEKDAYAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P+SVFY +P  G+  VRF FCK ++ L  A +R+
Sbjct  347  LPERCGVVAVPSSVFYDDPHAGRTQVRFAFCKKDELLLEAADRL  390



>ref|WP_030026710.1| aminotransferase [Streptomyces flavotricini]
Length=398

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  230  FPGMRERTVTISSAGKTFSFTGWKVGWLTAPPELVSAVRTAKQFLTYVSSGPFQYAVAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY   + D +AK+ IL DGL +AGF V+   GTYF+  D TP G KD +AFC  
Sbjct  290  LDLPDAYYESFRADLAAKRDILADGLASAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK    LR A +R+
Sbjct  350  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKRTTVLREAADRL  393



>ref|WP_037960119.1| aminotransferase [Streptomyces violens]
Length=389

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT+ S GKTFS TGWK+GW    P L   +R A  FLT+ ++ P QYA A AL
Sbjct  224  PGMRERTVTIGSAGKTFSFTGWKVGWVTGTPELVGAVRSAKQFLTYVSAGPFQYAVAEAL  283

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PD Y+  L+ D   K+ IL DGL  AGF V+  SGTYFV  D T  G KD +AFC  L
Sbjct  284  ALPDDYFHGLRADLRRKRDILSDGLTEAGFQVFRPSGTYFVTTDITALGEKDGLAFCLGL  343

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+P SVFY + E G++LVRF FCK ++ LR AV R+
Sbjct  344  PERCGVVAVPNSVFYDDKEAGRSLVRFAFCKKDEVLRDAVSRL  386



>ref|WP_037920790.1| aminotransferase [Streptomyces sp. PCS3-D2]
 gb|EYU69158.1| aminotransferase [Streptomyces sp. PCS3-D2]
Length=395

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV+++S GKTFS TGWK+GW +A   L   +R A  +LT+ ++ P QYA A A
Sbjct  227  FPGMRERTVSISSAGKTFSFTGWKVGWVMADGPLVSAVRTAKQYLTYVSAGPFQYAVAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  287  LHLPDSYFDGFRADLQRKRDLLGDGLRAAGFEVYQPEGTYFITTDITPFGEKDAHAFCRT  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P+ G+  VRFTFCK +  L  AV R+
Sbjct  347  LPERCGVVAIPNSVFYDDPDTGRTQVRFTFCKKDGVLHEAVNRL  390



>ref|WP_030258006.1| aminotransferase [Streptacidiphilus jeojiense]
Length=393

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWVTATPELVSTVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY + + D   K+ +L  GL++AGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  280  LRLPDAYYADFRTDLLRKRDLLDAGLRSAGFEVYEPQGTYFITTDITPFGEKDGYAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVA+P SVFY +P+ G++ VRFTFCK    + +AVE +
Sbjct  340  LPARCGVVAVPNSVFYDDPDAGRSQVRFTFCKRLDVISAAVEGL  383



>ref|WP_008408921.1| MULTISPECIES: aminotransferase [Streptomyces]
 gb|EKC94478.1| aspartate/tyrosine/aromatic aminotransferase [Streptomyces sp. 
SM8]
Length=392

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSTPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRDSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKPAGSPFVRFAFCKKDEVLNEAAERL  387



>ref|WP_010644765.1| aminotransferase [Streptomyces sp. S4]
Length=398

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSTPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRDSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKPAGSPFVRFAFCKKDEVLNEAAERL  387



>ref|WP_030696112.1| aminotransferase [Streptomyces griseus]
Length=392

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSTPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRDSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKAAGSPFVRFAFCKKDEVLSEAAERL  387



>ref|WP_031091937.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=397

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV++ S GKTFS TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  231  FPGMRERTVSIGSAGKTFSFTGWKVGWVTAAPELVSAVRAVKQFLTYVSSGPFQYAVAEA  290

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ E +R   A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  291  LALPDSYFEEFRRGMLARREILAEGLTAAGFEVFRPAGTYFITTDIRPLGEKDGFAFCRA  350

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY N E G   VRF FCK E  L  A ER+
Sbjct  351  LPERAGVVAIPNAVFYDNREAGAPFVRFAFCKREDVLSEAAERL  394



>ref|WP_014673961.1| aminotransferase [Streptomyces hygroscopicus]
 gb|AEY90648.1| aminotransferase [Streptomyces hygroscopicus subsp. jinggangensis 
5008]
 gb|AGF64806.1| aminotransferase [Streptomyces hygroscopicus subsp. jinggangensis 
TL01]
Length=394

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV + S GKTFS TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  228  FPGMRERTVAIGSAGKTFSFTGWKVGWVTAAPELVSAVRAVKQFLTYVSSGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ E +R   A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  288  LALPDSYFEEFRRGMLARREILAEGLTAAGFEVFRPAGTYFITTDIRPLGEKDGFAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E  LR A ER+
Sbjct  348  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREDVLREAAERL  391



>ref|WP_037782835.1| aminotransferase [Streptomyces sp. CNH099]
Length=397

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GK++S TGWK+GW  AP  L   +R A  +LT+ +S P QYA A A
Sbjct  223  LPGMRERTVSISSAGKSYSFTGWKVGWVTAPAPLLAAVRTAKQYLTYVSSGPFQYAVAEA  282

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY   L+ D   K+ +L DGL  AGF V+  SGTYFV  D TP G KD VAFC  
Sbjct  283  LALPDSYLAGLRADLLRKRDLLSDGLAEAGFRVFRPSGTYFVTADITPLGEKDGVAFCMS  342

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+PT VFY +P+ G+++VRF FCK ++ LR A  R+
Sbjct  343  LPERCGVVAVPTQVFYDDPDAGRSIVRFAFCKKDEVLREAGARL  386



>ref|WP_023422382.1| MULTISPECIES: aminotransferase [Streptomyces]
 gb|ESP98160.1| aminotransferase [Streptomyces sp. GBA 94-10]
Length=392

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSTPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY +L+    AK+A+L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDDLRDSLRAKRALLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PSRAGVVAIPNAVFYDDKPAGSPFVRFAFCKRDEVLSEAAERL  387



>gb|KIX77321.1| aminotransferase [Streptomyces sp. MBRL 601]
Length=392

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 105/163 (64%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFS TGWK+GW  + P L   +R A  FLTF ++ P QYA A AL
Sbjct  225  PGMRERTVTISSSGKTFSFTGWKVGWVTSTPALVSAVRSAKQFLTFVSAGPFQYAIAEAL  284

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD+YY EL+    AK+ +L DGL AAGF V+  SGTYF+  D  P G  D + FC +L
Sbjct  285  RLPDAYYDELRDSLRAKRTLLTDGLTAAGFGVFRPSGTYFITTDVRPLGHTDGIDFCRHL  344

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
                GVVAIP +VFY +   G   VRF FCK ++ L  A ER+
Sbjct  345  PARAGVVAIPNAVFYDDKAAGSPFVRFAFCKKDEVLSEAAERL  387



>ref|WP_042836185.1| aminotransferase, partial [Streptomyces sp. NRRL S-15]
Length=252

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFSLTGWKIGW  A P L   +R A  FLT+ +  P QYA A A
Sbjct  85   FPGMRERTVTISSAGKTFSLTGWKIGWITASPELVTAVRSAKQFLTYVSGGPFQYAVADA  144

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFG-LKDDVAFCE  398
            LR PDSY+ EL+ D  AK+ +L  GL  AGF VY  +GTYFV  D  P G  +D  AFC 
Sbjct  145  LRLPDSYFDELRADLRAKRDLLSAGLAEAGFEVYKPAGTYFVTTDIRPLGDERDGFAFCR  204

Query  397  YLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             L +  GVVAIP +VFY + E G + VRF FCK  + +  AV R+
Sbjct  205  ALPERCGVVAIPNAVFYDHREQGAHFVRFAFCKRTEVITEAVTRL  249



>ref|WP_041819600.1| aminotransferase [Streptomyces davawensis]
Length=396

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKT+S TGWK+GW  APP L   +R A  FLT+  S P QYA A A
Sbjct  228  FPGMRERTVTIGSAGKTYSFTGWKVGWVTAPPALVSAVRSAKQFLTYVASGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+Y+ E + D  AK+ +L  GL  AGF V+ S+GTYF+  D  P G KD  AFC  
Sbjct  288  LALPDTYFAEFRADMQAKRDLLASGLTEAGFEVFTSAGTYFITTDIRPLGEKDGFAFCRN  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L  AV R+
Sbjct  348  LPERAGVVAIPNAVFYDDKEAGAPYVRFAFCKRNEVLHQAVSRL  391



>ref|WP_033040348.1| aminotransferase [Streptomyces monomycini]
Length=394

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  FPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELIGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G KD  AFC  
Sbjct  286  LALPDSYYTGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEKDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK +  L  AV R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKRKGVLEEAVTRL  389



>ref|WP_030372953.1| aminotransferase [Streptomyces rimosus]
Length=394

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASPELVGAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D  AK+ +L DGL AAGF V+  SGTYFV  D  P G +D  AFC  
Sbjct  286  LALPDSYYTGLRDDLRAKRDLLADGLAAAGFRVFRPSGTYFVTTDIRPLGEEDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK  + L  AV R+
Sbjct  346  LPERAGVVAIPNAVFYDHQDQGAPYVRFAFCKRTELLDEAVARL  389



>emb|CCK28600.1| Aminotransferase YbdL [Streptomyces davawensis JCM 4913]
Length=393

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKT+S TGWK+GW  APP L   +R A  FLT+  S P QYA A A
Sbjct  225  FPGMRERTVTIGSAGKTYSFTGWKVGWVTAPPALVSAVRSAKQFLTYVASGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+Y+ E + D  AK+ +L  GL  AGF V+ S+GTYF+  D  P G KD  AFC  
Sbjct  285  LALPDTYFAEFRADMQAKRDLLASGLTEAGFEVFTSAGTYFITTDIRPLGEKDGFAFCRN  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L  AV R+
Sbjct  345  LPERAGVVAIPNAVFYDDKEAGAPYVRFAFCKRNEVLHQAVSRL  388



>ref|WP_030755723.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=395

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  227  LPGMRERTVTISSAGKTYSFTGWKVGWITASPELITAVRSVKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D +AK+ IL DGL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LALPDSYYDTLRADLAAKRDILADGLAAAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK    L+ AVER+
Sbjct  347  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKRTVVLQEAVERL  390



>ref|WP_028415999.1| aminotransferase [Streptomyces sp. SolWspMP-sol2th]
Length=391

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKT+S TGWKIGW  A   L   +R A  +LTF +  P QYA A A
Sbjct  224  LPGMRERTVSISSAGKTYSYTGWKIGWVTADAPLVTAVRSAKQYLTFVSGGPFQYAIAEA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+++ E +     K+ +L  GL++AGF VY   GTYFV  D +PFG +D  AFC  
Sbjct  284  LQLPDTFFTEFRDSMRRKRDLLAGGLRSAGFQVYEPEGTYFVTTDISPFGEEDAYAFCRA  343

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK ++ L SAVER+
Sbjct  344  LPERCGVAAVPNSVFYDDPEAGRSQVRFTFCKRDEVLESAVERL  387



>ref|WP_037681133.1| aminotransferase [Streptomyces albus]
Length=390

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  222  FPGMRERTVTISSAGKTFSFTGWKVGWVTASGPLVAAVRTAKQYLTYVSAGPFQYAIAEA  281

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+   + D   K+ +L DGL+AAGF V+   GTYF+  D TPFG KD  AFC  
Sbjct  282  LRLPDAYFDGFRADLRRKRDLLGDGLRAAGFEVHQPQGTYFITTDITPFGEKDAYAFCRA  341

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P+ G++ VRFTFCK +  L  A +R+
Sbjct  342  LPERCGVVAIPNSVFYDDPDAGRSQVRFTFCKKDDVLAEAADRL  385



>gb|EWM62867.1| aminotransferase, class I [Micromonospora sp. M42]
Length=246

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW +A   +   +R A  +LT+ ++ P QYA A A
Sbjct  78   LPGMRERTVSISSAGKTFSCTGWKVGWVMADGPIVSAVRTAKQYLTYVSAGPFQYAIAEA  137

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+   + +   K+ +L +GL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  138  LRLPDAYFDGFRANLRRKRDLLGEGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  197

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P  G+  VRFTFCK ++ L  A  R+
Sbjct  198  LPERCGVVAIPNSVFYDDPGAGRTQVRFTFCKKDEVLAEATSRL  241



>ref|WP_018489581.1| aminotransferase [Streptomyces sp. CcalMP-8W]
Length=391

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKT+S TGWKIGW  A   L   +R A  +LTF +  P QYA A A
Sbjct  224  LPGMRERTVSISSAGKTYSYTGWKIGWVTADAPLVTAVRSAKQYLTFVSGGPFQYAIAEA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+++ E +     K+ +L  GL++AGF VY   GTYFV  D +PFG +D  AFC  
Sbjct  284  LQLPDTFFTEFRDSMRRKRDLLAGGLRSAGFQVYEPEGTYFVTTDISPFGEEDAYAFCRA  343

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK ++ L SAVER+
Sbjct  344  LPERCGVAAVPNSVFYDDPEAGRSQVRFTFCKRDEVLESAVERL  387



>ref|WP_030304478.1| aminotransferase [Streptomyces sp. NRRL F-6131]
Length=389

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWITGTPELVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + +   K+ +L DGL AAGF V+  +GTYFV  D TP G KD + FC  
Sbjct  280  LRLPDSYFDGFRAELLHKRDLLADGLAAAGFRVFRPAGTYFVTTDITPLGEKDGIEFCRT  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY +P+ G+ LVRFTFCK    L  AV+R+
Sbjct  340  LPGRCGVVAIPNAVFYDDPDAGRPLVRFTFCKRVDVLEEAVDRL  383



>ref|WP_003955095.1| aminotransferase [Streptomyces clavuligerus]
 gb|EDY49605.1| aminotransferase [Streptomyces clavuligerus ATCC 27064]
Length=190

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKT + TGWKIGWA   P L   +R A  FLT+  + P+QYAAA  
Sbjct  22   FPGMRERTVTISSAGKTLAYTGWKIGWATGSPELVTAVRSAKQFLTYVAAGPLQYAAAEG  81

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+  L+ +  AK+ +L  GL  AGFTV+  +GTYFV  D  P G +D  AFC  
Sbjct  82   LRLPDAYFAGLREELRAKRDLLCAGLADAGFTVHRPAGTYFVTTDIRPLGEEDGFAFCRA  141

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L K  GVVAIP +VFY + E G   VRF FCK  + +  A+ R+
Sbjct  142  LPKRCGVVAIPNAVFYDHREQGAPFVRFAFCKRTEVVEEAIRRL  185



>ref|WP_043331252.1| aminotransferase, partial [Micromonospora sp. M42]
Length=253

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW +A   +   +R A  +LT+ ++ P QYA A A
Sbjct  85   LPGMRERTVSISSAGKTFSCTGWKVGWVMADGPIVSAVRTAKQYLTYVSAGPFQYAIAEA  144

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+   + +   K+ +L +GL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  145  LRLPDAYFDGFRANLRRKRDLLGEGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  204

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P  G+  VRFTFCK ++ L  A  R+
Sbjct  205  LPERCGVVAIPNSVFYDDPGAGRTQVRFTFCKKDEVLAEATSRL  248



>ref|WP_032776204.1| aminotransferase [Streptomyces sp. NRRL S-623]
Length=388

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWKIGW      L   +R A  +LTF +  P QYA A A
Sbjct  221  LPGMRERTVSISSAGKTFSYTGWKIGWVTGDAALVTAVRSAKQYLTFVSGGPFQYAIAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+++ E +     ++ +L +GL++AGF V+   GTYF+  D +PFG +D  AFC  
Sbjct  281  LRLPDTFFTEFRESMRRRRDLLAEGLRSAGFRVHEPEGTYFITTDISPFGEEDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK E  L  AVER+
Sbjct  341  LPERCGVAAVPVSVFYDDPEAGRSQVRFTFCKREDVLEEAVERL  384



>ref|WP_030827723.1| aminotransferase [Streptomyces sp. NRRL F-2305]
Length=396

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM +RTVT++S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  228  FPGMRDRTVTISSAGKTFSFTGWKVGWITANGPLVSAVRTAKQYLTYVSAGPFQYAIAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  288  LRLPDSYFDGFRADLHRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPFGEKDAHAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P SVFY +P+ G++ VRFTFCK +  L  A +R+
Sbjct  348  LPERCGVVAVPNSVFYDDPDAGRSQVRFTFCKRDDVLHEAADRL  391



>ref|WP_018386236.1| aminotransferase [Streptomyces vitaminophilus]
Length=387

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTV+++S GKTFS TGWK+GW  A   L   +R A  FLT+ +S P QYA A AL
Sbjct  220  PGMRERTVSISSAGKTFSFTGWKVGWVTAASPLVTAVRTAKQFLTYVSSGPFQYAIAEAL  279

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
            R PD Y+   + D   K+ +L DGL+AAGF V+   GTYF+  D  PFG KD  AFC  L
Sbjct  280  RLPDEYFDTFRADLRGKRDLLGDGLRAAGFEVHQPQGTYFITTDIAPFGEKDAYAFCRAL  339

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVAIP SVFY +PE G++ VRF FCK +  L  AV R+
Sbjct  340  PERCGVVAIPNSVFYDDPEAGRSQVRFAFCKRKAVLDEAVARL  382



>ref|WP_009309336.1| aminotransferase [Streptomyces ipomoeae]
 gb|EKX66776.1| aminotransferase [Streptomyces ipomoeae 91-03]
Length=388

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A   L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVTIGSAGKTFSFTGWKVGWVTASGPLVAAVRTAKQYLTYVSAGPFQYAIAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+   + D   K+ +L DGL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  280  LRLPDSYFDGFRDDLRRKRDLLGDGLRAAGFEVYEPEGTYFITTDITPFGEKDAYAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTL  284
            L +  GVVAIP SVFY +P+ G++ VRFTFCK +  L
Sbjct  340  LPERCGVVAIPNSVFYDDPDAGRSQVRFTFCKKDDVL  376



>ref|WP_006126313.1| MULTISPECIES: aminotransferase [Streptomyces]
 gb|EFE76311.1| aminotransferase [Streptomyces roseosporus NRRL 15998]
 gb|ESU49530.1| aminotransferase [Streptomyces sp. HCCB10043]
 gb|EWS93291.1| aminotransferase [Streptomyces roseosporus NRRL 11379]
Length=402

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWKIGW      L   +R A  +LTF +  P QYA A A
Sbjct  236  LPGMRERTVSISSSGKTFSYTGWKIGWVTGDAPLVAAVRAAKQYLTFVSGGPFQYAIAEA  295

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+++   + D   K+ +L +GL+ AGF VY   GTYF+  D +PFG +D  AFC  
Sbjct  296  LALPDAFFTGFREDMRRKRDLLAEGLRTAGFRVYEPEGTYFITTDISPFGDEDAYAFCRA  355

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK E+ LR AVER+
Sbjct  356  LPERCGVAAVPNSVFYDDPEAGRSQVRFTFCKREEVLRKAVERL  399



>ref|WP_018845927.1| aminotransferase [Streptomyces sp. CNT372]
Length=393

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM +RTV+++S GKTFS TGWK+GW  A P L   +R A  +LTF ++ P QYA A A
Sbjct  225  LPGMRDRTVSISSAGKTFSFTGWKVGWVTAAPALVAAVRAAKQYLTFVSAGPFQYAIAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y   ++ +  A + +L DGL  AGF VY   GTYFV  D  P G KD  AFC  
Sbjct  285  LRLPDTYVTGVREELRAGRDLLADGLAEAGFRVYRPQGTYFVTADIAPLGEKDGTAFCLS  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY +PE G+ LVRF FCK    L+ AV+R+
Sbjct  345  LPERCGVVAVPNAVFYDDPEAGRTLVRFAFCKRRPVLQEAVDRL  388



>ref|WP_037933570.1| aminotransferase [Streptomyces toyocaensis]
 gb|KES06319.1| aminotransferase [Streptomyces toyocaensis]
Length=397

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  +LT+ +++P QYA A A
Sbjct  228  LPGMRERTVTISSAGKTFSFTGWKVGWVTASPELVTAVRSAKQYLTYVSASPFQYAIAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+  L+ D  AK+ +L  GL+ AG TVY  SGTYFV  D  P G  D VAFC  
Sbjct  288  LALPDSYFTGLRADLRAKRDVLAAGLEDAGLTVYRPSGTYFVTADIRPLGETDGVAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIPT+VFY + E G   VRF FCK    L  A  R+
Sbjct  348  LPERAGVVAIPTAVFYDHREMGAPFVRFAFCKKRSVLEEAARRL  391



>ref|WP_032772659.1| aminotransferase [Streptomyces cyaneofuscatus]
Length=388

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKT+S TGWKIGW      L   +R A  +LTF +  P+QYA A A
Sbjct  221  LPGMRERTVSISSAGKTYSYTGWKIGWVTGDAPLVTAVRSAKQYLTFVSGGPLQYAIAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+++ E +     K+ +L +GL++AGF VY   GTYFV  D +PFG +D  AFC  
Sbjct  281  LQLPDTFFTEFRASMHRKRDLLAEGLRSAGFRVYEPEGTYFVTTDISPFGEEDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK E  L  AVER+
Sbjct  341  LPERCGVAAVPVSVFYDDPEAGRSQVRFTFCKREDVLEEAVERL  384



>ref|WP_030274595.1| aminotransferase [Streptomyces sp. NRRL B-24484]
Length=386

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWVTGAPELVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD ++   + D   K+ +L DGL  AGF V+   GTYF+  D TP G KD   FC  
Sbjct  280  LRLPDDHFDGFRADLLRKRDLLADGLAGAGFRVFVPEGTYFITTDITPLGEKDGAEFCRS  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY N ++G+ LVRFTFCK ++ LR AV R+
Sbjct  340  LPGRCGVVAIPNAVFYDNADEGRPLVRFTFCKRDEVLREAVARL  383



>ref|WP_043463625.1| aminotransferase [Streptomyces fradiae]
Length=390

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW   PP L   +R A  +LT+ ++ P QYA A A
Sbjct  221  FPGMRERTVTIGSAGKTFSFTGWKVGWVTGPPELVTAVRSAKQYLTYVSAGPFQYAVAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P SY+  L+ D  AK+ +L DGL  AGFTVY  +GTYF+  D  P G  D  AFC  
Sbjct  281  LRLPRSYFDGLRDDLRAKRDLLGDGLAKAGFTVYRPAGTYFITTDIRPLGFDDGFAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E+G   VRF FCK  + L  A ER+
Sbjct  341  LPERCGVVAIPNAVFYDHREEGAPFVRFAFCKRTEVLAEAAERL  384



>gb|KDS87996.1| aminotransferase [Streptomyces fradiae]
Length=393

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW   PP L   +R A  +LT+ ++ P QYA A A
Sbjct  224  FPGMRERTVTIGSAGKTFSFTGWKVGWVTGPPELVTAVRSAKQYLTYVSAGPFQYAVAEA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P SY+  L+ D  AK+ +L DGL  AGFTVY  +GTYF+  D  P G  D  AFC  
Sbjct  284  LRLPRSYFDGLRDDLRAKRDLLGDGLAKAGFTVYRPAGTYFITTDIRPLGFDDGFAFCRA  343

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E+G   VRF FCK  + L  A ER+
Sbjct  344  LPERCGVVAIPNAVFYDHREEGAPFVRFAFCKRTEVLAEAAERL  387



>ref|WP_030747570.1| aminotransferase [Streptomyces griseus]
Length=395

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKT+S TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  228  LPGMRERTVTIGSAGKTYSFTGWKVGWTTASPELTAAVRSAKQFLTYVSSGPFQYAIAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY  L+ D  AK+ +L +GL  AGF V+   GTYFV  D  P G  D  AFC  
Sbjct  288  LRLPDAYYEGLRADLQAKRDLLSEGLAQAGFEVHRPRGTYFVTTDVRPLGSADGFAFCRS  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK    L+ AV+R+
Sbjct  348  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKRTDVLQEAVDRL  391



>ref|WP_016906034.1| aminotransferase [Streptomyces xiaopingdaonensis]
Length=397

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S+TGWK+GW  + P L   +R A  FLT+ ++ P QYA A A
Sbjct  230  LPGMRERTVTISSAGKTWSVTGWKVGWVTSTPELVTAVRSAKQFLTYVSAGPFQYAVAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY +L+ D  AK+ +L  GL  AGF V+PS+GTYFV  D  P G  D  AFC  
Sbjct  290  LRLPDAYYHDLRDDLRAKRDLLSRGLADAGFRVFPSAGTYFVTTDIRPLGESDGPAFCLA  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P  VFY + E+G   VRF FCK  + L  A ER+
Sbjct  350  LPERCGVVAVPNQVFYDHAEEGAPYVRFAFCKQREVLEEASERL  393



>ref|WP_026241844.1| aminotransferase [Streptomyces sp. ScaeMP-e10]
Length=386

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKT+S TGWKIGW      L   +R A  +LTF +  P+QYA A A
Sbjct  220  LPGMRERTVSISSAGKTYSYTGWKIGWVTGDAPLVTAVRSAKQYLTFVSGGPLQYAIAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+++ E +     K+ +L +GL++AGF VY   GTYF+  D +PFG +D  AFC  
Sbjct  280  LQLPDTFFTEFRASMHRKRDLLAEGLRSAGFRVYEPEGTYFITTDISPFGEEDAYAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK E  L  AVER+
Sbjct  340  LPERCGVAAVPVSVFYDDPEAGRSQVRFTFCKREDVLEEAVERL  383



>ref|WP_023547956.1| aminotransferase [Streptomyces roseochromogenus]
 gb|EST29639.1| aminotransferase [Streptomyces roseochromogenes subsp. oscitans 
DS 12.976]
Length=397

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  228  FPGMRERTVTIGSAGKTFSFTGWKVGWVTATPELVTAVRSVKQFLTYVSSGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ E +R   A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  288  LALPDSYFEEFRRSMLARRDILAEGLTAAGFQVFRPAGTYFITTDIRPLGEKDGFAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK +  L++A ER+
Sbjct  348  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKRKDVLQAATERL  391



>ref|WP_037793153.1| aminotransferase [Streptomyces sp. Mg1]
Length=392

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S TGWK+GW  + P L   +R    FLT+ +S P QYA A A
Sbjct  225  LPGMRERTVTISSAGKTYSFTGWKVGWITSTPELVTAVRSVKQFLTYVSSGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D +AK+ +L DGL AAGF VY   GTYFV  D  P G  D +AFC  
Sbjct  285  LGLPDSYYEGLRADLAAKRDLLSDGLAAAGFQVYRPQGTYFVTTDIAPLGESDGIAFCRA  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK  + LR AV+R+
Sbjct  345  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKKTEVLREAVDRL  388



>ref|WP_039820259.1| aminotransferase [Streptomyces xinghaiensis]
Length=389

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW   PP L   +R A  +LT+ ++ P QYA A A
Sbjct  221  FPGMRERTVTIGSAGKTFSFTGWKVGWVTGPPELVTAVRSAKQYLTYVSAGPFQYAVAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P SY+  L+ D   K+ +L DGL  AGFTVY  +GTYF+  D  P G  D  AFC  
Sbjct  281  LRLPRSYFDGLRDDLRTKRDLLGDGLAKAGFTVYRPAGTYFITTDIRPLGFDDGFAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E+G   VRF FCK  + L  AVER+
Sbjct  341  LPERCGVVAIPNAVFYDHREEGAPFVRFAFCKRTEVLAEAVERL  384



>ref|WP_030634727.1| aminotransferase [Streptomyces flavovirens]
Length=392

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFSLTGWKIGW  A P L   +R A  FLT+ +  P+QYA A A
Sbjct  223  LPGMRERTVTVSSAGKTFSLTGWKIGWITASPELVTAVRSAKQFLTYVSGGPLQYAVADA  282

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+  L+ D  AK+ +L  GL  AGF VY  +GTYFV  D  P G  D  AFC  
Sbjct  283  LRLPDSYFDGLREDLRAKRDLLSAGLTEAGFEVYEPAGTYFVTTDIRPLGETDGFAFCRA  342

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY + E G   VRF FCK    L  AV R+
Sbjct  343  LPERCGVVAVPNAVFYDHREQGAPFVRFAFCKRTDVLTEAVSRL  386



>gb|EDX24378.1| aminotransferase [Streptomyces sp. Mg1]
Length=395

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S TGWK+GW  + P L   +R    FLT+ +S P QYA A A
Sbjct  228  LPGMRERTVTISSAGKTYSFTGWKVGWITSTPELVTAVRSVKQFLTYVSSGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSYY  L+ D +AK+ +L DGL AAGF VY   GTYFV  D  P G  D +AFC  
Sbjct  288  LGLPDSYYEGLRADLAAKRDLLSDGLAAAGFQVYRPQGTYFVTTDIAPLGESDGIAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK  + LR AV+R+
Sbjct  348  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKKTEVLREAVDRL  391



>ref|WP_030997379.1| aminotransferase [Streptomyces sp. NRRL F-5630]
Length=388

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GWA A P L   +R A  +LTF ++ P+QYA A A
Sbjct  220  LPGMRERTVSISSAGKTFSFTGWKVGWATASPPLIAAVRTAKQYLTFVSAGPLQYAIAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+Y+   + D   K+ +L DGL+ AGF VY   GTYF+  D TP G KD   FC  
Sbjct  280  LCLPDTYFDTFREDLHRKRDLLADGLRTAGFEVYTPQGTYFLTTDITPLGEKDAYNFCRS  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVA+P SVFY +PE G + VRFTFCK +  L  A  ++
Sbjct  340  LPTRCGVVAVPNSVFYDDPEQGHSQVRFTFCKKDDILHEAARQL  383



>ref|WP_015794539.1| aminotransferase [Catenulispora acidiphila]
 gb|ACU74810.1| aminotransferase class I and II [Catenulispora acidiphila DSM 
44928]
Length=387

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  APP L   +R A  FLT+  S P QYAAATA
Sbjct  219  LPGMRERTVTIGSAGKTFSFTGWKVGWVTAPPALVSAVRSAKQFLTYVASGPFQYAAATA  278

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+Y+  L+ D   K+ +L DGL AAGF V+   GTYF+  D +    K  + FC  
Sbjct  279  LALPDAYFSTLRTDLERKRDLLADGLTAAGFEVFRPDGTYFITTDISALTPKGGMDFCRE  338

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY + E  ++LVRF FCK ++ L  AVER+
Sbjct  339  LPERCGVVAIPNQVFYDDTEAARSLVRFAFCKKDEVLTEAVERL  382



>ref|WP_042371624.1| aminotransferase [Streptacidiphilus neutrinimicus]
Length=389

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV ++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  221  FPGMRERTVCVSSAGKTFSFTGWKVGWVTGTPELVTAVRAAKQYLTYVSAGPFQYAVADA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+ + + D   K+ +L  GL+AAGF VY   GTYF+  D  PFG  D  AFC  
Sbjct  281  LRLPDSYFADFRADLQRKRDLLASGLRAAGFEVYEPQGTYFITTDIAPFGETDAYAFCRE  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP SVFY + E G   VRFTFCK +  L+ AV R+
Sbjct  341  LPARCGVVAIPNSVFYDDKEAGATQVRFTFCKRDSVLQEAVSRL  384



>ref|WP_037658395.1| aminotransferase [Streptomyces griseofuscus]
Length=394

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ +S P QYA A A
Sbjct  228  FPGMRERTVTIGSAGKTFSFTGWKVGWVTAAPALVSAVRAAKQFLTYVSSGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  P+SYY + +R    ++ IL  GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  288  LALPESYYDDFRRSMRERRDILSAGLTAAGFEVFEPAGTYFITTDIRPLGEKDGFAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E  LR A ER+
Sbjct  348  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREDVLREAAERL  391



>ref|WP_033250459.1| aminotransferase [Kitasatospora phosalacinea]
Length=389

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV ++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVAISSAGKTFSFTGWKVGWVTGTPELVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSYY + + D   K+ +LV GL AAGF  +   GTYFV  D TP G KD + FC  
Sbjct  280  LRLPDSYYADFRADLHRKRDLLVGGLTAAGFRAFEPQGTYFVTTDITPLGEKDGLEFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G++ VRF FCK  + L  AV R+
Sbjct  340  LPERCGVVAIPNAVFYDDAEAGRSQVRFAFCKRVEVLEEAVSRL  383



>ref|WP_028421112.1| aminotransferase [Streptomyces sp. GXT6]
Length=397

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  228  LPGMRERTVTISSSGKTFSFTGWKVGWVTAAPALVAAVRSAKQFLTYVSAGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+  L+ D  AK+ +L  GL  AGF V+  +GTYF+  D  P G  D  AFC  
Sbjct  288  LNLPDSYFTALREDLRAKRDLLAAGLVEAGFEVFRPAGTYFITTDIRPLGESDGFAFCRS  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E+G   VRF FCK  +TLR A +R+
Sbjct  348  LPERAGVVAIPNAVFYDHREEGAPFVRFAFCKQPETLREAGKRL  391



>ref|WP_030323594.1| aminotransferase [Streptomyces flavochromogenes]
Length=392

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  225  LPGMRERTVTIGSAGKTFSFTGWKVGWITASPELTSAVRSAKQFLTYVSSGPFQYAIAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P +Y+  L+ + SAK+ +L +GL  AGF VY  +GTYFV  D  P G +D  AFC  
Sbjct  285  LRLPATYFDTLRTELSAKRDLLSEGLAQAGFAVYKPAGTYFVTTDIRPLGAEDGFAFCRS  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L  AV R+
Sbjct  345  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKKTEVLEEAVSRL  388



>ref|WP_030648267.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=397

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTV++ S GKTFS TGWK+GW  A P L   +R    FLT+ +S P QYA A A
Sbjct  231  FPGMRERTVSIGSAGKTFSFTGWKVGWVTAAPELVSAVRAVKQFLTYVSSGPFQYAVAEA  290

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ E +R   A++ IL +GL AAGF V+  +GTYF+  D  P G KD  AFC  
Sbjct  291  LALPDSYFEEFRRGMLARREILAEGLTAAGFEVFRPAGTYFITTDIRPLGEKDGFAFCRA  350

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK E  L  A ER+
Sbjct  351  LPERAGVVAIPNAVFYDDREAGAPFVRFAFCKREDVLSEAAERL  394



>ref|WP_020119254.1| aminotransferase [Streptomyces canus]
Length=400

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  APP L   IR A  FLT+ +S P QYA A A
Sbjct  231  FPGMRERTVTIGSAGKTFSFTGWKVGWITAPPALVSAIRSAKQFLTYVSSGPFQYAVAEA  290

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+   + D  AK+ +L  GL+ AGFTV+  +GTYF+  D  P G  D  AFC  
Sbjct  291  LALPDSYFTAFREDMRAKRDLLASGLEEAGFTVFKPAGTYFITTDIRPLGESDGFAFCRA  350

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E+G   VRF FCK    L  A +R+
Sbjct  351  LPERAGVVAIPNAVFYDHREEGAPFVRFAFCKQTGVLTDAADRL  394



>ref|WP_037829608.1| aminotransferase [Streptomyces sp. NRRL S-325]
Length=392

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 103/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFSLTGWKIGW  A P L   +R A  FLT+ +  P QYA A A
Sbjct  223  FPGMRERTVTISSAGKTFSLTGWKIGWITASPELVTAVRSAKQFLTYVSGGPFQYAVADA  282

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+  L+ D  AK+ +L  GL  AGF VY  +GTYFV  D  P G+ D  AFC  
Sbjct  283  LRLPDSYFDALREDLRAKRDLLTAGLTEAGFEVYEPAGTYFVTTDIRPLGVTDGFAFCRA  342

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY + E G   VRF FCK    L  AV R+
Sbjct  343  LPERCGVVAVPNAVFYDHREQGAPFVRFAFCKRTDVLTEAVSRL  386



>ref|WP_006604641.1| aminotransferase [Streptomyces auratus]
 gb|EJJ06164.1| aminotransferase [Streptomyces auratus AGR0001]
Length=392

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+ ++ P QYA A A
Sbjct  226  FPGMRERTVTISSAGKTFSFTGWKVGWVTAPPELISAVRSAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD Y+  L+ D  AK+ +L  GL  AGF VY SSGTYF+  D  P G  D  AFC  
Sbjct  286  LALPDGYFTGLRDDLRAKRDVLAHGLSEAGFRVYRSSGTYFITTDIRPLGHDDGFAFCRA  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + + G   VRF FCK  + L+ A +R+
Sbjct  346  LPERAGVVAIPNAVFYDHKDAGAPFVRFAFCKSPEVLQEAADRL  389



>ref|WP_037839822.1| aminotransferase [Streptomyces sp. NRRL S-1813]
Length=393

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+ ++ P QYA A A
Sbjct  226  FPGMRERTVTIGSAGKTFSFTGWKVGWVTAIPELVTAVRAAKQFLTYVSAGPFQYAVAEA  285

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+ EL+ D  +K+ +L  GL  AGFTV+  SGTYF+  D  P G  D  AFC  
Sbjct  286  LALPDSYFNELRNDLRSKRDLLATGLADAGFTVFRPSGTYFITTDIRPLGFDDGFAFCRT  345

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L + VGVVAIP +VFY + + G   VRF FCK E+ L+ A  R+
Sbjct  346  LPERVGVVAIPNAVFYDHKDQGAPYVRFAFCKQEKVLQEATARL  389



>ref|WP_012827663.1| aminotransferase [Haliangium ochraceum]
 ref|YP_003266948.1| class I and II aminotransferase [Haliangium ochraceum DSM 14365]
 gb|ACY15055.1| aminotransferase class I and II [Haliangium ochraceum DSM 14365]
Length=389

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV ++SLGK+FSLTGWKIG   A P LT  +R AH F+TF   +P+Q AAA A
Sbjct  221  LPGMRERTVQISSLGKSFSLTGWKIGHTCASPPLTRALRTAHQFITFCNGSPLQVAAAVA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
              APDSY+ EL RDY  ++  L  GL   GF V P +GTYFV  D  P G  DDVAFC  
Sbjct  281  YAAPDSYFDELSRDYRIRRDRLCAGLADIGFEVLPPAGTYFVQTDIRPLGYDDDVAFCRM  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L ++VGV AIPTS FY N + GK+LVR+ FCK    + +A+ER+
Sbjct  341  LPEQVGVAAIPTSAFYANKQHGKHLVRWAFCKTLPIIDAALERL  384



>ref|WP_008747039.1| aminotransferase [Streptomyces sp. SPB74]
 gb|EFG65028.1| aminotransferase, class I [Streptomyces sp. SPB74]
Length=396

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERT T++S GKTFSLTGWK+GW   P  L   +R    +LTF ++ P QYA A A
Sbjct  227  LPGMRERTATISSSGKTFSLTGWKVGWVTGPAALVTAVRTVKQYLTFVSAGPFQYAVAAA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGL-KDDVAFCE  398
            L  PD+YY   + D   K+ +L DGL  AGF V+   GTYFV  D TP GL  D  AFC 
Sbjct  287  LNLPDTYYDGFREDLRRKRDLLCDGLADAGFEVFRPQGTYFVTSDITPLGLGADGTAFCL  346

Query  397  YLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             L +  GVVA+P +VFY +PE G++LVRF FCK E  LR AV R+
Sbjct  347  ALPERCGVVAVPDAVFYDDPEAGRSLVRFAFCKREDVLREAVGRL  391



>gb|EPX56688.1| Aspartate aminotransferase [Cystobacter fuscus DSM 2262]
Length=388

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 112/167 (67%), Gaps = 4/167 (2%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LP + +RTVT++S GKTFSLTGWK+GW IAPP L   +R+AH F+TFAT+TP+Q A A A
Sbjct  215  LPVLADRTVTVSSGGKTFSLTGWKVGWFIAPPALNDAVRRAHQFVTFATATPLQVAMAAA  274

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+ EL R Y A++  L+ GL  AG  V+   G+YF++ D +  G  DDVAFC +
Sbjct  275  LRLPDSYFQELSRAYHARRERLLAGLTRAGLEVHSPEGSYFILADISGQGHGDDVAFCRH  334

Query  394  LIKEVGVVAIPTSVFYLNPED---GKNLVRFTFCKDEQTLRSAVERM  263
            L+  VGV AIP SVFY  PE    G+   RF FCK +  L  A  R+
Sbjct  335  LVTHVGVAAIPPSVFY-GPEHRHLGRGFARFAFCKTDAVLDEAARRL  380



>ref|WP_028457816.1| aminotransferase [Chloroflexus sp. Y-396-1]
Length=396

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 2/166 (1%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM+ERT+T+NSLGKTFSLTGWKIG+A+ P  L   +R AH ++TFAT+TP+QYAAA A
Sbjct  224  LPGMWERTLTINSLGKTFSLTGWKIGYAVGPATLIAALRAAHQWITFATATPLQYAAAVA  283

Query  574  LRA--PDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFC  401
            L     + YY   + +Y+A+  +L + L +AG  V P+ G+YF++ D TP G +DDV FC
Sbjct  284  LEGALQNGYYDRFRAEYTARYRLLEEILSSAGLPVLPTEGSYFLMADITPTGFRDDVTFC  343

Query  400  EYLIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             YL  EVGV AIP S FY        L RF F K E+TLR+A +R+
Sbjct  344  RYLTTEVGVAAIPPSAFYARQTGLPLLARFCFAKREETLRAAQQRL  389



>ref|WP_030647959.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=396

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKTFS TGWK+GW  APP L   +R A  FLT+  S P QYA A A
Sbjct  230  FPGMRERTVTISSAGKTFSFTGWKVGWLTAPPELVSAVRSAKQFLTYVASGPFQYAIAQA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L+ PD+YY   + D +AK+ IL DGL +AGF V+   GTYF+  D TP G KD +AFC  
Sbjct  290  LQLPDAYYEGFRADLAAKRDILADGLVSAGFEVFRPQGTYFITTDITPLGEKDGLAFCRA  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK    L  A +R+
Sbjct  350  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKKTPVLEEAADRL  393



>ref|WP_043434361.1| aminotransferase [Cystobacter fuscus]
Length=397

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 112/167 (67%), Gaps = 4/167 (2%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LP + +RTVT++S GKTFSLTGWK+GW IAPP L   +R+AH F+TFAT+TP+Q A A A
Sbjct  224  LPVLADRTVTVSSGGKTFSLTGWKVGWFIAPPALNDAVRRAHQFVTFATATPLQVAMAAA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+ EL R Y A++  L+ GL  AG  V+   G+YF++ D +  G  DDVAFC +
Sbjct  284  LRLPDSYFQELSRAYHARRERLLAGLTRAGLEVHSPEGSYFILADISGQGHGDDVAFCRH  343

Query  394  LIKEVGVVAIPTSVFYLNPED---GKNLVRFTFCKDEQTLRSAVERM  263
            L+  VGV AIP SVFY  PE    G+   RF FCK +  L  A  R+
Sbjct  344  LVTHVGVAAIPPSVFY-GPEHRHLGRGFARFAFCKTDAVLDEAARRL  389



>ref|WP_030553179.1| aminotransferase [Streptomyces exfoliatus]
Length=392

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  225  LPGMRERTVTIGSAGKTFSFTGWKVGWITASPELTSAVRSAKQFLTYVSSGPFQYAIAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P +Y+  L+ D  AK+ +L +GL  AGF VY  +GTYFV  D  P G +D  AFC  
Sbjct  285  LRLPATYFDTLRADLQAKRDLLSEGLAQAGFEVYRPAGTYFVTTDIRPLGDEDGFAFCRS  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L  AV R+
Sbjct  345  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKKTEVLEEAVSRL  388



>ref|WP_039650621.1| MULTISPECIES: aminotransferase [Streptomyces]
 gb|KHL03036.1| aminotransferase [Streptomyces pluripotens]
 gb|KIE27712.1| aminotransferase [Streptomyces sp. MUSC 125]
 gb|KIE36321.1| aminotransferase [Streptomyces pluripotens]
Length=389

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S  KTFS TGWK+GWA A P L   +R A  FLT+ +S P QYA A A
Sbjct  220  LPGMRERTVTISSAAKTFSFTGWKVGWATATPELITAVRSAKQFLTYVSSGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+   ++D  AK+ +L  GLK AGF VY ++GTYF+  D  P G  D  AFC  
Sbjct  280  LALPDSYFETFRQDMRAKRDVLTAGLKEAGFQVYDTAGTYFITTDIRPLGETDGFAFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L  A ER+
Sbjct  340  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKRVEVLADATERL  383



>ref|WP_030690805.1| aminotransferase [Streptomyces globisporus]
Length=400

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  233  LPGMRERTVTIGSSGKTFSFTGWKVGWITASPELTSAVRSAKQFLTYVSSGPFQYAIAEA  292

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P +Y+  L+ D  AK+ +L +GL  AGF VY  +GTYFV  D  P G  D  AFC  
Sbjct  293  LRLPAAYFDGLRADLRAKRDLLSEGLVQAGFEVYRPAGTYFVTTDIRPLGATDGFAFCRS  352

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E+G   VRF FCK  + L  AV R+
Sbjct  353  LPERAGVVAIPNAVFYDHREEGAPFVRFAFCKKTEVLEEAVSRL  396



>ref|WP_031008729.1| aminotransferase [Streptomyces sp. NRRL F-5727]
Length=397

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM +RTVT+ S GKT+S TGWK+GW  A P LT  +R A  FLT+ +S P QYA A A
Sbjct  230  LPGMRDRTVTIGSAGKTYSFTGWKVGWTTASPELTATVRAAKQFLTYVSSGPFQYAVAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P +YY  L+ D  AK+ +L DGL  AGF VY   GTYFV  D  P G  D  AFC  
Sbjct  290  LRLPAAYYDGLRADLQAKRDLLSDGLAEAGFEVYRPQGTYFVTTDIRPLGEGDGFAFCRS  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY + E G   VRF FCK  + L+ AV+R+
Sbjct  350  LPERAGVVAIPNAVFYDHREAGAPFVRFAFCKRTEVLQEAVDRL  393



>ref|WP_043915295.1| aminotransferase [Kitasatospora griseola]
 gb|KIQ62971.1| aminotransferase [Kitasatospora griseola]
Length=386

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV ++S GKTFS TGWK+GW    P L   +R A  +LT+ ++ P QYA A A
Sbjct  220  LPGMRERTVAISSAGKTFSFTGWKVGWVTGAPELVAAVRTAKQYLTYVSAGPFQYAVAEA  279

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY E + +   K+ +L  GL  AGF V+   GTYF+  D TP G KD + FC  
Sbjct  280  LRLPDAYYAEFRAELHRKRDLLAAGLTEAGFRVFEPQGTYFITTDITPLGEKDGIEFCRA  339

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L    GVVAIP +VFY   E G   VRF FCK E  LR AVER+
Sbjct  340  LPARCGVVAIPNAVFYDRTEIGLAQVRFAFCKRESVLREAVERL  383



>ref|WP_031509962.1| aminotransferase [Streptomyces megasporus]
Length=403

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM +RTV+++S GKTFS TGWK+GW  A   L   +R A  +LTF ++ P QYA A A
Sbjct  225  LPGMRDRTVSISSAGKTFSFTGWKVGWVTASAPLVTAVRTAKQYLTFVSAGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD Y+   + D  AK+ +LVDGL  AGF V+   GTYFV  D  P G KD +AFC  
Sbjct  285  LRLPDEYFTAFREDLRAKRDLLVDGLAEAGFEVHRPQGTYFVTTDVAPLGEKDGLAFCRS  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VF+ + + G+  VRF FCK E  LR AV R+
Sbjct  345  LPERCGVVAVPNAVFHDDVDAGRTQVRFAFCKREDVLREAVARL  388



>ref|WP_031155146.1| aminotransferase [Streptomyces erythrochromogenes]
Length=395

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT++S GKT+S TGWK+GW  APP L   +R A  FLT+ +S P QYA A A
Sbjct  227  FPGMRERTVTISSAGKTYSFTGWKVGWITAPPELVSAVRSAKQFLTYVSSGPFQYAIAEA  286

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+YY   + D +AK+ IL  GL AAGF V+   GTYF+  D TP G KD +AFC  
Sbjct  287  LHLPDAYYDAFRADLAAKRDILAGGLAAAGFQVFRPRGTYFITTDITPLGEKDGLAFCRA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP  VFY +   G   VR+ FCK    L+ AV+R+
Sbjct  347  LPERCGVVAIPNQVFYDDKSAGATQVRWAFCKRTAVLQEAVDRL  390



>ref|WP_007825090.1| aminotransferase [Streptomyces sp. Tu6071]
 gb|EGJ76315.1| putative aminotransferase, class I [Streptomyces sp. Tu6071]
Length=395

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 1/164 (1%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTV+++S GKTFSLTGWK+GW      L   +R    +LTF ++ P QYA A AL
Sbjct  227  PGMRERTVSISSSGKTFSLTGWKVGWVTGSAALVSAVRTVKQYLTFVSAGPFQYAVAEAL  286

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDD-VAFCEY  395
            R PD+Y+ + + D   K+ +L DGL  AGF V+   GTYFV  D TP GL DD   FC  
Sbjct  287  RLPDAYFDDFREDLRRKRDLLCDGLAEAGFAVHRPQGTYFVTTDITPLGLGDDGTKFCLA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY +P+ G+ LVRF FCK E  LR AV+R+
Sbjct  347  LPERCGVVAVPNAVFYDDPDAGRPLVRFAFCKREDVLREAVDRL  390



>ref|WP_019547998.1| aminotransferase [Streptomyces sulphureus]
Length=397

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT++S GKT+S+TGWK+GW  + P L   +R A  FLT+ ++ P QYA A A
Sbjct  230  LPGMRERTVTISSAGKTWSVTGWKVGWVTSTPALVTAVRSAKQFLTYVSAGPFQYAVAEA  289

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+YY +L+ D  AK+ +L  GL  AGF V+PSSGTYFV  D  P G  D  AFC  
Sbjct  290  LRLPDAYYHDLRDDLRAKRDLLSRGLADAGFRVFPSSGTYFVTTDIRPLGENDGPAFCLA  349

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P  VFY + E+G   VRF FCK  + L  A  R+
Sbjct  350  LPERCGVVAVPNQVFYDHAEEGAPYVRFAFCKQREVLEEASARL  393



>ref|WP_010278847.1| aminotransferase [Streptomyces sp. SA3_actG]
Length=395

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 1/164 (1%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTV+++S GKTFSLTGWK+GW      L   +R    +LTF ++ P QYA A AL
Sbjct  227  PGMRERTVSISSSGKTFSLTGWKVGWVTGSAALVSAVRTVKQYLTFVSAGPFQYAVAEAL  286

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDD-VAFCEY  395
            R PD+Y+ + + D   K+ +L DGL  AGF V+   GTYFV  D TP GL DD   FC  
Sbjct  287  RLPDAYFDDFREDLRRKRDLLCDGLAEAGFAVHRPQGTYFVTTDITPLGLGDDGTKFCLA  346

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY +P+ G+ LVRF FCK E  LR AV+R+
Sbjct  347  LPERCGVVAVPNAVFYDDPDAGRPLVRFAFCKREDVLREAVDRL  390



>ref|WP_030284381.1| aminotransferase [Streptomyces catenulae]
Length=394

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 102/163 (63%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLTF +  P QYA A AL
Sbjct  227  PGMRERTVTIGSAGKTFSFTGWKVGWVTAAPELVAAVRSAKQFLTFTSGGPFQYALAEAL  286

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PD Y+  L  D  AK+ +L DGL+AAGF VY   GTYFV  D  P G  D  AFC  L
Sbjct  287  ALPDGYFTGLLEDLRAKRDLLSDGLRAAGFEVYRPQGTYFVTTDIRPLGHTDGHAFCRAL  346

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVAIP +VFY + + G   VRF FCK  + L+ AV+R+
Sbjct  347  PERAGVVAIPNAVFYDHRDQGAPFVRFAFCKKTEVLQEAVDRL  389



>ref|WP_037795518.1| aminotransferase [Streptomyces sp. CNT360]
Length=406

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 104/163 (64%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GKTFSLTGWK+GW    P L   +R A  +LTF ++ P QYA A AL
Sbjct  241  PGMRERTVTISSSGKTFSLTGWKVGWVTGTPELVTAVRSAKQYLTFVSAGPFQYAVAEAL  300

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PDSYY EL+    A++ +L  GL+ AGF V+  +GTYFV  D  P G  D VAFC  L
Sbjct  301  ALPDSYYTELREGMRARRDLLAAGLRDAGFGVFTPAGTYFVTADIRPLGWSDGVAFCLSL  360

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+PT VFY + E G   VRF FCK E  L  AV R+
Sbjct  361  PERCGVVAVPTQVFYDHAEAGAPYVRFAFCKREDVLSEAVSRL  403



>ref|WP_043393165.1| aminotransferase [Cystobacter violaceus]
 gb|KFA93118.1| aminotransferase [Cystobacter violaceus Cb vi76]
Length=398

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            +P + +RT+T++S GK+FSLTGWKIGW IAPP L   +++AH F+TFAT++P+Q A A A
Sbjct  225  VPSLADRTLTVSSAGKSFSLTGWKIGWVIAPPPLRDAVQRAHQFVTFATASPLQAATAAA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PDSY+ EL   Y +K+  L+ GL  AG   Y   G+YF+I +    G  DDVAFC +
Sbjct  285  LRLPDSYFQELSAMYLSKRDRLLAGLAEAGLEAYAPEGSYFIIANIAGRGFADDVAFCRH  344

Query  394  LIKEVGVVAIPTSVFYLNPED---GKNLVRFTFCKDEQTLRSAVERM  263
            L+ EVGV AIP SVFY +PE    G+ +VRF FCK E  L  AV R+
Sbjct  345  LVTEVGVAAIPPSVFY-SPEHKHLGQGMVRFAFCKTEAVLDEAVRRL  390



>gb|AGS70808.1| aminotransferase [Streptomyces collinus Tu 365]
Length=391

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+  S P QYA A A
Sbjct  225  FPGMRERTVTIGSAGKTFSFTGWKVGWVTAAPGLVTAVRSAKQFLTYVASGPFQYAVAEA  284

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+   +     ++ IL +GL  AGF V+  +GTYF+  D  P G KD +AFC  
Sbjct  285  LTLPDSYFEGFREGMRVRRDILAEGLTGAGFEVFRPAGTYFITTDIRPLGEKDGLAFCRA  344

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY + E G   VRF FCK E+ LR A ER+
Sbjct  345  LPERAGVVAVPNAVFYDDREAGSPFVRFAFCKREEVLREAAERL  388



>ref|WP_030209889.1| aminotransferase [Streptomyces griseoluteus]
Length=401

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTVT+ S GKTFS TGWK+GWA     L   +R A  +LT+ ++ P QYA A A
Sbjct  233  LPGMRERTVTIGSAGKTFSFTGWKVGWATGSRELVTAVRTAKQYLTYVSAGPFQYAIAEA  292

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR P +Y+  L+ D   K+ +L DGL+AAGF VY   GTYF+  D TP G KD  AFC  
Sbjct  293  LRLPAAYFDTLRADLQRKRDLLGDGLRAAGFEVYQPQGTYFITTDITPLGEKDAHAFCCA  352

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP +VFY +P+ G+  VRF FCK +  L  A +R+
Sbjct  353  LPERCGVVAIPNAVFYDDPDAGRTQVRFAFCKKDDVLHEAADRL  396



>ref|WP_030407772.1| MULTISPECIES: aminotransferase [Streptomyces]
Length=400

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GK+FS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A AL
Sbjct  232  PGMRERTVTISSSGKSFSFTGWKVGWVTATPALVTAVRTAKQYLTYVSAGPFQYAVAEAL  291

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PDSYY EL+    A++ +L DGL+ AGF V+  +GTYF+  D  P G  D V+FC  L
Sbjct  292  ALPDSYYTELREGLRARRDLLADGLREAGFGVFTPAGTYFITTDIRPLGTSDGVSFCLSL  351

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+PT VFY + E G   VRF FCK E+ L  AV R+
Sbjct  352  PERAGVVAVPTQVFYDHAEAGAPYVRFAFCKKEEVLTEAVSRL  394



>gb|KFK90027.1| aminotransferase [Streptomyces sp. JS01]
Length=391

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWKIGW      L   +R A  +LTF +  P QYA A A
Sbjct  224  LPGMRERTVSISSSGKTFSYTGWKIGWVTGDAPLVAAVRAAKQYLTFVSGGPFQYAIAEA  283

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+++   + D   K+ +L  GL+AAGF VY   GTYF+  D +PFG +D  AFC  
Sbjct  284  LALPDAFFSGFRADMHRKRDLLAKGLRAAGFRVYEPEGTYFITTDISPFGDEDAYAFCRA  343

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK +  L SAVER+
Sbjct  344  LPERCGVAAVPNSVFYDDPEAGRSQVRFTFCKRDDVLESAVERL  387



>ref|WP_031028283.1| aminotransferase [Streptomyces sp. NRRL F-5639]
Length=400

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GK+FS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A AL
Sbjct  232  PGMRERTVTISSSGKSFSFTGWKVGWVTATPALVTAVRTAKQYLTYVSAGPFQYAVAEAL  291

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PDSYY EL+    A++ +L DGL+ AGF V+  +GTYF+  D  P G  D V+FC  L
Sbjct  292  ALPDSYYTELREGLRARRDLLADGLREAGFGVFTPAGTYFITTDIRPLGTSDGVSFCLSL  351

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+PT VFY + E G   VRF FCK E+ L  AV R+
Sbjct  352  PERAGVVAVPTQVFYDHAEAGAPYVRFAFCKKEEVLTEAVSRL  394



>ref|WP_032782146.1| aminotransferase [Streptomyces sp. JS01]
Length=388

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWKIGW      L   +R A  +LTF +  P QYA A A
Sbjct  221  LPGMRERTVSISSSGKTFSYTGWKIGWVTGDAPLVAAVRAAKQYLTFVSGGPFQYAIAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PD+++   + D   K+ +L  GL+AAGF VY   GTYF+  D +PFG +D  AFC  
Sbjct  281  LALPDAFFSGFRADMHRKRDLLAKGLRAAGFRVYEPEGTYFITTDISPFGDEDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GV A+P SVFY +PE G++ VRFTFCK +  L SAVER+
Sbjct  341  LPERCGVAAVPNSVFYDDPEAGRSQVRFTFCKRDDVLESAVERL  384



>ref|WP_009067064.1| aminotransferase [Streptomyces sp. SPB78]
 gb|EFL00940.1| aminotransferase [Streptomyces sp. SPB78]
Length=389

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
            LPGM ERTV+++S GKTFS TGWK+GW +A   +   +R A  +LT+ ++ P QYA A A
Sbjct  221  LPGMRERTVSISSAGKTFSCTGWKVGWVMADGPIVSAVRTAKQYLTYVSAGPFQYAIAEA  280

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            LR PD+Y+   + +   K+ +L +GL+AAGF VY   GTYF+  D TPFG KD  AFC  
Sbjct  281  LRLPDAYFDGFRANLRRKRDLLGEGLRAAGFEVYQPQGTYFITTDITPFGEKDAYAFCRA  340

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVAIP SVFY +P  G+  VRFTFCK ++ L  A  R+
Sbjct  341  LPERCGVVAIPNSVFYDDPGAGRTQVRFTFCKKDEVLAEATSRL  384



>gb|EPD91143.1| hypothetical protein HMPREF1486_05075 [Streptomyces sp. HPH0547]
Length=397

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  751  PGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATAL  572
            PGM ERTVT++S GK+FS TGWK+GW  A P L   +R A  +LT+ ++ P QYA A AL
Sbjct  229  PGMRERTVTISSSGKSFSFTGWKVGWVTATPALVTAVRTAKQYLTYVSAGPFQYAVAEAL  288

Query  571  RAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEYL  392
              PDSYY EL+    A++ +L DGL+ AGF V+  +GTYF+  D  P G  D V+FC  L
Sbjct  289  ALPDSYYTELREGLRARRDLLADGLREAGFGVFTPAGTYFITTDIRPLGTSDGVSFCLSL  348

Query  391  IKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
             +  GVVA+PT VFY + E G   VRF FCK E+ L  AV R+
Sbjct  349  PERAGVVAVPTQVFYDHAEAGAPYVRFAFCKKEEVLTEAVSRL  391



>ref|WP_043476070.1| aminotransferase [Streptomyces collinus]
Length=394

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = -2

Query  754  LPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGIRQAHSFLTFATSTPMQYAAATA  575
             PGM ERTVT+ S GKTFS TGWK+GW  A P L   +R A  FLT+  S P QYA A A
Sbjct  228  FPGMRERTVTIGSAGKTFSFTGWKVGWVTAAPGLVTAVRSAKQFLTYVASGPFQYAVAEA  287

Query  574  LRAPDSYYVELKRDYSAKKAILVDGLKAAGFTVYPSSGTYFVIVDHTPFGLKDDVAFCEY  395
            L  PDSY+   +     ++ IL +GL  AGF V+  +GTYF+  D  P G KD +AFC  
Sbjct  288  LTLPDSYFEGFREGMRVRRDILAEGLTGAGFEVFRPAGTYFITTDIRPLGEKDGLAFCRA  347

Query  394  LIKEVGVVAIPTSVFYLNPEDGKNLVRFTFCKDEQTLRSAVERM  263
            L +  GVVA+P +VFY + E G   VRF FCK E+ LR A ER+
Sbjct  348  LPERAGVVAVPNAVFYDDREAGSPFVRFAFCKREEVLREAAERL  391



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050