BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016P12

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611045.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    333   9e-109   Nicotiana tomentosiformis
ref|XP_009803786.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    331   3e-108   Nicotiana sylvestris
dbj|BAK32933.1|  mid1-complementing activity 2                          331   3e-108   Nicotiana tabacum [American tobacco]
ref|XP_006343349.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    329   2e-107   Solanum tuberosum [potatoes]
ref|XP_004232512.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    328   4e-107   Solanum lycopersicum
ref|XP_006340771.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    328   5e-107   Solanum tuberosum [potatoes]
ref|XP_009801746.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    328   6e-107   Nicotiana sylvestris
ref|XP_009624357.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    324   2e-105   Nicotiana tomentosiformis
emb|CBI22120.3|  unnamed protein product                                307   3e-100   Vitis vinifera
ref|XP_002272810.2|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    308   3e-99    Vitis vinifera
ref|XP_007046628.1|  PLAC8 family protein                               305   8e-98    
emb|CDP01861.1|  unnamed protein product                                304   9e-98    Coffea canephora [robusta coffee]
ref|XP_006383064.1|  hypothetical protein POPTR_0005s11200g             301   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010113307.1|  hypothetical protein L484_026637                   296   6e-96    
ref|XP_011043148.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    299   8e-96    Populus euphratica
gb|KJB43289.1|  hypothetical protein B456_007G192000                    297   6e-95    Gossypium raimondii
ref|XP_011099884.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    296   9e-95    
gb|KDP23985.1|  hypothetical protein JCGZ_25373                         295   2e-94    Jatropha curcas
gb|KJB17606.1|  hypothetical protein B456_003G007400                    291   1e-92    Gossypium raimondii
ref|XP_010266008.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    289   6e-92    Nelumbo nucifera [Indian lotus]
ref|XP_008448524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    288   2e-91    Cucumis melo [Oriental melon]
ref|XP_008393931.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    287   5e-91    
ref|XP_004146155.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    286   1e-90    Cucumis sativus [cucumbers]
ref|XP_004159726.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...    286   1e-90    
ref|XP_007202160.1|  hypothetical protein PRUPE_ppa006351mg             284   8e-90    Prunus persica
gb|KHG25004.1|  mid1-complementing activity 1 -like protein             283   1e-89    Gossypium arboreum [tree cotton]
ref|XP_009379353.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    283   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_008242040.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    283   2e-89    Prunus mume [ume]
ref|XP_009363461.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    282   4e-89    
ref|XP_006425392.1|  hypothetical protein CICLE_v10025703mg             282   5e-89    
gb|KDO71305.1|  hypothetical protein CISIN_1g014734mg                   282   5e-89    Citrus sinensis [apfelsine]
ref|XP_006466999.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    282   6e-89    Citrus sinensis [apfelsine]
ref|XP_008807147.1|  PREDICTED: cell number regulator 13-like           281   1e-88    Phoenix dactylifera
ref|XP_008809426.1|  PREDICTED: cell number regulator 13-like iso...    280   4e-88    
ref|XP_008352422.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    279   8e-88    Malus domestica [apple tree]
ref|XP_008809427.1|  PREDICTED: cell number regulator 13-like iso...    278   1e-87    
ref|XP_010933352.1|  PREDICTED: cell number regulator 13-like iso...    278   1e-87    Elaeis guineensis
ref|XP_010920111.1|  PREDICTED: cell number regulator 13-like           275   2e-86    Elaeis guineensis
ref|XP_010266845.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    273   1e-85    Nelumbo nucifera [Indian lotus]
ref|XP_010029652.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    273   2e-85    Eucalyptus grandis [rose gum]
ref|XP_010029651.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    273   2e-85    Eucalyptus grandis [rose gum]
ref|XP_010933353.1|  PREDICTED: cell number regulator 13-like iso...    271   3e-85    
ref|XP_004512157.1|  PREDICTED: cell number regulator 13-like iso...    272   4e-85    
ref|XP_006572883.1|  PREDICTED: uncharacterized protein LOC100811...    271   8e-85    
gb|KHN41878.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   273   9e-85    Glycine soja [wild soybean]
ref|XP_007157885.1|  hypothetical protein PHAVU_002G106200g             270   1e-84    Phaseolus vulgaris [French bean]
ref|XP_004287784.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    270   3e-84    Fragaria vesca subsp. vesca
gb|KCW53202.1|  hypothetical protein EUGRSUZ_J02474                     266   6e-84    Eucalyptus grandis [rose gum]
gb|KHN36012.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   268   6e-84    Glycine soja [wild soybean]
ref|XP_010935125.1|  PREDICTED: cell number regulator 13-like           268   1e-83    Elaeis guineensis
ref|XP_003612221.1|  hypothetical protein MTR_5g022670                  268   1e-83    Medicago truncatula
ref|XP_008806599.1|  PREDICTED: cell number regulator 13-like iso...    268   2e-83    
ref|XP_008806598.1|  PREDICTED: cell number regulator 13-like iso...    268   2e-83    
ref|XP_006412042.1|  hypothetical protein EUTSA_v10025310mg             267   3e-83    Eutrema salsugineum [saltwater cress]
ref|XP_004509394.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    266   1e-82    Cicer arietinum [garbanzo]
gb|KCW53201.1|  hypothetical protein EUGRSUZ_J02474                     261   9e-82    Eucalyptus grandis [rose gum]
ref|XP_009386555.1|  PREDICTED: cell number regulator 13-like iso...    262   2e-81    
gb|EYU30814.1|  hypothetical protein MIMGU_mgv1a007258mg                256   5e-79    Erythranthe guttata [common monkey flower]
dbj|BAH20129.1|  AT4G35920                                              254   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418750.1|  PREDICTED: cell number regulator 13-like           254   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75539.1|  BnaA01g01630D                                          254   2e-78    
ref|NP_195317.2|  protein MID1-complementing activity 1                 254   3e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CDX69186.1|  BnaC01g02670D                                          253   6e-78    
ref|XP_010531102.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    253   6e-78    
ref|XP_002867046.1|  hypothetical protein ARALYDRAFT_491044             253   8e-78    
emb|CAA18486.1|  putative protein                                       253   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003629262.1|  Cornifelin                                         252   2e-77    Medicago truncatula
ref|XP_009148721.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    251   3e-77    Brassica rapa
ref|XP_006282626.1|  hypothetical protein CARUB_v10004901mg             251   6e-77    Capsella rubella
gb|KHN35538.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   250   9e-77    Glycine soja [wild soybean]
ref|XP_003548830.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    250   9e-77    Glycine max [soybeans]
ref|XP_006574663.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    250   9e-77    Glycine max [soybeans]
ref|XP_003519857.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    250   9e-77    
ref|XP_010033519.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    251   1e-76    Eucalyptus grandis [rose gum]
ref|NP_001049013.1|  Os03g0157300                                       249   2e-76    
ref|XP_010526810.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    249   2e-76    Tarenaya hassleriana [spider flower]
ref|XP_010446852.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    249   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_006846924.1|  hypothetical protein AMTR_s00152p00084120          248   7e-76    Amborella trichopoda
ref|XP_009138395.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    248   8e-76    Brassica rapa
emb|CDY47043.1|  BnaAnng08310D                                          247   1e-75    Brassica napus [oilseed rape]
ref|XP_010432209.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    247   2e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006649427.1|  PREDICTED: cell number regulator 13-like           246   3e-75    Oryza brachyantha
ref|XP_009408216.1|  PREDICTED: cell number regulator 13-like iso...    246   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX72565.1|  BnaC07g45870D                                          244   2e-74    
ref|XP_007156188.1|  hypothetical protein PHAVU_003G265800g             244   3e-74    Phaseolus vulgaris [French bean]
ref|XP_010113309.1|  hypothetical protein L484_026640                   242   8e-74    
gb|EMS65760.1|  hypothetical protein TRIUR3_02105                       240   1e-73    Triticum urartu
gb|ACN26521.1|  unknown                                                 240   1e-72    Zea mays [maize]
ref|XP_008440854.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    239   1e-72    
ref|XP_010680410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    238   4e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004985646.1|  PREDICTED: cell number regulator 13-like           238   7e-72    Setaria italica
ref|XP_002468480.1|  hypothetical protein SORBIDRAFT_01g046630          237   1e-71    Sorghum bicolor [broomcorn]
ref|XP_003558777.1|  PREDICTED: cell number regulator 13                236   2e-71    Brachypodium distachyon [annual false brome]
ref|NP_001182136.1|  cell number regulator 13                           236   3e-71    Zea mays [maize]
ref|XP_004135021.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    235   5e-71    Cucumis sativus [cucumbers]
ref|XP_006599313.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    234   3e-70    
gb|AAK32909.1|AF367322_1  AT4g35920/F4B14_190                           233   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408218.1|  PREDICTED: cell number regulator 13-like iso...    227   6e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011074700.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    226   1e-67    Sesamum indicum [beniseed]
ref|XP_009408217.1|  PREDICTED: cell number regulator 13-like iso...    226   1e-67    
ref|XP_008809428.1|  PREDICTED: cell number regulator 13-like iso...    225   2e-67    
gb|ABR16594.1|  unknown                                                 224   2e-66    Picea sitchensis
ref|XP_010489415.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    223   4e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010489410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    222   6e-66    Camelina sativa [gold-of-pleasure]
ref|XP_008242042.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    221   1e-65    Prunus mume [ume]
gb|KJB17609.1|  hypothetical protein B456_003G007400                    220   1e-65    Gossypium raimondii
ref|XP_010680412.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    220   2e-65    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006297774.1|  hypothetical protein CARUB_v10013809mg             221   2e-65    Capsella rubella
gb|EYU17580.1|  hypothetical protein MIMGU_mgv1a007522mg                218   1e-64    Erythranthe guttata [common monkey flower]
ref|XP_006409246.1|  hypothetical protein EUTSA_v10023167mg             215   1e-63    
gb|KDO71309.1|  hypothetical protein CISIN_1g014734mg                   214   7e-63    Citrus sinensis [apfelsine]
ref|XP_002886128.1|  hypothetical protein ARALYDRAFT_480672             213   2e-62    
gb|KCW53204.1|  hypothetical protein EUGRSUZ_J02474                     209   3e-62    Eucalyptus grandis [rose gum]
ref|XP_010413502.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    213   3e-62    Camelina sativa [gold-of-pleasure]
gb|KCW56602.1|  hypothetical protein EUGRSUZ_I02323                     213   1e-61    Eucalyptus grandis [rose gum]
ref|NP_001031366.1|  protein MID1-complementing activity 2              211   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467574.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    211   2e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010467573.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    210   2e-61    Camelina sativa [gold-of-pleasure]
pir||D84556  hypothetical protein At2g17780 [imported] - Arabidop...    210   3e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692506.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    210   3e-61    
ref|NP_179369.2|  protein MID1-complementing activity 2                 209   4e-61    Arabidopsis thaliana [mouse-ear cress]
emb|CDY30346.1|  BnaA09g09310D                                          207   3e-60    Brassica napus [oilseed rape]
ref|XP_009112457.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    206   4e-60    
ref|XP_009112455.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    206   6e-60    Brassica rapa
ref|XP_009112456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    206   6e-60    Brassica rapa
ref|XP_011083456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    203   1e-58    Sesamum indicum [beniseed]
ref|XP_004512162.1|  PREDICTED: cell number regulator 13-like iso...    201   3e-58    
ref|NP_001031367.1|  protein MID1-complementing activity 2              201   4e-58    Arabidopsis thaliana [mouse-ear cress]
emb|CDY26830.1|  BnaC09g09570D                                          201   5e-58    Brassica napus [oilseed rape]
ref|XP_009386557.1|  PREDICTED: cell number regulator 13-like iso...    197   1e-56    
gb|AFK40961.1|  unknown                                                 193   5e-55    Lotus japonicus
ref|XP_006574667.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    190   6e-54    
gb|EPS70744.1|  mid1-complementing activity 2                           189   9e-54    Genlisea aurea
gb|EEE65313.1|  hypothetical protein OsJ_20556                          190   3e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386556.1|  PREDICTED: cell number regulator 13-like iso...    170   3e-46    
gb|KDP44714.1|  hypothetical protein JCGZ_01214                         169   5e-46    Jatropha curcas
ref|XP_010087526.1|  hypothetical protein L484_006931                   167   3e-45    Morus notabilis
ref|NP_001242304.1|  uncharacterized protein LOC100811369               167   4e-45    
gb|KHG10652.1|  mid1-complementing activity 1 -like protein             157   8e-42    Gossypium arboreum [tree cotton]
ref|XP_006435802.1|  hypothetical protein CICLE_v10031760mg             155   1e-40    
ref|XP_010067558.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    154   4e-40    
ref|XP_009369211.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    149   6e-40    
ref|XP_006575552.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    149   1e-38    Glycine max [soybeans]
gb|KHN38534.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   149   1e-38    Glycine soja [wild soybean]
ref|XP_007008883.1|  PLAC8 family protein                               147   8e-38    
ref|XP_008234071.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    145   6e-37    
ref|XP_008363765.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...    143   3e-36    
ref|XP_010658231.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    141   3e-35    Vitis vinifera
ref|XP_010658233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    141   3e-35    Vitis vinifera
ref|XP_010658232.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    141   3e-35    Vitis vinifera
ref|XP_007219349.1|  hypothetical protein PRUPE_ppa019431mg             139   2e-34    
ref|XP_002520777.1|  conserved hypothetical protein                     138   2e-34    
ref|XP_003518431.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    138   3e-34    Glycine max [soybeans]
ref|XP_002316192.2|  hypothetical protein POPTR_0010s19210g             136   1e-33    
ref|XP_009386559.1|  PREDICTED: cell number regulator 13-like iso...    134   4e-33    
ref|XP_011035883.1|  PREDICTED: cell number regulator 13-like           134   9e-33    Populus euphratica
ref|XP_004235233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    130   1e-31    Solanum lycopersicum
gb|ACF79860.1|  unknown                                                 119   4e-30    Zea mays [maize]
ref|XP_006356473.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   6e-30    Solanum tuberosum [potatoes]
ref|XP_006356472.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   2e-29    Solanum tuberosum [potatoes]
ref|XP_006599316.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    123   3e-29    
emb|CDP13977.1|  unnamed protein product                                122   8e-29    Coffea canephora [robusta coffee]
ref|XP_002970226.1|  hypothetical protein SELMODRAFT_93428              120   6e-28    
ref|XP_008440857.1|  PREDICTED: cell number regulator 13 isoform X2     118   3e-27    Cucumis melo [Oriental melon]
gb|KGN48940.1|  hypothetical protein Csa_6G507150                       117   3e-27    
ref|XP_001768983.1|  predicted protein                                  107   2e-23    
ref|XP_010658234.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    106   5e-23    
ref|XP_001785848.1|  predicted protein                                  105   1e-22    
ref|XP_002978386.1|  hypothetical protein SELMODRAFT_418221             102   1e-21    
gb|EMT07324.1|  hypothetical protein F775_31025                       60.5    1e-18    
gb|AAM51833.1|AC105730_7  Unknown protein                             58.5    9e-17    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002531154.1|  conserved hypothetical protein                   86.7    1e-16    
emb|CAN71842.1|  hypothetical protein VITISV_036262                   85.9    9e-16    Vitis vinifera
ref|XP_010318233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  83.2    5e-15    
ref|XP_006486524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  82.8    5e-15    
gb|KDO68875.1|  hypothetical protein CISIN_1g020555mg                 81.3    1e-14    Citrus sinensis [apfelsine]
ref|XP_010489416.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  76.3    8e-13    Camelina sativa [gold-of-pleasure]
ref|NP_001031368.1|  protein MID1-complementing activity 2            70.1    1e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009604568.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.1    1e-07    Nicotiana tomentosiformis
ref|XP_011097029.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    60.8    2e-07    Sesamum indicum [beniseed]
ref|XP_008346854.1|  PREDICTED: uncharacterized protein LOC103409845  61.2    2e-07    Malus domestica [apple tree]
ref|XP_010265197.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.8    2e-07    Nelumbo nucifera [Indian lotus]
ref|XP_010265196.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.8    2e-07    Nelumbo nucifera [Indian lotus]
gb|KCW83842.1|  hypothetical protein EUGRSUZ_B00710                   60.8    2e-07    Eucalyptus grandis [rose gum]
ref|XP_010045639.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  60.8    2e-07    Eucalyptus grandis [rose gum]
ref|XP_002964322.1|  hypothetical protein SELMODRAFT_28363            57.4    3e-07    
ref|XP_006485849.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  59.3    7e-07    Citrus sinensis [apfelsine]
gb|EYU36803.1|  hypothetical protein MIMGU_mgv1a011010mg              59.3    7e-07    Erythranthe guttata [common monkey flower]
ref|XP_010465946.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.8    7e-07    Camelina sativa [gold-of-pleasure]
gb|KJB39330.1|  hypothetical protein B456_007G006900                  58.9    9e-07    Gossypium raimondii
ref|XP_006826803.1|  hypothetical protein AMTR_s00010p00033430        57.0    9e-07    
ref|XP_010506915.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.0    1e-06    Camelina sativa [gold-of-pleasure]
ref|XP_009025528.1|  hypothetical protein HELRODRAFT_189206           57.8    1e-06    Helobdella robusta
ref|XP_007036477.1|  PLAC8 family protein                             57.8    1e-06    
ref|XP_009785412.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.4    1e-06    Nicotiana sylvestris
ref|XP_009146119.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.0    1e-06    
ref|XP_007036475.1|  PLAC8 family protein                             58.9    1e-06    
ref|XP_010042703.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  56.6    1e-06    
ref|XP_008244010.1|  PREDICTED: leucine-rich repeat extensin-like...  58.2    2e-06    Prunus mume [ume]
ref|XP_006817786.1|  PREDICTED: cell number regulator 13-like         55.5    2e-06    Saccoglossus kowalevskii
ref|XP_002885257.1|  hypothetical protein ARALYDRAFT_479347           56.2    2e-06    
ref|XP_009339371.1|  PREDICTED: proline-rich proteoglycan 2-like      57.8    2e-06    Pyrus x bretschneideri [bai li]
ref|XP_010489915.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  55.8    2e-06    
ref|XP_006817787.1|  PREDICTED: cell number regulator 11-like         55.1    3e-06    Saccoglossus kowalevskii
ref|XP_006826802.1|  hypothetical protein AMTR_s00010p00032660        57.0    3e-06    
emb|CDX92237.1|  BnaA05g21700D                                        55.5    3e-06    
ref|XP_009339439.1|  PREDICTED: uncharacterized protein LOC103931645  57.8    4e-06    
ref|XP_007036480.1|  PLAC8 family protein                             57.0    4e-06    
ref|XP_010527531.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 12   54.7    5e-06    Tarenaya hassleriana [spider flower]
ref|XP_008244011.1|  PREDICTED: leucine-rich repeat extensin-like...  57.0    5e-06    Prunus mume [ume]
ref|XP_008393299.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  57.0    6e-06    
ref|XP_010663577.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    56.6    6e-06    Vitis vinifera
gb|EJT99228.1|  PLAC8-domain-containing protein                       55.1    9e-06    Dacryopinax primogenitus
ref|XP_009348105.1|  PREDICTED: proline-rich protein HaeIII subfa...  55.8    1e-05    Pyrus x bretschneideri [bai li]
ref|XP_006393318.1|  hypothetical protein EUTSA_v10011755mg           54.7    2e-05    Eutrema salsugineum [saltwater cress]
ref|XP_006826804.1|  hypothetical protein AMTR_s00010p00034340        53.9    2e-05    
ref|XP_002318695.2|  hypothetical protein POPTR_0012s09370g           53.5    2e-05    
ref|XP_006469221.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  53.5    2e-05    Citrus sinensis [apfelsine]
ref|XP_007210160.1|  hypothetical protein PRUPE_ppa021734mg           55.1    2e-05    
gb|KJB37241.1|  hypothetical protein B456_006G195300                  54.7    2e-05    Gossypium raimondii
ref|XP_008346788.1|  PREDICTED: proline-rich protein HaeIII subfa...  55.1    2e-05    Malus domestica [apple tree]
ref|XP_007036476.1|  PLAC8 family protein                             54.7    3e-05    
gb|KJB12064.1|  hypothetical protein B456_002G175600                  52.8    3e-05    Gossypium raimondii
ref|XP_006857399.1|  hypothetical protein AMTR_s00067p00142050        52.4    3e-05    Amborella trichopoda
gb|KDO38128.1|  hypothetical protein CISIN_1g031916mg                 52.8    3e-05    Citrus sinensis [apfelsine]
ref|XP_008244012.1|  PREDICTED: proline-rich protein 2-like           54.7    3e-05    Prunus mume [ume]
emb|CDP00820.1|  unnamed protein product                              52.8    3e-05    Coffea canephora [robusta coffee]
ref|XP_004297458.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  53.1    3e-05    Fragaria vesca subsp. vesca
ref|XP_007160407.1|  hypothetical protein PHAVU_002G319200g           52.4    3e-05    Phaseolus vulgaris [French bean]
ref|XP_006448197.1|  hypothetical protein CICLE_v10016920mg           52.4    4e-05    
ref|XP_010066569.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2    52.8    4e-05    Eucalyptus grandis [rose gum]
ref|XP_006448196.1|  hypothetical protein CICLE_v10016920mg           52.4    4e-05    Citrus clementina [clementine]
ref|XP_009009567.1|  hypothetical protein HELRODRAFT_184849           51.2    4e-05    Helobdella robusta
ref|XP_011016153.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  52.4    5e-05    Populus euphratica
ref|XP_009346952.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.6    5e-05    
gb|AFM43805.1|  fruit weight 2.2-2 protein                            52.0    6e-05    Dimocarpus longan [longan]
gb|KCW64493.1|  hypothetical protein EUGRSUZ_G02100                   53.1    6e-05    Eucalyptus grandis [rose gum]
ref|NP_188474.1|  PLAC8 family protein                                52.4    6e-05    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527777.1|  conserved hypothetical protein                   52.4    7e-05    Ricinus communis
ref|XP_007046277.1|  PLAC8 family protein, putative                   51.6    7e-05    
ref|XP_004297457.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    8e-05    Fragaria vesca subsp. vesca
ref|XP_001756741.1|  predicted protein                                50.4    9e-05    
ref|XP_006362555.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    9e-05    Solanum tuberosum [potatoes]
ref|XP_010068707.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    9e-05    
ref|XP_010265361.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  52.4    9e-05    Nelumbo nucifera [Indian lotus]
gb|KCW64542.1|  hypothetical protein EUGRSUZ_G02148                   51.2    9e-05    Eucalyptus grandis [rose gum]
ref|XP_004298295.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    1e-04    Fragaria vesca subsp. vesca
ref|XP_004294815.1|  PREDICTED: cell number regulator 2-like          51.6    1e-04    Fragaria vesca subsp. vesca
ref|XP_004294816.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.6    1e-04    Fragaria vesca subsp. vesca
ref|XP_007047233.1|  Plant cadmium resistance 2                       51.6    1e-04    
ref|XP_006965746.1|  predicted protein                                50.4    1e-04    Trichoderma reesei QM6a
ref|XP_002281039.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2    50.8    1e-04    Vitis vinifera
ref|XP_006352289.1|  PREDICTED: cell number regulator 1-like          51.6    1e-04    
ref|XP_003382500.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    2e-04    Amphimedon queenslandica
ref|XP_011465683.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    2e-04    Fragaria vesca subsp. vesca
ref|NP_680337.2|  PLAC8 family protein                                50.1    2e-04    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644037.1|  PREDICTED: cell number regulator 5-like          50.8    2e-04    Oryza brachyantha
ref|XP_010070341.1|  PREDICTED: cell number regulator 2-like          50.4    2e-04    Eucalyptus grandis [rose gum]
ref|XP_011448416.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    2e-04    Crassostrea gigas
ref|XP_006362573.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    2e-04    Solanum tuberosum [potatoes]
gb|AES90190.2|  fruit weight 2.2 protein                              50.8    2e-04    Medicago truncatula
ref|XP_011084083.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.8    2e-04    Sesamum indicum [beniseed]
ref|XP_004297456.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.8    2e-04    Fragaria vesca subsp. vesca
ref|XP_009351523.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    2e-04    
ref|XP_002511966.1|  structural constituent of cell wall, putative    52.0    3e-04    Ricinus communis
ref|XP_009147919.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    51.2    3e-04    Brassica rapa
emb|CDX92238.1|  BnaA05g21690D                                        49.7    3e-04    
ref|XP_010535733.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    3e-04    Tarenaya hassleriana [spider flower]
ref|XP_003607993.1|  Placenta-specific gene 8 protein                 50.4    3e-04    
ref|XP_004503375.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.8    3e-04    Cicer arietinum [garbanzo]
dbj|BAK07354.1|  predicted protein                                    50.1    3e-04    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010265195.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  51.2    3e-04    Nelumbo nucifera [Indian lotus]
ref|XP_006378441.1|  hypothetical protein POPTR_0010s11920g           50.4    3e-04    
gb|KDO70032.1|  hypothetical protein CISIN_1g041663mg                 49.3    3e-04    Citrus sinensis [apfelsine]
ref|XP_002310729.2|  hypothetical protein POPTR_0007s11140g           49.7    3e-04    
ref|NP_175332.1|  PLAC8 family protein                                50.8    3e-04    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461829.1|  PREDICTED: LOW QUALITY PROTEIN: protein PLAN...  50.4    4e-04    Camelina sativa [gold-of-pleasure]
gb|KJB77671.1|  hypothetical protein B456_012G150200                  50.1    4e-04    Gossypium raimondii
ref|XP_006304539.1|  hypothetical protein CARUB_v10011498mg           50.4    4e-04    Capsella rubella
ref|NP_188475.1|  PLAC8 family protein                                50.1    4e-04    
ref|XP_001757562.1|  predicted protein                                48.5    4e-04    
gb|KJB77672.1|  hypothetical protein B456_012G150200                  50.1    4e-04    
ref|XP_010551155.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6    50.1    4e-04    
gb|KCW83840.1|  hypothetical protein EUGRSUZ_B00708                   49.3    4e-04    
ref|XP_010920620.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    4e-04    
ref|XP_010044215.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.7    4e-04    
ref|XP_010266903.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  50.1    5e-04    
ref|XP_010269384.1|  PREDICTED: cell number regulator 1-like          49.3    5e-04    
ref|XP_009761627.1|  PREDICTED: cell number regulator 2-like isof...  48.9    5e-04    
emb|CDY62851.1|  BnaA06g03340D                                        49.3    5e-04    
emb|CDY71552.1|  BnaCnng73400D                                        50.1    5e-04    
ref|XP_011429582.1|  PREDICTED: cell number regulator 3-like          48.1    5e-04    
emb|CDY62854.1|  BnaA06g03310D                                        50.1    6e-04    
ref|XP_002735356.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.1    6e-04    
ref|XP_004238947.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.5    6e-04    
ref|XP_010068703.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.5    6e-04    
ref|XP_002523567.1|  conserved hypothetical protein                   48.5    6e-04    
ref|XP_006355072.1|  PREDICTED: cell number regulator 2-like          49.3    6e-04    
gb|AFM43804.1|  fruit weight 2.2-1 protein                            49.3    6e-04    
ref|XP_010026670.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  48.9    7e-04    
gb|AFK38344.1|  unknown                                               48.9    7e-04    
ref|XP_009761628.1|  PREDICTED: cell number regulator 2-like isof...  48.1    7e-04    
ref|XP_010066585.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  49.3    7e-04    
ref|XP_002891473.1|  hypothetical protein ARALYDRAFT_337030           49.7    7e-04    
ref|XP_009145891.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 7    48.1    7e-04    
ref|XP_011010193.1|  PREDICTED: cell number regulator 1-like          48.9    7e-04    
ref|XP_009766449.1|  PREDICTED: cell number regulator 7-like          48.5    8e-04    
ref|XP_011009998.1|  PREDICTED: activating signal cointegrator 1 ...  50.4    8e-04    
ref|XP_009617949.1|  PREDICTED: cell number regulator 2-like          48.1    8e-04    
ref|XP_010107951.1|  hypothetical protein L484_027541                 49.7    9e-04    
ref|XP_009337288.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  47.8    9e-04    
ref|XP_003630909.1|  Fruit weight 2.2-like protein                    48.9    9e-04    
ref|XP_010544048.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 9    48.1    0.001    
ref|XP_009337179.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  47.8    0.001    



>ref|XP_009611045.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009611046.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   333 bits (853),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 196/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQANLDV QCEFIQHLLDVTEVVA  SL  KS P KP  K++  YS+ DS
Sbjct  196  NEKLQLELQRSQANLDVGQCEFIQHLLDVTEVVATNSLSLKSSPTKPPKKLDESYSNVDS  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
              ++Y +SY K++EK  TSRN SSVSSKH+L+SSKGSHRYEEWHSDLLGCCSEPLLCIKT
Sbjct  256  YTEHYVESYAKSEEKRETSRNASSVSSKHELLSSKGSHRYEEWHSDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            + FPCGTFS++A+ A +RHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL+I GGF+
Sbjct  316  VFFPCGTFSKVASVAADRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLNIMGGFV  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG  G  KTK SPP++QFMES
Sbjct  376  DDFLSHLMCCCCALVQEWREVEIRGAHGLEKTKVSPPTSQFMES  419



>ref|XP_009803786.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009803787.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 195/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQANLDV QCEFIQHLLDVTEVVA  SL  KS P KP  K++  YS+ DS
Sbjct  196  NEKLQLELQRSQANLDVGQCEFIQHLLDVTEVVATNSLSLKSSPIKPPKKLDESYSNVDS  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               +Y +SY KNDEK +TSRNTSSVSSKH+L+SSKGSHRYEEWHSDLLGCCSEPLLCIKT
Sbjct  256  YTDHYVESYAKNDEKQATSRNTSSVSSKHELLSSKGSHRYEEWHSDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            + FPCGTFS++A+ A +RHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL+I GGF+
Sbjct  316  VFFPCGTFSKVASVAADRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLNIMGGFV  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG  G  KTK  PP++Q MES
Sbjct  376  DDFLSHLMCCCCALVQEWREVEIRGTHGLEKTKVRPPTSQLMES  419



>dbj|BAK32933.1| mid1-complementing activity 2 [Nicotiana tabacum]
Length=419

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQANLDV QCEFIQHLLDVTEVVA  SL  KS P KP  K++  YS+ DS
Sbjct  196  NEKLQLELQRSQANLDVGQCEFIQHLLDVTEVVATNSLSLKSSPIKPPKKLDESYSNVDS  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               +Y +SY KNDEK +TSRN SSVSSKH+L+SSKGSHRYEEWHSDLLGCCSEPLLCIKT
Sbjct  256  YTDHYVESYAKNDEKQATSRNASSVSSKHELLSSKGSHRYEEWHSDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            + FPCGTFS++A+ A +RHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL+I GGF+
Sbjct  316  VFFPCGTFSKVASVAADRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLNIMGGFV  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG  G  KTK  PP++Q MES
Sbjct  376  DDFLSHLMCCCCALVQEWREVEIRGTHGLEKTKVRPPTSQLMES  419



>ref|XP_006343349.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343350.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006343351.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Solanum tuberosum]
Length=419

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAA SL +KS P +P K +EH +SDA+S
Sbjct  196  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAAESLSEKSSPTQPTKKLEHSHSDANS  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            DK++ D+SY K+DEK STSRNTSSVSS+ +L+SSKGS+RYEEWH+DLLGCCSEPLLCIKT
Sbjct  256  DKEHSDKSYIKSDEKHSTSRNTSSVSSQRELLSSKGSYRYEEWHTDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              FPCGTFS++A+ A NR ISSA+ACNELMAYSLILSCCCYTCCIR+KLR+KL+I GG I
Sbjct  316  FFFPCGTFSKVASFAANRDISSADACNELMAYSLILSCCCYTCCIRKKLRQKLNITGGII  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE RE+EIRG  GT KTKTSPP +QFME+
Sbjct  376  DDFLSHLMCCCCALVQELREVEIRGANGTEKTKTSPPPSQFMET  419



>ref|XP_004232512.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
 ref|XP_010316435.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
Length=418

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 197/224 (88%), Gaps = 2/224 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQANLDV QCEFIQHLLDVTEVVA  SL  KS PAKPLK ++  YS+ D+
Sbjct  196  NEKLQLELQRSQANLDVGQCEFIQHLLDVTEVVANNSLSLKSSPAKPLKKLDQSYSNVDT  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +K  YD  Y K+DEK +TSRNTSSV+S+HDL+SSKGSH+YEEWHSDLLGCCSEPLLCIKT
Sbjct  256  EKVYYD-DYAKSDEKQTTSRNTSSVTSRHDLLSSKGSHQYEEWHSDLLGCCSEPLLCIKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L FPCGTFSRIA+ A +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG +
Sbjct  315  LFFPCGTFSRIASVAADRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNIKGGCV  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE RE++IRG  G  KTK SPP+TQFMES
Sbjct  375  DDFLSHLMCCCCALVQELREVKIRGTHGIEKTKISPPTTQFMES  418



>ref|XP_006340771.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006340772.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=418

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 197/224 (88%), Gaps = 2/224 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQANLDV QCEFIQHLLDVTEVVA  SL  KS PAKPLK ++  YS+ D+
Sbjct  196  NEKLQLELQRSQANLDVGQCEFIQHLLDVTEVVATNSLSLKSSPAKPLKKLDLSYSNVDN  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +K  YD  Y K+DEK STSRNTSSV+S+HDL+SSKGSHRYEEWHSDLLGCCSEPLLCIKT
Sbjct  256  EKVYYD-DYAKSDEKQSTSRNTSSVTSRHDLLSSKGSHRYEEWHSDLLGCCSEPLLCIKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L FPCGTFSR+A+ A +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG +
Sbjct  315  LFFPCGTFSRVASVAEDRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNIRGGCV  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE RE++IRG  G  KTK SPP+TQFMES
Sbjct  375  DDFLSHLMCCCCALVQELREVKIRGTHGIEKTKISPPTTQFMES  418



>ref|XP_009801746.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009801747.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   328 bits (840),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQANLDV+ CEFIQHLL+VTEVVA+ SL +KS P KP K +EH +SD +S
Sbjct  196  NEKLQLELQRSQANLDVSHCEFIQHLLEVTEVVASESLSEKSSPTKPTKKLEHSHSDVNS  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            DK++YD+SY K+DEK STSRNTSSVSS+ +L+SSKGS RY+EWHSDLLGCCSEPLLCIKT
Sbjct  256  DKEHYDRSYTKSDEKQSTSRNTSSVSSQRELLSSKGSDRYDEWHSDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              FPCGTFS++A+AA +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG I
Sbjct  316  CFFPCGTFSKVASAAADRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNITGGII  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE RE+EIRG  GT KTKTSPP +QFMES
Sbjct  376  DDFLSHLMCCCCALVQELREVEIRGAHGTGKTKTSPPPSQFMES  419



>ref|XP_009624357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009624358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 dbj|BAK32932.1| mid1-complementing activity 1 [Nicotiana tabacum]
Length=419

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 199/224 (89%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQANLDV+ CEFIQHLL+VTEVVA+ SL +KS P KP K +EH +SD +S
Sbjct  196  NEKLQLELQRSQANLDVSHCEFIQHLLEVTEVVASESLSEKSSPTKPTKKLEHSHSDVNS  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            DK++ D+SY K+DEK STSR TSSVSS+ +L+SSKGS RY+EWHSDLLGCCSEPLLCIKT
Sbjct  256  DKEHNDRSYTKSDEKQSTSRITSSVSSQRELLSSKGSDRYDEWHSDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              FPCGTFS++A+AA +RHISSA+ACNELMAYSLILSCCCYTCCIR+KLRKKL+I GG I
Sbjct  316  CFFPCGTFSKVASAAADRHISSADACNELMAYSLILSCCCYTCCIRKKLRKKLNITGGII  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE RE+EIRG  GT KTKTSPP +QFMES
Sbjct  376  DDFLSHLMCCCCALVQELREVEIRGAHGTGKTKTSPPPSQFMES  419



>emb|CBI22120.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQAN DV+QCE IQHL+ VTE VAA S+P+K+LP +   K E  YSDA+S
Sbjct  95   NEKLQLELQRSQANYDVDQCEVIQHLIGVTEAVAANSVPEKNLPVRSSKKAESDYSDANS  154

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK+ + D+SY K  +  + SRN SSVSS HDL+S++GSHR+EEWHSDLLGCCSEP LCIK
Sbjct  155  DKEYSVDESYPKRSDTRTASRNISSVSSGHDLLSTRGSHRHEEWHSDLLGCCSEPSLCIK  214

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IA+ ATNRH+SSAEACNELMAYS+ILSCCCYTCCIRRKLR  L+I GG 
Sbjct  215  TFFYPCGTFSKIASVATNRHMSSAEACNELMAYSMILSCCCYTCCIRRKLRNMLNITGGL  274

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSHLMCCCCALVQEWRE+EIRG+ G  KT+TSPP +Q+MES
Sbjct  275  FDDFLSHLMCCCCALVQEWREVEIRGVYGPEKTRTSPPPSQYMES  319



>ref|XP_002272810.2| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Vitis vinifera]
Length=420

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQAN DV+QCE IQHL+ VTE VAA S+P+K+LP +   K E  YSDA+S
Sbjct  196  NEKLQLELQRSQANYDVDQCEVIQHLIGVTEAVAANSVPEKNLPVRSSKKAESDYSDANS  255

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK+ + D+SY K  +  + SRN SSVSS HDL+S++GSHR+EEWHSDLLGCCSEP LCIK
Sbjct  256  DKEYSVDESYPKRSDTRTASRNISSVSSGHDLLSTRGSHRHEEWHSDLLGCCSEPSLCIK  315

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IA+ ATNRH+SSAEACNELMAYS+ILSCCCYTCCIRRKLR  L+I GG 
Sbjct  316  TFFYPCGTFSKIASVATNRHMSSAEACNELMAYSMILSCCCYTCCIRRKLRNMLNITGGL  375

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSHLMCCCCALVQEWRE+EIRG+ G  KT+TSPP +Q+MES
Sbjct  376  FDDFLSHLMCCCCALVQEWREVEIRGVYGPEKTRTSPPPSQYMES  420



>ref|XP_007046628.1| PLAC8 family protein [Theobroma cacao]
 gb|EOX90785.1| PLAC8 family protein [Theobroma cacao]
Length=421

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            N KLQLELQRSQAN DV QCE IQHLL+VTEV AATS+PDKS   K  K VE  YSDA+S
Sbjct  197  NAKLQLELQRSQANYDVQQCEVIQHLLEVTEVAAATSIPDKSSSMKGSKKVERNYSDANS  256

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K  +YD+S     +  +TSRNTSSVSS HDL+S +GSHRY+EWH+DLLGCCSEP LC+K
Sbjct  257  EKDHSYDESSPNKSDTRTTSRNTSSVSSGHDLLSDRGSHRYDEWHADLLGCCSEPYLCMK  316

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT ATNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  317  TFFYPCGTFSKIATVATNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGF  376

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSHLMCCCCALVQEWRE+E+RG+ G  KT+ SPP +QFMES
Sbjct  377  IDDFLSHLMCCCCALVQEWREVEMRGVYGPEKTRISPPPSQFMES  421



>emb|CDP01861.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 193/224 (86%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQAN DVNQCE IQHLL+VTE VAATS+P+K  P K  K ++H +SD ++
Sbjct  196  NEKLQLELQRSQANYDVNQCEMIQHLLEVTEAVAATSVPEKVSPKKTSKEMDHSFSDLNN  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            D ++Y + Y K+ +K   SRNTSSVSSKHDL+ S+GSH++EEWHSDLLGCCSEPLLCIKT
Sbjct  256  DNEHYGERYTKSVDKHPPSRNTSSVSSKHDLLDSQGSHQHEEWHSDLLGCCSEPLLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              FPC TFSR+AT AT+R +SS+EACNE+MAYSLILSCCCYTCCIR+KLRK+L+I GG  
Sbjct  316  FFFPCWTFSRVATVATSRRVSSSEACNEMMAYSLILSCCCYTCCIRQKLRKQLNIAGGLC  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE+RE++IRGI G  KTKTSPP++Q+MES
Sbjct  376  DDFLSHLMCCCCALVQEYREVKIRGIHGFEKTKTSPPASQYMES  419



>ref|XP_006383064.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
 gb|ERP60861.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
Length=419

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 191/224 (85%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQA+LDVNQCE IQHL++VTEV AA+SLP+KS   K  K +E  YSDA  
Sbjct  196  NEKLQLELQRSQAHLDVNQCEVIQHLIEVTEVAAASSLPEKSSSTKSSKKLEPAYSDASE  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +K ++D SY    +   TSRNTSSVSS+ DL+SS+GSH+ EEWH+DLLGCCSEP LCIKT
Sbjct  256  NKHSFDDSYSTKSDSHKTSRNTSSVSSRDDLLSSRGSHQQEEWHADLLGCCSEPYLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L +PCGTF++IAT A NRHISSAEACNELMAYS++LSCCCYTCC+RR+LRK L+I GGFI
Sbjct  316  LFYPCGTFAKIATVAKNRHISSAEACNELMAYSMMLSCCCYTCCVRRELRKTLNITGGFI  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP +QFMES
Sbjct  376  DDFLSHLMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQFMES  419



>ref|XP_010113307.1| hypothetical protein L484_026637 [Morus notabilis]
 gb|EXC35314.1| hypothetical protein L484_026637 [Morus notabilis]
Length=320

 Score =   296 bits (758),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 186/225 (83%), Gaps = 2/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLEL+RSQAN DVNQCE IQ L+DVTE VA  ++PDKS P K   K+E  YSD +S
Sbjct  96   NEKLQLELRRSQANYDVNQCEVIQRLIDVTETVAENTVPDKSSPEKSHKKMERNYSDDNS  155

Query  603  DKQNY-DQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K++  D+ Y K  +   TSRNTSSVSS HDL+S++ SHR+EEW +DLLGCCSEP LCIK
Sbjct  156  EKEDSSDEKYSKRGDSRVTSRNTSSVSSGHDLLSTRWSHRHEEWSNDLLGCCSEPSLCIK  215

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT A NRH+S AEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  216  TFFYPCGTFSKIATVAKNRHMSPAEACNELMAYSLILSCCCYTCCIRRKLRKTLNITGGF  275

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSH MCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  276  IDDFLSHFMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQYMES  320



>ref|XP_011043148.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
 ref|XP_011043149.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
Length=419

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLELQRSQA+LDVNQCE IQHL++VTEV AATSLP+KS   K  K +E  YSD   
Sbjct  196  NEKLQLELQRSQAHLDVNQCEVIQHLIEVTEVAAATSLPEKSSSTKSSKKLEPTYSDVSE  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +K ++D +Y    +   TSRNTSSVSS+ DL+SS+GSH +EEWH+DLLGCCSEP LCIKT
Sbjct  256  NKHSFDDNYSTKSDSHKTSRNTSSVSSRDDLLSSRGSHHHEEWHADLLGCCSEPYLCIKT  315

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L +PCGTF++IAT A NRHISSAEACNELMAYS++LSCCCYTCC+RR+LRK L+I GGFI
Sbjct  316  LFYPCGTFAKIATVAKNRHISSAEACNELMAYSMMLSCCCYTCCVRRELRKTLNITGGFI  375

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP +QFMES
Sbjct  376  DDFLSHLMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQFMES  419



>gb|KJB43289.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43290.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43291.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
Length=416

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 184/224 (82%), Gaps = 5/224 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQRSQ++ DV QCE IQHLL+VTEV AATS+PDK    +  KVE  YSDA+S+
Sbjct  197  NEKLQVELQRSQSSYDVQQCEVIQHLLEVTEVAAATSVPDK----RSKKVERNYSDANSE  252

Query  600  K-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K  +YD+   K      TS NTSSVSS  DL+S +GS RY+EWH+DLLGCCSEP LCIKT
Sbjct  253  KGHSYDEISPKKPGSRITSINTSSVSSGRDLLSDRGSDRYDEWHADLLGCCSEPYLCIKT  312

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
               PCGT S+IAT ATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFI
Sbjct  313  FFCPCGTLSKIATVATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGFI  372

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG  G+ KTKTSPP +QFMES
Sbjct  373  DDFLSHLMCCCCALVQEWREVEIRGFNGSEKTKTSPPPSQFMES  416



>ref|XP_011099884.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099885.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099886.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099887.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
Length=416

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 183/222 (82%), Gaps = 2/222 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N+KLQLELQ SQANLDV QCE IQHLL+VTE VAA SLP+K+   K  KVE  Y D  S+
Sbjct  196  NQKLQLELQHSQANLDVGQCEVIQHLLEVTEAVAANSLPEKTSFTKESKVEQVYVDVSSE  255

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K++YD++Y +N EK   S NTSSVSS+ DL+S KG+   +EWHSDLLGCCSEPLLC+KT+
Sbjct  256  KEHYDKNYSRNSEKQEASGNTSSVSSRRDLLSFKGAQ--DEWHSDLLGCCSEPLLCLKTM  313

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
            LFPCGTFSRIA+ ATNRHIS AEACN+LMAYSLILSCCCYTCCIR+KLR  L+I GG  D
Sbjct  314  LFPCGTFSRIASVATNRHISPAEACNDLMAYSLILSCCCYTCCIRKKLRGMLNIKGGLFD  373

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DFLSHLMCCCCALVQEWRE+EIR ++G  KT T PP+ Q++E
Sbjct  374  DFLSHLMCCCCALVQEWREVEIRQVKGHQKTTTCPPTIQYIE  415



>gb|KDP23985.1| hypothetical protein JCGZ_25373 [Jatropha curcas]
Length=415

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 179/224 (80%), Gaps = 5/224 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQANLDVNQCE IQHL++VTE   A S+P KS P K   K+E  YSD   
Sbjct  196  NEKLQLELQRSQANLDVNQCEVIQHLIEVTEAAVANSVPQKSSPVKASKKLEPSYSDVSE  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               +YD++Y K +     SR TS  +S  DL+S KGS+R EEWH+DLLGCCSEP LC++T
Sbjct  256  KNHSYDEAYPKKNN----SRTTSRNTSGDDLLSRKGSYRDEEWHTDLLGCCSEPSLCMRT  311

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGT S+IAT ATNRH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+
Sbjct  312  FFYPCGTISKIATVATNRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGFV  371

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQE+RE+EIRG+ G  KTK SPP +QFMES
Sbjct  372  DDFLSHLMCCCCALVQEYREVEIRGVYGPEKTKISPPPSQFMES  415



>gb|KJB17606.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17607.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17608.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=418

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 186/225 (83%), Gaps = 4/225 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKL+LELQRSQAN DV QCE IQHLLDVTEV  A S+PDKS   K  K  E  YSD D+
Sbjct  196  NEKLRLELQRSQANYDVKQCEVIQHLLDVTEV--AASIPDKSSSPKVSKKVERNYSDVDN  253

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +   +Y+ +  K  +   TSRNTSSVSS HDL+S +GSHRYEEW++DLLGCCSEP LCIK
Sbjct  254  ENGHSYNDNSPKKPDSRMTSRNTSSVSSGHDLLSDRGSHRYEEWNADLLGCCSEPSLCIK  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT ATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  314  TFFYPCGTFSKIATVATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGF  373

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +DDFLSHLMCCCCALVQEWRE+EIRGI G  KTKTSPP +QFMES
Sbjct  374  VDDFLSHLMCCCCALVQEWREVEIRGIYGPEKTKTSPPPSQFMES  418



>ref|XP_010266008.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266009.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266010.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=420

 Score =   289 bits (740),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            N KLQ ELQ SQAN+DV QCE IQ LL+VTEV AA+SLPDK  P K   KVE  YSDA +
Sbjct  197  NSKLQQELQLSQANMDVGQCEVIQRLLEVTEV-AASSLPDKDSPDKSSKKVEPKYSDAHN  255

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK  ++D+ Y   ++ +  SR TS VSS HDL+S++GSHR+EEWHSDLLGCCSEP LC++
Sbjct  256  DKLHSFDERYHGENDTYVPSRTTSLVSSGHDLLSTRGSHRHEEWHSDLLGCCSEPYLCMR  315

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT ATNRH+S AEACNELMAYSLILSCCCYTCCIRRKLRK L+I GG 
Sbjct  316  TFFYPCGTFSKIATVATNRHMSPAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGL  375

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSHL+CCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+ME+
Sbjct  376  CDDFLSHLICCCCALVQEWREVEIRGVYGPGKTKTSPPPSQYMEA  420



>ref|XP_008448524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Cucumis melo]
Length=418

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKLQLELQRSQANL+V +CE IQ LLDVTE VAATSLP+K+ P K  KV E  Y DA++
Sbjct  196  NEKLQLELQRSQANLNVGECEVIQRLLDVTESVAATSLPEKNSPEKSHKVVEKTYVDANN  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               + D+ + KN +  +TSR +SSVSS HDL+S++GS RY EWH+DLL CCSEP LC+KT
Sbjct  256  GDSS-DEHFYKNTDARTTSRKSSSVSSGHDLLSTRGSDRYGEWHTDLLDCCSEPSLCLKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGT SRIAT AT+RH S AEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GGF+
Sbjct  315  FFYPCGTLSRIATVATSRHTSPAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGFV  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  375  DDFLSHLMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQYMES  418



>ref|XP_008393931.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393938.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393943.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393951.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393959.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
Length=408

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 186/225 (83%), Gaps = 11/225 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQA  DV+QCE IQ LL+VTE VAA S P+K++     KV+  +SDA+++
Sbjct  193  NEKLQLELQRSQAAYDVSQCEVIQRLLEVTETVAAESSPEKNIE----KVDRSHSDANNE  248

Query  600  KQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K+ + ++SY KN+ +      TS  +S+HDL+S++GSHR EEW++DLLGCCSEP LCIKT
Sbjct  249  KEHSSNESYKKNESR-----KTSRNTSRHDLLSTRGSHRNEEWNTDLLGCCSEPALCIKT  303

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGTFS+IA+AATNR +SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFI
Sbjct  304  FFYPCGTFSKIASAATNRPMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKXLNISGGFI  363

Query  243  DDFLSHLMCCCCALVQEWreieirgi-eGTHKTKTSPPSTQFMES  112
            DDFLSH MCCCCALVQEWRE+EIRG+  G  KTK SPP++Q+ME+
Sbjct  364  DDFLSHFMCCCCALVQEWREVEIRGVHYGAEKTKVSPPASQYMET  408



>ref|XP_004146155.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 gb|KGN55644.1| hypothetical protein Csa_3G002640 [Cucumis sativus]
Length=418

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKLQLELQRSQANL+V +CE IQ L+DVTE VAATSLP+K+ P K  KV E  Y DA++
Sbjct  196  NEKLQLELQRSQANLNVGECEVIQRLIDVTESVAATSLPEKNSPEKSHKVVEKTYVDANN  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               + D+ + KN +  +TSR +SSVSS HDL+S++GS RY EWH+DLL CCSEP LC+KT
Sbjct  256  GDSS-DEHFYKNTDARTTSRKSSSVSSGHDLLSTRGSDRYGEWHTDLLDCCSEPSLCLKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGT SRIAT AT+RH S AEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GGF+
Sbjct  315  FFYPCGTLSRIATVATSRHTSPAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGFV  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+ME+
Sbjct  375  DDFLSHLMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQYMET  418



>ref|XP_004159726.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Cucumis sativus]
Length=418

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 185/224 (83%), Gaps = 2/224 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKLQLELQRSQANL+V +CE IQ L+DVTE VAATSLP+K+ P K  KV E  Y DA++
Sbjct  196  NEKLQLELQRSQANLNVGECEVIQRLIDVTESVAATSLPEKNSPEKSHKVVEKTYVDANN  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               + D+ + KN +  +TSR +SSVSS HDL+S++GS RY EWH+DLL CCSEP LC+KT
Sbjct  256  GDSS-DEHFYKNTDARTTSRKSSSVSSGHDLLSTRGSDRYGEWHTDLLDCCSEPSLCLKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGT SRIAT AT+RH S AEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GGF+
Sbjct  315  FFYPCGTLSRIATVATSRHTSPAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGFV  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+ME+
Sbjct  375  DDFLSHLMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQYMET  418



>ref|XP_007202160.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
 gb|EMJ03359.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
Length=416

 Score =   284 bits (726),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 189/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQ+  DV+QCE IQ LL+VTE VA+ S P+K+      K+E  YSDA+S+
Sbjct  197  NEKLQLELQRSQSIYDVSQCEVIQRLLEVTETVASKSSPEKNNK----KIERNYSDANSE  252

Query  600  KQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K+ + ++SY K++ +   SRNTSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT
Sbjct  253  KEPSSNESYQKSESR-KMSRNTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPSLCIKT  311

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGTFS+IA+ ATNRH+SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFI
Sbjct  312  FFYPCGTFSKIASVATNRHMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNISGGFI  371

Query  243  DDFLSHLMCCCCALVQEWreieirgi-eGTHKTKTSPPSTQFMES  112
            DDFLSH MCCCCALVQEWRE+E+RGI  G  KTK SPP +Q+ME+
Sbjct  372  DDFLSHFMCCCCALVQEWREVELRGIPYGAEKTKISPPPSQYMET  416



>gb|KHG25004.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=418

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 185/225 (82%), Gaps = 4/225 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKL+LELQ SQAN DV QCE IQHLLDVTEV  A S+PDKS   K  K  E  YSD D+
Sbjct  196  NEKLRLELQCSQANYDVKQCEVIQHLLDVTEV--AASIPDKSSSPKVSKKVERNYSDVDN  253

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K  +Y+ +  K  +   TSRNTSSVSS HDL+S +GSHRYEEW++DLLGC SEP LCIK
Sbjct  254  EKGHSYNDNSPKKPDSRMTSRNTSSVSSGHDLLSDRGSHRYEEWNADLLGCFSEPSLCIK  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT ATN+H+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  314  TFFYPCGTFSKIATVATNKHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNITGGF  373

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +DDFLSHLMCCCCALVQEWRE+EIRGI G  KTKTSPP +QFMES
Sbjct  374  VDDFLSHLMCCCCALVQEWREVEIRGIYGPEKTKTSPPPSQFMES  418



>ref|XP_009379353.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379354.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379355.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379356.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379359.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=412

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 186/224 (83%), Gaps = 5/224 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQA  DV+QCE IQ LL+VTE VAA S P+K++     KV+  +SDA+++
Sbjct  193  NEKLQLELQRSQAAYDVSQCEVIQRLLEVTETVAAESSPEKNIE----KVDRSHSDANNE  248

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K++  +   K  E   TSRNTSSVSS+HDL+S++GSHR+EEW +DLLGCCSEP LCIKT 
Sbjct  249  KEHSSKESYKKSESRKTSRNTSSVSSRHDLLSTRGSHRHEEWKTDLLGCCSEPALCIKTF  308

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             +PCGTFS+IA+AATNR +SS+EACNELMAYSL+LSCCCYT CIRRKLRK L+I GGFID
Sbjct  309  FYPCGTFSKIASAATNRPMSSSEACNELMAYSLVLSCCCYTSCIRRKLRKTLNISGGFID  368

Query  240  DFLSHLMCCCCALVQEWreieirgi-eGTHKTKTSPPSTQFMES  112
            DFLSH MCCCCALVQEWRE+EIRG+  G  KTK SPP++Q+ME+
Sbjct  369  DFLSHFMCCCCALVQEWREVEIRGVHYGAEKTKVSPPASQYMET  412



>ref|XP_008242040.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
 ref|XP_008242041.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
Length=416

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 188/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQ+  DV+QCE IQ LL+VTE VA+ S P+K+      K E  YSDA+S+
Sbjct  197  NEKLQLELQRSQSIYDVSQCEVIQRLLEVTETVASKSSPEKNNK----KTERNYSDANSE  252

Query  600  KQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K+ + ++SY K++ +   SRNTSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT
Sbjct  253  KEPSSNESYQKSESR-KMSRNTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPSLCIKT  311

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGTFS+IA+ ATNRH+SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFI
Sbjct  312  FFYPCGTFSKIASVATNRHMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNISGGFI  371

Query  243  DDFLSHLMCCCCALVQEWreieirgi-eGTHKTKTSPPSTQFMES  112
            DDFLSH MCCCCALVQEWRE+E+RGI  G  KTK SPP +Q+ME+
Sbjct  372  DDFLSHFMCCCCALVQEWREVELRGIPYGAEKTKISPPPSQYMET  416



>ref|XP_009363461.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Pyrus x bretschneideri]
Length=415

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 182/224 (81%), Gaps = 5/224 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQA  DV+QCE IQ LL+VTE VAA S P+KS      KVE   SDA+++
Sbjct  196  NEKLQLELQRSQATYDVDQCEVIQRLLEVTETVAANSSPEKS----SKKVERSQSDANNE  251

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K +      +  E   TSR+TSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT 
Sbjct  252  KDHSSNESYQKSESRKTSRSTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPFLCIKTF  311

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             +PCGTFS+IA+ ATNR ISSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFID
Sbjct  312  FYPCGTFSKIASVATNRPISSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNISGGFID  371

Query  240  DFLSHLMCCCCALVQEWreieirgi-eGTHKTKTSPPSTQFMES  112
            DFLSH MCCCCALVQEWRE+EIRG+  G  KTK SPP++Q+ME+
Sbjct  372  DFLSHFMCCCCALVQEWREVEIRGVHYGAEKTKISPPTSQYMET  415



>ref|XP_006425392.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425393.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425394.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425395.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425396.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38632.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38633.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38634.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38635.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38636.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
Length=419

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQ  +DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+
Sbjct  196  NEKLQLELQRSQTQMDVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDN  255

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
             K  ++++   K D + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+K
Sbjct  256  GKNHSFNEKANKCDARTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMK  314

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  315  TFFYPCGTFSKIATVATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNIAGGF  374

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +DDFLSH MCCCCALVQEWRE+EIRGI G  KTKTSPP +Q MES
Sbjct  375  VDDFLSHFMCCCCALVQEWREVEIRGIYGPEKTKTSPPPSQIMES  419



>gb|KDO71305.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71306.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71307.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71308.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=419

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQ  +DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+
Sbjct  196  NEKLQLELQRSQTQMDVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDN  255

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
             K  ++++   K D + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+K
Sbjct  256  GKNHSFNEKSNKCDARTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMK  314

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  315  TFFYPCGTFSKIATVATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNIAGGF  374

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +DDFLSH MCCCCALVQEWRE+EIRGI G  KTKTSPP +Q MES
Sbjct  375  VDDFLSHFMCCCCALVQEWREVEIRGIYGPEKTKTSPPPSQIMES  419



>ref|XP_006466999.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467000.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Citrus sinensis]
Length=419

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQ  +DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+
Sbjct  196  NEKLQLELQRSQTQMDVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDN  255

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
             K  ++++   K D + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+K
Sbjct  256  GKNHSFNEKSNKCDARTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMK  314

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  315  TFFYPCGTFSKIATVATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNIAGGF  374

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +DDFLSH MCCCCALVQEWRE+EIRGI G  KTKTSPP +Q MES
Sbjct  375  VDDFLSHFMCCCCALVQEWREVEIRGIYGPEKTKTSPPPSQIMES  419



>ref|XP_008807147.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
 ref|XP_008807148.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
Length=421

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 184/226 (81%), Gaps = 4/226 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKS-LPAKPLKVEHGYSDADS  604
            NEKLQ+ELQRSQ+++D++QCE I  LL VTE VA  SLP+KS  P  P+KVE  YSD + 
Sbjct  197  NEKLQMELQRSQSDMDISQCEIILRLLGVTENVAC-SLPEKSEKPKDPMKVESNYSDTNI  255

Query  603  D-KQNYDQSY-GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            D + ++D  Y  +  + +  SR+ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+
Sbjct  256  DTRHSFDGDYCSQQKDTYMASRSVSPVSSGHDLISNRGSHRHEDWHSDLLGCCSEPYLCM  315

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KTL +PCGTFS+IAT   NRH+SSAEACN+L+AYSLILSCCCYTCC+RRKLRK L+I GG
Sbjct  316  KTLFYPCGTFSKIATVTQNRHVSSAEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITGG  375

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
              DDFLSHLMCCCCALVQEWRE+EIRG++ T K KTSPP +Q+M+S
Sbjct  376  LCDDFLSHLMCCCCALVQEWREVEIRGVQCTGKKKTSPPPSQYMQS  421



>ref|XP_008809426.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=421

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 186/226 (82%), Gaps = 4/226 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADS  604
            NEKLQ+ELQRSQ+N+D++QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++
Sbjct  197  NEKLQMELQRSQSNMDISQCEVIQRLLAVTENIAC-SPPEKSEKLKDSKKVESDYSDTNT  255

Query  603  DKQ-NYDQSY-GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            +K+ ++D  Y  + ++ +  S++ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+
Sbjct  256  EKRYSFDGDYCSQQNDSYMASKSVSQVSSGHDLISNRGSHRHEDWHSDLLGCCSEPNLCM  315

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT L+PCGTFS+IAT A NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG
Sbjct  316  KTFLYPCGTFSKIATVAKNRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGG  375

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
              DDFLSHLMCCCCALVQEWRE+EIRG+ GT +TKTS P +Q+MES
Sbjct  376  LCDDFLSHLMCCCCALVQEWREVEIRGVYGTEETKTSSPPSQYMES  421



>ref|XP_008352422.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
 ref|XP_008352423.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
Length=415

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 180/224 (80%), Gaps = 5/224 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQA  DV QCE IQ LL+VTE VAA S P+KS      KVE   SDA+++
Sbjct  196  NEKLQLELQRSQATYDVGQCEVIQRLLEVTETVAANSSPEKS----SKKVERSQSDANNE  251

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K +      +  E   TSR+TSSVSS HDL+S++GSH +EEW++DLLGCCSEP LCIKT 
Sbjct  252  KDHSSNESYQKSESRKTSRSTSSVSSGHDLLSTRGSHLHEEWNTDLLGCCSEPFLCIKTF  311

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             +PCGTFS+IA+ ATNR ISSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I GGFID
Sbjct  312  FYPCGTFSKIASVATNRPISSAEACNELMAYSLVLSCCCYTCCIRRKLRKMLNISGGFID  371

Query  240  DFLSHLMCCCCALVQEWreieirgi-eGTHKTKTSPPSTQFMES  112
            DFLSH MCCCCALVQEWRE+EIRG+  G  KTK SPP++QFME+
Sbjct  372  DFLSHFMCCCCALVQEWREVEIRGVHYGAVKTKISPPTSQFMET  415



>ref|XP_008809427.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=420

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADS  604
            NEKLQ+ELQRSQ+N+D++QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++
Sbjct  197  NEKLQMELQRSQSNMDISQCEVIQRLLAVTENIAC-SPPEKSEKLKDSKKVESDYSDTNT  255

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K+ ++D  Y         + N S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+K
Sbjct  256  EKRYSFDGDYCSQQNDSYMASNVSQVSSGHDLISNRGSHRHEDWHSDLLGCCSEPNLCMK  315

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T L+PCGTFS+IAT A NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG 
Sbjct  316  TFLYPCGTFSKIATVAKNRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGL  375

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSHLMCCCCALVQEWRE+EIRG+ GT +TKTS P +Q+MES
Sbjct  376  CDDFLSHLMCCCCALVQEWREVEIRGVYGTEETKTSSPPSQYMES  420



>ref|XP_010933352.1| PREDICTED: cell number regulator 13-like isoform X1 [Elaeis guineensis]
Length=421

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 183/226 (81%), Gaps = 4/226 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADS  604
            NEKLQ+ELQRSQ+N+D+ QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++
Sbjct  197  NEKLQMELQRSQSNMDIGQCEVIQRLLGVTENIAC-SQPEKSEKLKDSRKVESDYSDTNT  255

Query  603  DKQ-NYDQSYG-KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DK+ ++D  Y  + ++ +  S++ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+
Sbjct  256  DKRYSFDGDYCCQQNDTYMASKSVSPVSSGHDLISTRGSHRHEDWHSDLLGCCSEPYLCM  315

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT L+PCGTFS+IAT   NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG
Sbjct  316  KTFLYPCGTFSKIATVTENRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGG  375

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
              DDFLSHLMCCCCALVQEWRE+EIRG+ GT KTKT+ P  Q+MES
Sbjct  376  LCDDFLSHLMCCCCALVQEWREVEIRGVYGTEKTKTTSPPFQYMES  421



>ref|XP_010920111.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010920112.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=414

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 178/224 (79%), Gaps = 7/224 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQ+ELQRSQ+++D+ QCE IQ LL VTE VA  SLP+KS   K  K VE  YSD   
Sbjct  197  NEKLQMELQRSQSDMDIGQCEIIQRLLGVTENVAY-SLPEKSEKLKDCKNVESNYSDI--  253

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
               N D  +  +   +  SRN S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KT
Sbjct  254  ---NMDARHSFDGIDYMASRNVSPVSSGHDLISNRGSHRHEDWHSDLLGCCSEPYLCMKT  310

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L +PCGTFS+IAT   NRH+SSAEACN+LMAY+LILSCCCYTCC+RRKLRK L+I GG  
Sbjct  311  LFYPCGTFSKIATVTKNRHVSSAEACNDLMAYTLILSCCCYTCCVRRKLRKMLNITGGLC  370

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG++GT K KTSPP +Q+MES
Sbjct  371  DDFLSHLMCCCCALVQEWREVEIRGVQGTEKKKTSPPPSQYMES  414



>ref|XP_010266845.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=409

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 176/223 (79%), Gaps = 12/223 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKL++ELQRSQA++DV QCE IQHLL+VTEV A    P KS           YSDA +D
Sbjct  197  NEKLKVELQRSQASMDVGQCEVIQHLLEVTEVAAKNDSPSKS-----------YSDASND  245

Query  600  K-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K  ++D  + +  +   TSR TSSVSS HDL+S++GSHR EEWHSDLLGCCSEP LC+KT
Sbjct  246  KAHSFDDRHNEESDTRVTSRTTSSVSSGHDLLSTRGSHRLEEWHSDLLGCCSEPSLCMKT  305

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGTFS+IA+ ATNRH+S AEACNELMAYSLILSCCCYTCC+RRKLR+ L+I GG  
Sbjct  306  FFYPCGTFSKIASVATNRHMSPAEACNELMAYSLILSCCCYTCCVRRKLRRMLNITGGSC  365

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTK SPP +Q+ME
Sbjct  366  DDFLSHLMCCCCALVQEWREVEIRGVYGPEKTKMSPPPSQYME  408



>ref|XP_010029652.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Eucalyptus grandis]
Length=417

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 177/225 (79%), Gaps = 5/225 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY-SDADS  604
            NEKL++ELQRSQ N+D+NQCE IQ LL+VTE VA+ SLPD   P K  K +  Y SDADS
Sbjct  196  NEKLRMELQRSQTNMDMNQCEVIQRLLEVTETVASNSLPDYGSPVKGSKKKEKYTSDADS  255

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            D+ Q+  ++Y  N        +++SVS  +DL+ SKGS+ + EWH+DLLGCCSEPLLCIK
Sbjct  256  DREQSTGETYPNNSTS---KTSSTSVSLDNDLLPSKGSYGHYEWHTDLLGCCSEPLLCIK  312

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T   PC TFS+IAT ATNRH+S  EACN+L+AYSLILSCCCYTCC+RRKLRK L+I GG+
Sbjct  313  TFFCPCDTFSKIATVATNRHMSPGEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITGGW  372

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSH MCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  373  FDDFLSHFMCCCCALVQEWREVEIRGLSGHEKTKTSPPPSQYMES  417



>ref|XP_010029651.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Eucalyptus grandis]
Length=418

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 177/225 (79%), Gaps = 4/225 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY-SDADS  604
            NEKL++ELQRSQ N+D+NQCE IQ LL+VTE VA+ SLPD   P K  K +  Y SDADS
Sbjct  196  NEKLRMELQRSQTNMDMNQCEVIQRLLEVTETVASNSLPDYGSPVKGSKKKEKYTSDADS  255

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            D+ Q+  ++Y  N      +  ++SVS  +DL+ SKGS+ + EWH+DLLGCCSEPLLCIK
Sbjct  256  DREQSTGETYPNNSTS--KTSRSTSVSLDNDLLPSKGSYGHYEWHTDLLGCCSEPLLCIK  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T   PC TFS+IAT ATNRH+S  EACN+L+AYSLILSCCCYTCC+RRKLRK L+I GG+
Sbjct  314  TFFCPCDTFSKIATVATNRHMSPGEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITGGW  373

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSH MCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  374  FDDFLSHFMCCCCALVQEWREVEIRGLSGHEKTKTSPPPSQYMES  418



>ref|XP_010933353.1| PREDICTED: cell number regulator 13-like isoform X2 [Elaeis guineensis]
Length=402

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 173/224 (77%), Gaps = 19/224 (8%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADS  604
            NEKLQ+ELQRSQ+N+D+ QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++
Sbjct  197  NEKLQMELQRSQSNMDIGQCEVIQRLLGVTENIAC-SQPEKSEKLKDSRKVESDYSDTNT  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            DK++                  S VSS HDLIS++GSHR+E+WHSDLLGCCSEP LC+KT
Sbjct  256  DKRS-----------------VSPVSSGHDLISTRGSHRHEDWHSDLLGCCSEPYLCMKT  298

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
             L+PCGTFS+IAT   NRH+SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG  
Sbjct  299  FLYPCGTFSKIATVTENRHVSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGLC  358

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ GT KTKT+ P  Q+MES
Sbjct  359  DDFLSHLMCCCCALVQEWREVEIRGVYGTEKTKTTSPPFQYMES  402



>ref|XP_004512157.1| PREDICTED: cell number regulator 13-like isoform X1 [Cicer arietinum]
 ref|XP_004512158.1| PREDICTED: cell number regulator 13-like isoform X2 [Cicer arietinum]
 ref|XP_004512159.1| PREDICTED: cell number regulator 13-like isoform X3 [Cicer arietinum]
 ref|XP_004512160.1| PREDICTED: cell number regulator 13-like isoform X4 [Cicer arietinum]
 ref|XP_004512161.1| PREDICTED: cell number regulator 13-like isoform X5 [Cicer arietinum]
Length=417

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 174/225 (77%), Gaps = 7/225 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVE-HGYSDADSD  601
            EKL LELQRSQANLD+NQCE IQ LLDVT+V A  SLPD   P K  K E + YS+A+ D
Sbjct  197  EKLNLELQRSQANLDMNQCEVIQRLLDVTKV-AEYSLPDNCSPEKSHKKEKYSYSNANDD  255

Query  600  K--QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            K   + ++ Y K D   ST   +    S+ DL+S+ GS++  EWH+DLL CCSEP LC+K
Sbjct  256  KGLSSDEKYYAKTD---STVSTSRFSVSQKDLMSTGGSYQQAEWHTDLLACCSEPSLCLK  312

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT A NR +SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  313  TFFYPCGTFSKIATVAKNRPMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGF  372

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +DDFLSHLMCCCCALVQEWRE+EIRG+    KTKTSPP +Q+MES
Sbjct  373  VDDFLSHLMCCCCALVQEWREVEIRGLSAHEKTKTSPPPSQYMES  417



>ref|XP_006572883.1| PREDICTED: uncharacterized protein LOC100811369 isoform X1 [Glycine 
max]
Length=415

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 177/225 (79%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKL+LELQRSQANLD+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSDA+S
Sbjct  196  NEKLKLELQRSQANLDMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDANS  254

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK  + D+ Y    +K      +    ++ DL S+ GS++ E+WH+DLL CCSEP LC+K
Sbjct  255  DKDHSSDEKYHAKIDK---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSEPSLCMK  311

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IA+ A NR ISS EACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  312  TFFYPCGTFSKIASVARNRPISSGEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGF  371

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSHLMCCCCALVQEWRE+EIRG+ G+ KTKTSPP +Q+MES
Sbjct  372  IDDFLSHLMCCCCALVQEWREVEIRGLSGS-KTKTSPPPSQYMES  415



>gb|KHN41878.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=497

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 176/225 (78%), Gaps = 6/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKL+LELQRSQANLD+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSD +S
Sbjct  277  NEKLKLELQRSQANLDMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDVNS  335

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            D+  + D+ Y    +K      +    ++ DL S+ GS++ E+WH+DLL CCSEP LC+K
Sbjct  336  DQDHSSDEKYHAKIDK---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSEPSLCMK  392

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IA+ A NR ISS EACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  393  TFFYPCGTFSKIASVARNRPISSGEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGF  452

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSHLMCCCCALVQEWRE+EIRG+ G+ KTKTSPP +Q+MES
Sbjct  453  IDDFLSHLMCCCCALVQEWREVEIRGLTGSEKTKTSPPPSQYMES  497



>ref|XP_007157885.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157886.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157887.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157888.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29879.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29880.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29881.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29882.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
Length=416

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 176/225 (78%), Gaps = 6/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKL+LELQRSQAN D+NQC+ IQ LLDVTEV AA S+P+K  P K   K E+ YS  +S
Sbjct  196  NEKLKLELQRSQANYDMNQCQVIQRLLDVTEV-AAYSVPEKCSPEKNHKKEEYNYSKDNS  254

Query  603  DKQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK+ + D+ Y    +K      +    ++ D++S+ GS++ E+WH+DLL CCSEP LC+K
Sbjct  255  DKEHSSDERYHAKVDK---HSPSRYSVARKDIVSAGGSYQEEDWHTDLLACCSEPSLCMK  311

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IA+ A NR ISSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  312  TFFYPCGTFSKIASIARNRPISSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGF  371

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSHLMCCCCALVQEWRE+EIRGI    KTKTSPP +Q+MES
Sbjct  372  IDDFLSHLMCCCCALVQEWREVEIRGISAPEKTKTSPPPSQYMES  416



>ref|XP_004287784.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 180/226 (80%), Gaps = 9/226 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQA  DV+QCE IQ L++VTE VAA S P+K+      K+E  +SD +S+
Sbjct  196  NEKLQLELQRSQATYDVSQCEVIQRLIEVTEAVAANSSPEKNQK----KIERDHSDVNSE  251

Query  600  K--QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
                + ++SY K++     SRNTSSVSS HDL+S++GSH + EW++DLLGCCSEP LC K
Sbjct  252  SVHSSDEKSYKKSESH--ISRNTSSVSSGHDLLSNRGSHHHGEWNTDLLGCCSEPSLCFK  309

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT ATNRH+SS EACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  310  TFFYPCGTFSKIATVATNRHMSSGEACNELMAYSLILSCCCYTCCIRRKLRKTLNISGGF  369

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGT-HKTKTSPPSTQFMES  112
            IDDFLSH MCCCCALVQEWRE+EIRG+     KTK SPP +Q+ME+
Sbjct  370  IDDFLSHFMCCCCALVQEWREVEIRGMTYGPEKTKISPPPSQYMEA  415



>gb|KCW53202.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
 gb|KCW53203.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
Length=347

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 177/225 (79%), Gaps = 2/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLEL RSQA LD++QCE IQHL+DVTE V    + +   P K  K V +  SDA++
Sbjct  123  NEKLQLELHRSQATLDMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANN  182

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K +  D+S  K  +  + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+K
Sbjct  183  EKNHPSDESRSKKSDCSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVK  242

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            TLLFPCGTFSR+AT A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I GG+
Sbjct  243  TLLFPCGTFSRVATVASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQGGW  302

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSH +CCCCALVQEWRE+EIRG++G  KT+TS PS Q+M+S
Sbjct  303  FDDFLSHFLCCCCALVQEWREVEIRGVKGPMKTETSAPSLQYMQS  347



>gb|KHN36012.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=409

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 176/225 (78%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKL+LELQRSQANLD+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSDA+S
Sbjct  190  NEKLKLELQRSQANLDMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDANS  248

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK  + D+ Y    +K      +    ++ DL S+ GS++ E+WH+DLL CCSE  LC+K
Sbjct  249  DKDHSSDEKYHAKIDK---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSESSLCMK  305

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IA+ A NR ISS EACN+LMAYSLILSCCCYTCC+RRKLRK L+I GGF
Sbjct  306  TFFYPCGTFSKIASVARNRSISSGEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGGF  365

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSHLMCCCCALVQEWRE+EIRG+ G+ KTKTSPP +Q+MES
Sbjct  366  IDDFLSHLMCCCCALVQEWREVEIRGLSGS-KTKTSPPPSQYMES  409



>ref|XP_010935125.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010935126.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=420

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 175/226 (77%), Gaps = 4/226 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKL LELQRSQA +D+ QCE IQHL+ VT+ VA T     +    P  V+  YSDA++D
Sbjct  196  NEKLHLELQRSQARMDLGQCEVIQHLIGVTQTVACTLQEKNTQLKNPNNVDPDYSDANND  255

Query  600  KQN-YDQSYGKN--DEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            K+N +DQSY K   D K +TSR+ S VS  HD I+ KGS+ + EWHSDLLGCCSEP LC+
Sbjct  256  KENAFDQSYHKEYIDTK-TTSRSASPVSRSHDYIAGKGSYSHNEWHSDLLGCCSEPYLCL  314

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            +T   PCGT ++IAT A NRHISSAEACN+LMAY+L+LSCCCYTCCIRRKLR   +I GG
Sbjct  315  ETFFCPCGTLAKIATVAKNRHISSAEACNDLMAYTLLLSCCCYTCCIRRKLRNMFNIEGG  374

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            F DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  375  FCDDFLSHLMCCCCALVQEWREVEIRGMHGPEKTKTSPPPSQYMES  420



>ref|XP_003612221.1| hypothetical protein MTR_5g022670 [Medicago truncatula]
 gb|AES95179.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=416

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/224 (66%), Positives = 173/224 (77%), Gaps = 6/224 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVE-HGYSDADSD  601
            EKL LELQRSQANLD+NQCE IQ LL+VT+V A  SLPDK  P K  K E + YSD++ D
Sbjct  197  EKLNLELQRSQANLDMNQCEVIQRLLEVTKV-AEYSLPDKCSPEKSHKKENYSYSDSNDD  255

Query  600  K-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K  + D+ Y     K  T   +    S+ D++S+ GS++ E+WH+DLL CCSEP LC+KT
Sbjct  256  KVHSSDEKYHT---KVDTLSQSRYSVSQKDVMSTGGSYQQEDWHTDLLACCSEPSLCMKT  312

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGTFS+IAT   NR +SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF+
Sbjct  313  FFYPCGTFSKIATVVKNRPMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNITGGFV  372

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCALVQEWRE+EIRG+ G  KTKTSPP  Q+MES
Sbjct  373  DDFLSHLMCCCCALVQEWREVEIRGVSGADKTKTSPPPIQYMES  416



>ref|XP_008806599.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=418

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 180/226 (80%), Gaps = 4/226 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKL LELQRSQA +D+ QCE IQHL+ VT+ VA+T L +KS   K  + VE  +SD+++
Sbjct  194  NEKLHLELQRSQARMDLGQCEVIQHLIGVTQTVAST-LQEKSTQLKNSRNVEPDFSDSNN  252

Query  603  DKQN-YDQSYGKND-EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DK++ +D+SY K   +  ++SR  S VS  HD I+ KGS+  EEWHSDLLGCCSEP LC+
Sbjct  253  DKEHAFDRSYHKEHIDTKTSSRTASPVSLSHDYIAGKGSYSDEEWHSDLLGCCSEPYLCL  312

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            +T  +PCGT ++IAT A NRHISSAEACN+LMAY+L+LSCCCYTCCIRRKLRK  +I GG
Sbjct  313  ETFFYPCGTLAKIATVAKNRHISSAEACNDLMAYTLLLSCCCYTCCIRRKLRKMFNIEGG  372

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            F DDFLSHLMCCCCALVQEWRE+E+RG+ G  KTKTSPP +Q+MES
Sbjct  373  FCDDFLSHLMCCCCALVQEWREVELRGVHGPEKTKTSPPPSQYMES  418



>ref|XP_008806598.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=420

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 180/226 (80%), Gaps = 4/226 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKL LELQRSQA +D+ QCE IQHL+ VT+ VA+T L +KS   K  + VE  +SD+++
Sbjct  196  NEKLHLELQRSQARMDLGQCEVIQHLIGVTQTVAST-LQEKSTQLKNSRNVEPDFSDSNN  254

Query  603  DKQN-YDQSYGKND-EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DK++ +D+SY K   +  ++SR  S VS  HD I+ KGS+  EEWHSDLLGCCSEP LC+
Sbjct  255  DKEHAFDRSYHKEHIDTKTSSRTASPVSLSHDYIAGKGSYSDEEWHSDLLGCCSEPYLCL  314

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            +T  +PCGT ++IAT A NRHISSAEACN+LMAY+L+LSCCCYTCCIRRKLRK  +I GG
Sbjct  315  ETFFYPCGTLAKIATVAKNRHISSAEACNDLMAYTLLLSCCCYTCCIRRKLRKMFNIEGG  374

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            F DDFLSHLMCCCCALVQEWRE+E+RG+ G  KTKTSPP +Q+MES
Sbjct  375  FCDDFLSHLMCCCCALVQEWREVELRGVHGPEKTKTSPPPSQYMES  420



>ref|XP_006412042.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412043.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412044.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412045.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53495.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53496.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53497.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53498.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
Length=418

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQ + DV QCE IQ L+ VT+  AA    +K L  K  K ++  S ++  
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQTAAAVDDSEKQLSKKASK-KNERSSSNKT  255

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            + +YD+   K     + SR+TSSV+S HDL+S + S  +EEWH+DLL CCSEP LC+KT 
Sbjct  256  EYSYDEDSPKKSSSRAPSRSTSSVTSGHDLLSRRASQHHEEWHTDLLACCSEPSLCLKTF  315

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT ++IATAATNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFID
Sbjct  316  FFPCGTLAKIATAATNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFID  375

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG  GT KT+ SPPS+QFME
Sbjct  376  DFLSHLMCCCCALVQELREVEIRGAYGTEKTRVSPPSSQFME  417



>ref|XP_004509394.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004509396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Cicer arietinum]
Length=424

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 173/231 (75%), Gaps = 15/231 (6%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQ SQAN+D+NQCEFIQ LLDVTEV AA SLP+   P      EH +   +  
Sbjct  201  NEKLQLELQHSQANMDLNQCEFIQRLLDVTEV-AAYSLPENLSP------EHSHKKVEYS  253

Query  600  KQNYDQSYGK----NDEKWstsr----ntssvsSKHDLISSKGSHRYEEWHSDLLGCCSE  445
            K +Y  + G+    +DEK          + S  S+ +L+S+K SH  E+WH+DLL CCSE
Sbjct  254  KDSYSDANGRKGHSSDEKHRNKSDPLSESKSSVSEKNLLSTKTSHHQEDWHTDLLACCSE  313

Query  444  PLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL  265
            P LC+KTL FPCGT S+IAT A+NR ISSAEACNELMAYS++LSCCCYTCCIRRKLRK +
Sbjct  314  PYLCVKTLFFPCGTLSKIATVASNRPISSAEACNELMAYSMVLSCCCYTCCIRRKLRKMM  373

Query  264  SIPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            +I GG++DDFLSHLMCCCC+LVQEWRE+EIR + G  KT TSPP+ Q+MES
Sbjct  374  NIKGGYVDDFLSHLMCCCCSLVQEWREVEIRVLYGLEKTNTSPPTPQYMES  424



>gb|KCW53201.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
Length=348

 Score =   261 bits (667),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 173/222 (78%), Gaps = 2/222 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLEL RSQA LD++QCE IQHL+DVTE V    + +   P K  K V +  SDA++
Sbjct  123  NEKLQLELHRSQATLDMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANN  182

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K +  D+S  K  +  + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+K
Sbjct  183  EKNHPSDESRSKKSDCSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVK  242

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            TLLFPCGTFSR+AT A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I GG+
Sbjct  243  TLLFPCGTFSRVATVASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQGGW  302

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQF  121
             DDFLSH +CCCCALVQEWRE+EIRG++G  KT+TS PS Q 
Sbjct  303  FDDFLSHFLCCCCALVQEWREVEIRGVKGPMKTETSAPSLQL  344



>ref|XP_009386555.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 173/229 (76%), Gaps = 8/229 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQ+ELQRSQ NLDV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   
Sbjct  197  NEKLQMELQRSQTNLDVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLD  255

Query  603  DKQNYDQSYG-----KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPL  439
            DK++Y  SYG     ++D   ++SR +S  SS HDL+S+K S RYEEWHSDLLGCCSEP 
Sbjct  256  DKEDYS-SYGNYYSQQDDTCKASSRISSIASSGHDLLSNKASSRYEEWHSDLLGCCSEPF  314

Query  438  LCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            LCIKT  FPCGTFS+IA+ A NRH+SSAEACN+ MAY+L+LSCCCYTCCIRRKLRK L+I
Sbjct  315  LCIKTCCFPCGTFSKIASVAKNRHVSSAEACNDFMAYALVLSCCCYTCCIRRKLRKMLNI  374

Query  258  PGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             GG  DDFLSHLMCCCCA VQEWRE+E RG     KTKT+PP++Q+MES
Sbjct  375  TGGLCDDFLSHLMCCCCAFVQEWREVEFRGTNVVDKTKTNPPASQYMES  423



>gb|EYU30814.1| hypothetical protein MIMGU_mgv1a007258mg [Erythranthe guttata]
Length=413

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADS  604
            NEKL LELQ SQANLDV QCE IQHLL+VTE VA+ S   +     K  KVEH Y D  +
Sbjct  193  NEKLHLELQHSQANLDVRQCEVIQHLLEVTEAVASNSSLSEKSSHVKESKVEHLYVDVKT  252

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            + +++D++Y KN +K + SR+TSSVSS+ DL++S  S   +EWHSDLLGCC+EPLLCIKT
Sbjct  253  ENRDFDKNYTKNSQKHAASRSTSSVSSRRDLLASDVSE--DEWHSDLLGCCAEPLLCIKT  310

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              FPCGTFSRIA+AA +R IS AE+CN+LMAYSLILSCCCYTCCIR KLRK L+I GG  
Sbjct  311  SFFPCGTFSRIASAANSRDISPAESCNDLMAYSLILSCCCYTCCIRTKLRKMLNIKGGLF  370

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFLSHLMCCCCALVQEWRE+EIR ++G  K  T+PP+ Q++E
Sbjct  371  DDFLSHLMCCCCALVQEWREVEIRQVKGGLKI-TTPPTIQYIE  412



>dbj|BAH20129.1| AT4G35920 [Arabidopsis thaliana]
Length=421

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 169/226 (75%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   
Sbjct  197  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMK  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLC  433
            ++  +YD+   K     + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYDEDSPKKSSTRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
             KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  FKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GFIDDFLSH+MCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  375  GFIDDFLSHVMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  420



>ref|XP_009418750.1| PREDICTED: cell number regulator 13-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 175/223 (78%), Gaps = 4/223 (2%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADSD  601
            +KLQ+ELQRSQ  +D+ QCE IQHL+ VT  VA T+L +KS   K P KVE  YS  +S 
Sbjct  197  QKLQMELQRSQVTMDIGQCEVIQHLIGVTHNVA-TTLEEKSTHLKSPKKVELSYSGDNSY  255

Query  600  KQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K++ +D++Y +   K ST R  S  SS HD+IS +G H +EEWHSDLLGCCSEP LC KT
Sbjct  256  KEHTFDENYHEQVTK-STYRTGSPHSSGHDMISHRGLHGHEEWHSDLLGCCSEPSLCFKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCGTFS+IA+ A NR +SSAEACN+LMAYSL+LSCCCYTCC+RRKLR   +I GG  
Sbjct  315  FFYPCGTFSQIASVAKNRPVSSAEACNDLMAYSLVLSCCCYTCCVRRKLRNMFNITGGLC  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFLSHL+CCCCALVQEWRE+EIRG++GT KT+T+PP++Q+ME
Sbjct  375  DDFLSHLLCCCCALVQEWREVEIRGVKGTWKTQTNPPASQYME  417



>emb|CDX75539.1| BnaA01g01630D [Brassica napus]
Length=419

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 167/222 (75%), Gaps = 0/222 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQ + DV QCE IQ L+ VT+ VA      +   +K    +   S +   
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQTVAEVDGGSEKELSKKASKKADRSVSHKT  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            + +Y++         + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP LC+KT 
Sbjct  257  EYSYEEDPPMKSTSRAASRSTSSVTSGHDMLSRRASQHHEEWHTDLLACCSEPSLCLKTF  316

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT ++IATAATNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFID
Sbjct  317  FFPCGTLAKIATAATNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFID  376

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  377  DFLSHLMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  418



>ref|NP_195317.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849503.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849504.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 sp|Q8L7E9.1|MCAC1_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 1 [Arabidopsis 
thaliana]
 gb|AAM96959.1| putative protein [Arabidopsis thaliana]
 gb|AAO30093.1| putative protein [Arabidopsis thaliana]
 dbj|BAF46389.1| Mca1 [Arabidopsis thaliana]
 dbj|BAH19557.1| AT4G35920 [Arabidopsis thaliana]
 gb|AEE86589.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86590.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86591.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
Length=421

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 169/226 (75%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   
Sbjct  197  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMK  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLC  433
            ++  +YD+   K     + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYDEDSPKKSSTRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
             KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  FKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GFIDDFLSH+MCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  375  GFIDDFLSHVMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  420



>emb|CDX69186.1| BnaC01g02670D [Brassica napus]
Length=420

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 168/223 (75%), Gaps = 1/223 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAAT-SLPDKSLPAKPLKVEHGYSDADS  604
            NEKLQLELQRSQ + DV QCE IQ L+ VT+ VA      +K L  K    +   S +  
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQTVAEVDGGSEKELSKKASNKKADRSVSHK  256

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
             + +Y++         + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP LC+KT
Sbjct  257  MEYSYEEDPPMKSTSRAASRSTSSVTSGHDMLSRRASLHHEEWHTDLLACCSEPSLCLKT  316

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              FPCGT ++IATAATNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFI
Sbjct  317  FFFPCGTLAKIATAATNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFI  376

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFLSHLMCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  377  DDFLSHLMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  419



>ref|XP_010531102.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531103.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531104.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531105.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531106.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=416

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 170/226 (75%), Gaps = 11/226 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N+KLQLELQRSQ++ DVNQCE IQHL++VTE  AAT  PD     +    +      +S+
Sbjct  197  NQKLQLELQRSQSHYDVNQCEVIQHLIEVTEA-AATVEPD----PEKDSSKKSSHKENSN  251

Query  600  KQNYDQSYGKNDEK----WstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
            K+ Y  SYG++  K     S SR TSSVSS HDL+S++ S   EEW +DLL CCSEP LC
Sbjct  252  KEEY--SYGEDSPKKISSRSASRTTSSVSSGHDLLSTRSSKHREEWETDLLDCCSEPSLC  309

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +KT  FPCGT ++I T ATNRH SSAE CNELMAYSLILSCCCYTCCIR KLRK+L+I G
Sbjct  310  LKTFFFPCGTLAKIVTVATNRHTSSAETCNELMAYSLILSCCCYTCCIRGKLRKRLNITG  369

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GFIDDFLSHLMCCCCALVQEWRE++IRG     KTK SPP++QFME
Sbjct  370  GFIDDFLSHLMCCCCALVQEWREVDIRGAYAQEKTKISPPTSQFME  415



>ref|XP_002867046.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43305.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   253 bits (646),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 170/226 (75%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQLELQRSQ + +V QCE IQ L+ VT+  AA   PD  K L  K  K     S   
Sbjct  197  NEKLQLELQRSQEHYNVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMK  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLC  433
            ++  +YD+   K     + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYDEDSPKKSSSRTASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  LKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GFIDDFLSHLMCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  375  GFIDDFLSHLMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  420



>emb|CAA18486.1| putative protein [Arabidopsis thaliana]
 emb|CAA21478.1| putative protein [Arabidopsis thaliana]
 emb|CAB81501.1| putative protein [Arabidopsis thaliana]
Length=447

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 169/226 (75%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   
Sbjct  223  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMK  281

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLC  433
            ++  +YD+   K     + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  282  TE-YSYDEDSPKKSSTRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLC  340

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
             KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  341  FKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  400

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GFIDDFLSH+MCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  401  GFIDDFLSHVMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  446



>ref|XP_003629262.1| Cornifelin [Medicago truncatula]
 gb|AET03738.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=424

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 169/228 (74%), Gaps = 8/228 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV----EHGYSD  613
            NEKLQLEL  SQAN+D+NQCEFIQ LLDVT   AA SLP+K  P    ++     + +SD
Sbjct  200  NEKLQLELHHSQANMDINQCEFIQRLLDVTNF-AAYSLPEKLSPEDNYQIVEYSNNSHSD  258

Query  612  ADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
            A+  K +   S  K+ +K     ++ +  S+ + +S++ S++ E+WH+DLL CCSEP LC
Sbjct  259  ANGSKGH--SSNEKHHKKSDILSSSRTKVSEKNPVSTRSSYQQEDWHTDLLACCSEPYLC  316

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            IKT  +PCGTFS+IAT ATNR ISSAE CN+ +AYSL+LSCCCYTCCIRRKLRK ++IPG
Sbjct  317  IKTFFYPCGTFSKIATVATNRPISSAEVCNDFIAYSLVLSCCCYTCCIRRKLRKMMNIPG  376

Query  252  GFIDDFLSHLMCCCCALVQEWreieir-gieGTHKTKTSPPSTQFMES  112
            G++DDFLSHLMCC CALVQEWRE++IR   E   KT  SPP+ Q+MES
Sbjct  377  GYVDDFLSHLMCCSCALVQEWREVQIRGVYEEPEKTNISPPTAQYMES  424



>ref|XP_009148721.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
 ref|XP_009148775.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
Length=419

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 167/222 (75%), Gaps = 0/222 (0%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQ + DV QCE IQ L+ VT+ VA      +   +K    +   S +   
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQTVAEVDGGSEKELSKKASKKADRSVSHKT  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            + +Y++         + SR+TSSV+S H+++S + S  +EEWH+DLL CCSEP LC+KT 
Sbjct  257  EYSYEEDPPVKSTSRAASRSTSSVTSGHEMLSRRASLHHEEWHADLLACCSEPSLCLKTF  316

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT ++IATAATNRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GGFID
Sbjct  317  FFPCGTLAKIATAATNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFID  376

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG  GT KTK SPPS+QFME
Sbjct  377  DFLSHLMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME  418



>ref|XP_006282626.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 ref|XP_006282627.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15524.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15525.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
Length=421

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 170/226 (75%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQLELQRSQ + DV QCE IQ L+ VT+  A+   PD  K L  K  K     S  +
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQAAASVD-PDSEKELTKKASKKAERTSSMN  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGS--HRYEEWHSDLLGCCSEPLLC  433
            ++  +YD++  K     + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYDENTPKKSSSRAASRSTSNVSSGHDLLSRRASMAQHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +KT  FPCG  ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  LKTFFFPCGALAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GFIDDFLSHLMCCCCALVQE RE+EIRG  G  KTK SPPS+QFME
Sbjct  375  GFIDDFLSHLMCCCCALVQELREVEIRGAYGMEKTKISPPSSQFME  420



>gb|KHN35538.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=415

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 169/223 (76%), Gaps = 4/223 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ D
Sbjct  197  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGD  254

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K +   S  K  EK  T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT 
Sbjct  255  KGH--SSNEKIHEKNDTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTC  312

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             +PCGT S+IAT A NR ISSAE CNELMAYSLILSCCCYTCCIRRKLRK L+I GGFID
Sbjct  313  FYPCGTLSKIATVANNRPISSAETCNELMAYSLILSCCCYTCCIRRKLRKMLNIRGGFID  372

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DFLSHLMCCCCALVQE RE+EIRG+EG  KT T PP +Q+MES
Sbjct  373  DFLSHLMCCCCALVQERREVEIRGVEGPEKTNTRPPPSQYMES  415



>ref|XP_003548830.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=415

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 169/223 (76%), Gaps = 4/223 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ D
Sbjct  197  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGD  254

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K +   S  K  EK  T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT 
Sbjct  255  KGH--SSNEKIHEKNDTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTC  312

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             +PCGT S+IAT A NR ISSAE CNELMAYSLILSCCCYTCCIRRKLRK L+I GGFID
Sbjct  313  FYPCGTLSKIATVANNRPISSAETCNELMAYSLILSCCCYTCCIRRKLRKMLNIRGGFID  372

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DFLSHLMCCCCALVQE RE+EIRG+EG  KT T PP +Q+MES
Sbjct  373  DFLSHLMCCCCALVQERREVEIRGVEGPEKTNTRPPPSQYMES  415



>ref|XP_006574663.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006574664.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006574665.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
 ref|XP_006574666.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=418

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 170/226 (75%), Gaps = 10/226 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV A   L D     K ++  ++ YSDA+ 
Sbjct  200  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEVAA---LYDSKKNHKTVEYSDYSYSDANG  256

Query  603  DK--QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DK   + ++ + KND    T   + S  S+ DL+S+ GS+  E+WH+DLL CCSEP LC 
Sbjct  257  DKAHSSNEKIHKKND----THSASGSSVSEKDLLSTGGSYHREDWHTDLLACCSEPCLCF  312

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT  +PCGT S+IAT A NR ISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG
Sbjct  313  KTCFYPCGTLSKIATVANNRPISSAEACNELMAYSLILSCCCYTCCMRRKLRKMLNIRGG  372

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            FIDDFLSHLMCCCCALVQE RE+EI G+EG   T T PP +Q+MES
Sbjct  373  FIDDFLSHLMCCCCALVQERREVEIHGVEGPENTNTRPPPSQYMES  418



>ref|XP_003519857.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
 gb|KHN00454.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=416

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 170/226 (75%), Gaps = 10/226 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV A   L D     K ++  ++ YSDA+ 
Sbjct  198  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEVAA---LYDSKKNHKTVEYSDYSYSDANG  254

Query  603  DK--QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DK   + ++ + KND    T   + S  S+ DL+S+ GS+  E+WH+DLL CCSEP LC 
Sbjct  255  DKAHSSNEKIHKKND----THSASGSSVSEKDLLSTGGSYHREDWHTDLLACCSEPCLCF  310

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT  +PCGT S+IAT A NR ISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG
Sbjct  311  KTCFYPCGTLSKIATVANNRPISSAEACNELMAYSLILSCCCYTCCMRRKLRKMLNIRGG  370

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            FIDDFLSHLMCCCCALVQE RE+EI G+EG   T T PP +Q+MES
Sbjct  371  FIDDFLSHLMCCCCALVQERREVEIHGVEGPENTNTRPPPSQYMES  416



>ref|XP_010033519.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Eucalyptus 
grandis]
Length=464

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLEL RSQA LD++QCE IQHL+DVTE V    + +   P K  K V +  SDA++
Sbjct  123  NEKLQLELHRSQATLDMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANN  182

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K +  D+S  K  +  + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+K
Sbjct  183  EKNHPSDESRSKKSDCSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVK  242

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            TLLFPCGTFSR+AT A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I GG+
Sbjct  243  TLLFPCGTFSRVATVASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQGGW  302

Query  246  IDDFLSHLMCCCCALVQEW  190
             DDFLSH +CCCCALVQEW
Sbjct  303  FDDFLSHFLCCCCALVQEW  321



>ref|NP_001049013.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|ABF94063.1| Protein of unknown function, DUF614 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10927.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|EEC74547.1| hypothetical protein OsI_10083 [Oryza sativa Indica Group]
 dbj|BAJ40168.1| mid1-complementing activity 1 [Oryza sativa Japonica Group]
Length=418

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 165/225 (73%), Gaps = 6/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVE--HGYSDA  610
            +EKLQ+ELQRSQ+N+D+ QCE IQHLL VT+ VA +S+P+K + P    K +  H     
Sbjct  196  SEKLQVELQRSQSNMDMGQCEVIQHLLGVTKTVA-SSIPEKCATPKVSEKADSNHTKVSE  254

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DS K  +D S  K  +  +  R++   S  HDL+SS+GS+  +EWH+DLLGCCSEP LC+
Sbjct  255  DSAKTYHDDSPKKQKDACTAPRSSPPSSYGHDLVSSRGSYS-DEWHADLLGCCSEPSLCL  313

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            +T  FPCGTFS+IA+ A NR +SS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG
Sbjct  314  RTFFFPCGTFSKIASIAKNRPMSSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGG  373

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
             IDDFLSHLMCCCCALVQEW            +TK SPPS Q+ME
Sbjct  374  CIDDFLSHLMCCCCALVQEW-REVEIRGAYGERTKISPPSFQYME  417



>ref|XP_010526810.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010526811.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=409

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 160/227 (70%), Gaps = 20/227 (9%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N+KLQLELQ SQ++ DVNQCE IQ L+DVTE VA+                  Y + DS 
Sbjct  197  NQKLQLELQHSQSHYDVNQCEVIQRLIDVTEAVASVD---------------SYPEKDSS  241

Query  600  KQNYDQSYGKNDEKWstsrntssvsSK-----HDLISSKGSHRYEEWHSDLLGCCSEPLL  436
            K++Y +      E    S  +SS ++      HDL+SS+ SH +EEW +DLL CC +P L
Sbjct  242  KKSYHKDASDKKESSYDSSRSSSRTASSVSSGHDLLSSRASHHHEEWETDLLDCCLDPSL  301

Query  435  CIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIP  256
            C+KT  FPCGT ++I T AT+RH SSAE CNELMAYSL+LSCCCYTCCIR KLRK+L+I 
Sbjct  302  CLKTFFFPCGTLAKITTVATDRHTSSAETCNELMAYSLVLSCCCYTCCIRGKLRKRLNIT  361

Query  255  GGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GGFIDDFLSHLMCCCCALVQEWRE+EIRG     KTK SPPS+QFME
Sbjct  362  GGFIDDFLSHLMCCCCALVQEWREVEIRGAYAQEKTKVSPPSSQFME  408



>ref|XP_010446852.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446853.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 168/226 (74%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQLELQRSQ + DV QCE IQ L+ VT+  A+   PD  K L  K  K     S  +
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQAAASVD-PDSEKELTKKASKKAERTSSMN  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGS--HRYEEWHSDLLGCCSEPLLC  433
            ++  +Y++   K     + SR+ S+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYEEDTPKKSNSRAASRSASNVSSGHDLLSRRASLAEHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  LKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            G IDDFLSH+MCCCCALVQE RE+EIRG  G  KTK SPPS+QFME
Sbjct  375  GLIDDFLSHVMCCCCALVQELREVEIRGAYGMEKTKISPPSSQFME  420



>ref|XP_006846924.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
 gb|ERN08505.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
Length=421

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQRSQAN+DV QCE IQHL+DVTE VA       S      +VE     A+++
Sbjct  197  NEKLQVELQRSQANMDVGQCEVIQHLIDVTETVANNLSEKNSHSRNSKQVEPDCPSANNE  256

Query  600  KQ-NYDQSYGKND-EKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            K+   D  Y +   +  + SRN S VSS  DLIS +GSHR +EWH+DLLGCCSEP LC+K
Sbjct  257  KEYEMDDVYHRQQHDTHTPSRNASPVSSGRDLISVRGSHRSDEWHTDLLGCCSEPCLCLK  316

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGT S+IA  A+N   S  +ACN+LM YSL+L+CCCYTCC+RRKLRK L+I GG 
Sbjct  317  TCFYPCGTSSKIAAVASNGDTSPEQACNDLMTYSLLLACCCYTCCVRRKLRKMLNITGGV  376

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSHLMCCCCALVQEWRE+EIRG  GT+KTKTSPP++Q+MES
Sbjct  377  CDDFLSHLMCCCCALVQEWREVEIRGAYGTYKTKTSPPASQYMES  421



>ref|XP_009138395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
 ref|XP_009138396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
Length=416

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 167/228 (73%), Gaps = 15/228 (7%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAAT-SLPDKSLPAKPLK-----VEHGY  619
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+ V       +K L  K  +     VE+ Y
Sbjct  197  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQTVGEVDGGSEKELSKKASRKTDHTVEYSY  256

Query  618  SDADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPL  439
             + D         + K     + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP 
Sbjct  257  EEED---------HPKKSSSRAASRSTSSVTSSHDMLSRRESQHHEEWHTDLLACCSEPS  307

Query  438  LCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            LC+KT  FPCGT ++IATAATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  308  LCLKTFFFPCGTLAKIATAATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNI  367

Query  258  PGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
             GG+IDDFLSHLMCCCCALVQE RE+EIRG  GT KTK SPP +QFME
Sbjct  368  TGGYIDDFLSHLMCCCCALVQELREVEIRGAYGTEKTKVSPPPSQFME  415



>emb|CDY47043.1| BnaAnng08310D [Brassica napus]
Length=416

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 167/228 (73%), Gaps = 15/228 (7%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAAT-SLPDKSLPAKPLK-----VEHGY  619
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+ V       +K L  K  +     VE+ Y
Sbjct  197  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQTVGEVDGGSEKELSKKASRKTDHTVEYSY  256

Query  618  SDADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPL  439
             + D         + K     + SR+TSSV+S HD++S + S  +EEWH+DLL CCSEP 
Sbjct  257  EEED---------HPKKSSSRAASRSTSSVTSSHDMLSRRESQHHEEWHTDLLACCSEPS  307

Query  438  LCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            LC+KT  FPCGT ++IATAATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  308  LCLKTFFFPCGTLAKIATAATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNI  367

Query  258  PGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
             GG+IDDFLSHLMCCCCALVQE RE+EIRG  GT KTK SPP +QFME
Sbjct  368  TGGYIDDFLSHLMCCCCALVQELREVEIRGAYGTEKTKVSPPPSQFME  415



>ref|XP_010432209.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010432210.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437400.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437401.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 168/226 (74%), Gaps = 6/226 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQLELQRSQ + DV QCE IQ L+ VT+  A+   PD  K L  K  K     S  +
Sbjct  197  NEKLQLELQRSQEHYDVAQCEVIQRLIGVTQAAASVD-PDSEKELTKKASKKAERTSSMN  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGS--HRYEEWHSDLLGCCSEPLLC  433
            ++  +Y++   K     + SR+ S+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYEEDTPKKSSSRAASRSASNVSSGHDLLSRRASLAEHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  LKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            G IDDFLSH+MCCCCALVQE RE+EIRG  G  KTK SPPS+QFME
Sbjct  375  GLIDDFLSHVMCCCCALVQELREVEIRGAYGMEKTKISPPSSQFME  420



>ref|XP_006649427.1| PREDICTED: cell number regulator 13-like [Oryza brachyantha]
Length=419

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 171/225 (76%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVEHGYS--DA  610
            +EKLQ+ELQRSQ+N+D+ QCE IQHLL VT+ VA +S+PDK + P    K +   +  + 
Sbjct  198  SEKLQVELQRSQSNMDMGQCEVIQHLLGVTKTVA-SSIPDKCATPKVSEKCDSNLTKINE  256

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            +S K   D S  K  +     R++   S  HDL+SS+GS+  +EWH+DLLGCC+EP LC+
Sbjct  257  ESAKTYDDDSPKKQKDACGAPRSSLPSSYGHDLVSSRGSYS-DEWHADLLGCCTEPSLCL  315

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            +T  FPCGTFSRIA+ A NR ISS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG
Sbjct  316  RTFFFPCGTFSRIASIAKNRPISSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGG  375

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
             IDDFLSHLMCCCCALVQEWRE+EIRG     +TK SPPS Q+ME
Sbjct  376  CIDDFLSHLMCCCCALVQEWREVEIRGAY--DETKISPPSFQYME  418



>ref|XP_009408216.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 165/225 (73%), Gaps = 9/225 (4%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKLQ+ELQRS    D+ QCE IQHL+ VT+ VA+T     +    P KVE  YSD ++ K
Sbjct  197  EKLQMELQRS---YDIGQCEMIQHLIGVTQNVASTIEERSTQLKSPNKVELNYSDENNYK  253

Query  597  QNYDQSYGKNDEKWstsrntssvsSK---HDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +   +++GKN  +  T     + SS    HD+   +  H +EEWHSDLLGCCSEP LC+K
Sbjct  254  E---KTFGKNSHEQDTKATFRTTSSDSLGHDMSLHREHHGHEEWHSDLLGCCSEPSLCMK  310

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT A NR ++SAEACN+LMAYSLILSCCCYTCCIRRKLRK   I GG 
Sbjct  311  TFFYPCGTFSQIATVAKNRPVTSAEACNDLMAYSLILSCCCYTCCIRRKLRKMFDITGGL  370

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSHL+CCCCALVQEWRE+EIRG++   KTKTSPP++Q+ME+
Sbjct  371  CDDFLSHLLCCCCALVQEWREVEIRGVKEPWKTKTSPPASQYMEA  415



>emb|CDX72565.1| BnaC07g45870D [Brassica napus]
Length=414

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 166/224 (74%), Gaps = 10/224 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVA-ATSLPDKSLPAKPLKVEHGYSDADS  604
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+ V       +K L  K  +    YS    
Sbjct  198  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQTVGEVQGGSEKELAKKASRKTVEYS----  253

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGS-HRYEEWHSDLLGCCSEPLLCIK  427
                Y++ + K     + SR+TSSV+S+HD++S + S H  EEWH+DLL CCSEP LC+K
Sbjct  254  ----YEEDHPKKSSSRAASRSTSSVTSRHDMLSRRESQHHEEEWHTDLLACCSEPSLCLK  309

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  FPCGT ++IATAATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I GG+
Sbjct  310  TFFFPCGTLAKIATAATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGY  369

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            IDDFLSHLMCCCCALVQE RE+EIRG  G  KTK SPP +QFME
Sbjct  370  IDDFLSHLMCCCCALVQELREVEIRGAYGMEKTKVSPPPSQFME  413



>ref|XP_007156188.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 ref|XP_007156189.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28182.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28183.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
Length=415

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 166/227 (73%), Gaps = 12/227 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAA--TSLPDKSLPAKPLKVEHGYSDAD  607
            NEKLQ+ELQ SQAN+D+ Q EFIQHLLDVTEV A   +   +K++          YSDA+
Sbjct  197  NEKLQVELQHSQANMDIYQYEFIQHLLDVTEVAAHYHSEKNNKTVEYSG----SSYSDAN  252

Query  606  SDKQNY--DQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
              K +   +  + KND    T  ++ S  S+ DL+S  GS+  E+WH+DLL CCSEP LC
Sbjct  253  GGKPHSSDENIHKKND----TLSSSRSSVSEKDLLSRGGSYNREDWHTDLLACCSEPCLC  308

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            IKT   PCGT S IA+ ATNR ISSAEACNELMAYSLILSCCCYTCCIR KLRK L+I G
Sbjct  309  IKTCFCPCGTLSNIASVATNRPISSAEACNELMAYSLILSCCCYTCCIRSKLRKMLNIRG  368

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            G+IDDFLSHLMCCCCALVQEWRE+EIRG  G+ KT T PP +Q+MES
Sbjct  369  GYIDDFLSHLMCCCCALVQEWREVEIRGASGSEKTNTKPPPSQYMES  415



>ref|XP_010113309.1| hypothetical protein L484_026640 [Morus notabilis]
 gb|EXC35316.1| hypothetical protein L484_026640 [Morus notabilis]
Length=397

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 165/225 (73%), Gaps = 26/225 (12%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQAN DVNQCE IQ L+DVTE VA  ++PDKS P K   K+E  YSD +S
Sbjct  197  NEKLQLELQRSQANYDVNQCEVIQRLIDVTETVAENTVPDKSSPEKSHKKMERNYSDDNS  256

Query  603  DKQNY-DQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K++  D+ Y K  +   TSRNTSSVSS HDL+S++ S R+EEW +DLLGCCSEP L   
Sbjct  257  EKEDSSDEKYSKRGDSRVTSRNTSSVSSGHDLLSTRCSRRHEEWSNDLLGCCSEPSL---  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
                                 S AEACNELMAYSLILSCCCYTCCIRRKLRK L+I GGF
Sbjct  314  ---------------------SPAEACNELMAYSLILSCCCYTCCIRRKLRKTLNITGGF  352

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSH MCCCCALVQEWRE+EIRG+ G  KTKTSPP +Q+MES
Sbjct  353  IDDFLSHFMCCCCALVQEWREVEIRGVYGPEKTKTSPPPSQYMES  397



>gb|EMS65760.1| hypothetical protein TRIUR3_02105 [Triticum urartu]
Length=344

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 168/225 (75%), Gaps = 6/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY---SDA  610
            +EKLQ+ELQRSQ+N+D+ QCE I HLL VT  VA +S+P++S  AK  K  +      + 
Sbjct  122  SEKLQVELQRSQSNMDMAQCEVIHHLLGVTRTVA-SSIPEESTDAKVTKKTNSKCTKVNE  180

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DS K   D S  K  + +   R++S V   HDL+SS  S+  +EWH+DLLGCCSEP LC+
Sbjct  181  DSAKSYDDDSPKKQKDAYIAPRSSSPVPYNHDLVSSTASYS-DEWHADLLGCCSEPALCL  239

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT  FPCGTFSRIA+ A N+ +SS EACN++MAYSL+LSCCCYTCC+RRKLR++L+I GG
Sbjct  240  KTFFFPCGTFSRIASIAKNKPMSSGEACNDIMAYSLVLSCCCYTCCVRRKLRQRLNIAGG  299

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
              DDFLSH+MCCCCALVQEWRE+EIRG  G  KTK +PP+ Q+ME
Sbjct  300  CCDDFLSHVMCCCCALVQEWREVEIRGAYGG-KTKITPPAHQYME  343



>gb|ACN26521.1| unknown [Zea mays]
 tpg|DAA43436.1| TPA: putative cell number regulator 13 [Zea mays]
Length=428

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 162/235 (69%), Gaps = 16/235 (7%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYS----  616
            +EKLQ+ELQRSQ+N+D+  CE IQHLL VT+ V +T +P+K    K P K    YS    
Sbjct  196  SEKLQVELQRSQSNMDLGSCEVIQHLLGVTKTVEST-IPEKETNVKAPEKKGSNYSESKG  254

Query  615  --------DADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLL  460
                    D D  K+  D    K  E  ST R +S V   HDL+SS+GS+  +EWH+DLL
Sbjct  255  ETAKSFDDDDDYPKKQNDDYPKKQKETCSTQRCSSQVPYGHDLVSSRGSYS-DEWHADLL  313

Query  459  GCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRK  280
            GCCSEP LC+KTL FPCGTFSRIA+ A +R +SS EACN++MAYSLILSCCCYTCC+RRK
Sbjct  314  GCCSEPALCLKTLFFPCGTFSRIASIAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRK  373

Query  279  LRKKLSIPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            LR+KL I GG  DDFLSHL+CCCCALVQEW          + KTK +PP+ Q+ME
Sbjct  374  LRQKLDIAGGCCDDFLSHLLCCCCALVQEW-REVEIRGAYSEKTKVTPPACQYME  427



>ref|XP_008440854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440855.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
Length=415

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 161/225 (72%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADS  604
            NEKLQLELQ SQ+N+DV QC+ I+ L D+TE ++A    +K L    P + E+ YSDA+ 
Sbjct  196  NEKLQLELQISQSNMDVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHEYNYSDANG  255

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +  + YD ++ KN +    +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+K
Sbjct  256  ETTHAYDGNFHKNRDG-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMK  312

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T   PC T S++A+ ATNRH+SSA+ACNELMAYSL+ SCCCYTCC RRKLR  L+I GG 
Sbjct  313  TFFCPCWTLSKVASVATNRHVSSADACNELMAYSLVFSCCCYTCCFRRKLRSMLNIKGGL  372

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSH +CCCCALVQEW   E+    G   TKT PP  Q+MES
Sbjct  373  IDDFLSHFLCCCCALVQEW--REVEMRCGPENTKTIPPPLQYMES  415



>ref|XP_010680410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=410

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 165/224 (74%), Gaps = 7/224 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKL+LELQRSQ NLD+ QCE IQ LLDVT+  A     +KS   K      G   A   
Sbjct  193  NEKLRLELQRSQTNLDMTQCEVIQRLLDVTQTAAVVCETEKSESVK------GNKRAQPP  246

Query  600  KQNYDQSY-GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
              N   S+ G + +K   SR  S+VSS+ DL+S++ SH + EWH+DLL CC+EP LC+KT
Sbjct  247  YANEKYSFDGTSPKKNEISRTASTVSSRRDLLSNRSSHHHGEWHTDLLDCCAEPCLCLKT  306

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            + +PCGTF++I+T A N+++SSAEACN+L+AYSLILSCCCYTCC+R KLRK L+I GG  
Sbjct  307  IFYPCGTFAKISTVANNKYMSSAEACNDLVAYSLILSCCCYTCCVRGKLRKILNINGGVF  366

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSH MCCCCALVQE+RE+EIRG+ G  KTKT PP +QFMES
Sbjct  367  DDFLSHFMCCCCALVQEYREVEIRGVCGHEKTKTMPPISQFMES  410



>ref|XP_004985646.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=418

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 162/225 (72%), Gaps = 6/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            +EKLQ+ELQRSQ+++D+  CE IQHLL VT+ VA T +P++   AK  + +  Y ++  D
Sbjct  196  SEKLQVELQRSQSHMDLGSCEVIQHLLGVTKTVACT-IPEEETNAKVSEKDSNYKESKGD  254

Query  600  --KQNYDQSY-GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
              K   D  Y  K  +  ST R +S VS  HDL+S +GS+  +EWH+DLLGCCSEP LC+
Sbjct  255  VAKSYDDDDYPKKQKDACSTQRCSSPVSYGHDLVSRRGSYS-DEWHADLLGCCSEPALCL  313

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KTL FPCGTFSRIA+ A +R +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG
Sbjct  314  KTLFFPCGTFSRIASVAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGG  373

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
              DDFLSHL+CCCCALVQEW            KTKT+PP  Q+ME
Sbjct  374  CCDDFLSHLLCCCCALVQEW-REVEIRGAYGEKTKTTPPPCQYME  417



>ref|XP_002468480.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
 gb|EER95478.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
Length=420

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 161/227 (71%), Gaps = 8/227 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPL-KVEHGYSDADS  604
            +EKLQ+ELQRSQ+N+D+  CE IQHL+ VT+ V +T +P++   AK   K    YS++  
Sbjct  196  SEKLQVELQRSQSNMDLGSCEVIQHLIGVTKTVEST-IPEEETNAKASEKKGSNYSESKG  254

Query  603  DKQ---NYDQSYGKNDEKW-stsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLL  436
            D     + D  Y K  +   ST R +S V   HDL+SS+GS+  +EWH+DLLGCCSEP L
Sbjct  255  DNAKSFDDDDDYPKKQKDTCSTQRFSSQVPYGHDLVSSRGSYS-DEWHADLLGCCSEPAL  313

Query  435  CIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIP  256
            C KTL FPCGTFSRIA+ A +R +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I 
Sbjct  314  CFKTLFFPCGTFSRIASVAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIA  373

Query  255  GGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            GG  DDFLSHL+CCCCALVQEW          T KTK +PP  Q+ME
Sbjct  374  GGCCDDFLSHLLCCCCALVQEW-REVEIRGAYTEKTKVTPPPCQYME  419



>ref|XP_003558777.1| PREDICTED: cell number regulator 13 [Brachypodium distachyon]
Length=412

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 159/225 (71%), Gaps = 9/225 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            +EKLQ+ELQRSQ+N+D+ QCE I HLL VT+ VA +S+PD+S  AK  K  +   +    
Sbjct  193  SEKLQVELQRSQSNMDMGQCEVIHHLLGVTKTVA-SSIPDESTNAKVTKKTDSNKTKVSE  251

Query  603  DK-QNYD-QSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            D  Q+YD  S  K  +     R++S V   HDL+SS      +EWH+DLLGCCSEP LC+
Sbjct  252  DSAQSYDYDSPKKQKDACDAPRSSSPVPYGHDLVSSTS----DEWHADLLGCCSEPSLCL  307

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT  FPCGTFSRIA+ A NR +SS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG
Sbjct  308  KTFFFPCGTFSRIASVAKNRPMSSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGG  367

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
              DDFLSH+MCCCCALVQEW            KTK +PP  Q+ME
Sbjct  368  CCDDFLSHVMCCCCALVQEW-REVEIRGAYGEKTKVTPPPCQYME  411



>ref|NP_001182136.1| cell number regulator 13 [Zea mays]
 sp|B6SJQ0.1|CNR13_MAIZE RecName: Full=Cell number regulator 13; AltName: Full=ZmCNR13 
[Zea mays]
 gb|ACG25083.1| domain of unknown function DUF614 containing protein [Zea mays]
 gb|ADI48426.1| cell number regulator 13 [Zea mays]
Length=428

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 164/236 (69%), Gaps = 18/236 (8%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYS----  616
            +EKLQ+ELQRSQ+N+D+  CE IQHLL VT+ V +T +P+K    K P K    YS    
Sbjct  196  SEKLQVELQRSQSNMDLGSCEVIQHLLGVTKTVEST-IPEKETNVKAPEKKGSNYSESKG  254

Query  615  ------DADSD---KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDL  463
                  D D D   KQN D    + D   ST R +S V   HDL+SS+GS+  +EWH+DL
Sbjct  255  ETAKSFDDDDDYPKKQNGDYPKKQKD-TCSTQRCSSQVPYGHDLVSSRGSYS-DEWHADL  312

Query  462  LGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRR  283
            LGCCS+P LC+KTL FPCGTFSRIA+ A +R +SS EACN++MAYSLILSCCCYTCC+RR
Sbjct  313  LGCCSKPALCLKTLFFPCGTFSRIASIAKDRPMSSGEACNDIMAYSLILSCCCYTCCVRR  372

Query  282  KLRKKLSIPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            KLR+KL I GG  DDFLSHL+CCCCALVQEW          + KTK +PP+ Q+ME
Sbjct  373  KLRQKLDIAGGCCDDFLSHLLCCCCALVQEW-REVEIRGAYSEKTKVTPPACQYME  427



>ref|XP_004135021.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 ref|XP_004158901.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
Length=416

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 160/225 (71%), Gaps = 7/225 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADS  604
            NEKLQLELQ SQ+N+DV QC+ I+ L D+TE ++A    +K L    P + ++ YSD + 
Sbjct  197  NEKLQLELQISQSNMDVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHDYNYSDTNG  256

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +  + Y  ++ KN +    +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+K
Sbjct  257  ETTHAYVGNFHKNRDG-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMK  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T   PC T S++A+ ATNRH+SSA+ACNELMAYSL+ SCCCYTCC RRKLR KL+I GG 
Sbjct  314  TFFCPCWTLSKVASVATNRHVSSADACNELMAYSLVFSCCCYTCCFRRKLRSKLNIKGGL  373

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            IDDFLSH +CCCCALVQEW   E+    G   TKT PP  Q+MES
Sbjct  374  IDDFLSHFLCCCCALVQEW--REVEMRCGPENTKTIPPPLQYMES  416



>ref|XP_006599313.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006599314.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006599315.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
Length=432

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ D
Sbjct  197  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGD  254

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K +   S  K  EK  T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT 
Sbjct  255  KGH--SSNEKIHEKNDTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTC  312

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             +PCGT S+IAT A NR ISSAE CNELMAYSLILSCCCYTCCIRRKLRK L+I GGFID
Sbjct  313  FYPCGTLSKIATVANNRPISSAETCNELMAYSLILSCCCYTCCIRRKLRKMLNIRGGFID  372

Query  240  DFLSHLMCCCCALVQE  193
            DFLSHLMCCCCALVQE
Sbjct  373  DFLSHLMCCCCALVQE  388



>gb|AAK32909.1|AF367322_1 AT4g35920/F4B14_190 [Arabidopsis thaliana]
 gb|AAM91434.1| AT4g35920/F4B14_190 [Arabidopsis thaliana]
Length=440

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPD--KSLPAKPLKVEHGYSDAD  607
            NEKLQ+ELQRSQ + DV QCE IQ L+ VT+  AA   PD  K L  K  K     S   
Sbjct  197  NEKLQIELQRSQEHYDVAQCEVIQRLIGVTQAAAAVE-PDSEKELTKKASKKSERSSSMK  255

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLC  433
            ++  +YD+   K     + SR+TS+VSS HDL+S + S    +EEWH+DLL CCSEP LC
Sbjct  256  TE-YSYDEDSPKKSSTRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLC  314

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
             KT  FPCGT ++IATAA+NRHISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I G
Sbjct  315  FKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITG  374

Query  252  GFIDDFLSHLMCCCCALVQE  193
            GFIDDFLSH+MCCCCALVQE
Sbjct  375  GFIDDFLSHVMCCCCALVQE  394



>ref|XP_009408218.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKLQ+ELQRS    D+ QCE IQHL+ VT+ VA+T     +    P KVE  YSD ++ K
Sbjct  197  EKLQMELQRS---YDIGQCEMIQHLIGVTQNVASTIEERSTQLKSPNKVELNYSDENNYK  253

Query  597  QNYDQSYGKNDEKWstsrntssvsSK---HDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +   +++GKN  +  T     + SS    HD+   +  H +EEWHSDLLGCCSEP LC+K
Sbjct  254  E---KTFGKNSHEQDTKATFRTTSSDSLGHDMSLHREHHGHEEWHSDLLGCCSEPSLCMK  310

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT A NR ++SAEACN+LMAYSLILSCCCYTCCIRRKLRK   I GG 
Sbjct  311  TFFYPCGTFSQIATVAKNRPVTSAEACNDLMAYSLILSCCCYTCCIRRKLRKMFDITGGL  370

Query  246  IDDFLSHLMCCCCALVQEW  190
             DDFLSHL+CCCCALVQEW
Sbjct  371  CDDFLSHLLCCCCALVQEW  389



>ref|XP_011074700.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=403

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 156/225 (69%), Gaps = 14/225 (6%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYS--DAD  607
            +EKL+LELQ SQA++DV QCE I+ L++VTE  A + L + S    P+K +        +
Sbjct  191  HEKLKLELQNSQAHMDVGQCEVIERLIEVTENAANSVLENGSPSKSPVKSKTDKEPFSGE  250

Query  606  SDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            ++ + YD S    +         +++SS H++ S K     EEWHSDLLGCCSEP LC+K
Sbjct  251  NNAKKYDSSTSPRE---------TTISSGHNVASMKEIIWKEEWHSDLLGCCSEPYLCMK  301

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T L PC T S+IA+AAT + ISSA+ACN++MAY+LIL+CCCYTCCIRRKLR++L I GG 
Sbjct  302  TFLCPCDTISKIASAATGKEISSAQACNDIMAYTLILACCCYTCCIRRKLRRRLDIKGGM  361

Query  246  IDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
             DDFLSH+MCCCCALVQEW       I G HKT+TSPP +Q MES
Sbjct  362  FDDFLSHVMCCCCALVQEW---REVEIRGCHKTRTSPPPSQRMES  403



>ref|XP_009408217.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKLQ+ELQRS    D+ QCE IQHL+ VT+ VA+T     +    P KVE  YSD ++ K
Sbjct  197  EKLQMELQRS---YDIGQCEMIQHLIGVTQNVASTIEERSTQLKSPNKVELNYSDENNYK  253

Query  597  QNYDQSYGKNDEKWstsrntssvsSK---HDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +   +++GKN  +  T     + SS    HD+   +  H +EEWHSDLLGCCSEP LC+K
Sbjct  254  E---KTFGKNSHEQDTKATFRTTSSDSLGHDMSLHREHHGHEEWHSDLLGCCSEPSLCMK  310

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  +PCGTFS+IAT A NR ++SAEACN+LMAYSLILSCCCYTCCIRRKLRK   I GG 
Sbjct  311  TFFYPCGTFSQIATVAKNRPVTSAEACNDLMAYSLILSCCCYTCCIRRKLRKMFDITGGL  370

Query  246  IDDFLSHLMCCCCALVQEW  190
             DDFLSHL+CCCCALVQEW
Sbjct  371  CDDFLSHLLCCCCALVQEW  389



>ref|XP_008809428.1| PREDICTED: cell number regulator 13-like isoform X3 [Phoenix 
dactylifera]
Length=397

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 166/226 (73%), Gaps = 28/226 (12%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADS  604
            NEKLQ+ELQRSQ+N+D++QCE IQ LL VTE +A  S P+KS   K   KVE  YSD ++
Sbjct  197  NEKLQMELQRSQSNMDISQCEVIQRLLAVTENIAC-SPPEKSEKLKDSKKVESDYSDTNT  255

Query  603  DKQ-NYDQSY-GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            +K+ ++D  Y  + ++ +  S++ S VSS HDLIS++GSHR+E+WHSDLLGCCSEP    
Sbjct  256  EKRYSFDGDYCSQQNDSYMASKSVSQVSSGHDLISNRGSHRHEDWHSDLLGCCSEP----  311

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
                                ++SSAEACN+LMAYSLILSCCCYTCC+RRKLRK L+I GG
Sbjct  312  --------------------NLSSAEACNDLMAYSLILSCCCYTCCVRRKLRKMLNITGG  351

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
              DDFLSHLMCCCCALVQEWRE+EIRG+ GT +TKTS P +Q+MES
Sbjct  352  LCDDFLSHLMCCCCALVQEWREVEIRGVYGTEETKTSSPPSQYMES  397



>gb|ABR16594.1| unknown [Picea sitchensis]
Length=418

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 154/224 (69%), Gaps = 5/224 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDA-DS  604
            NEKLQ+EL RS+AN+DV+QC+ I+HL++VTE VA      K       +  H  +D  + 
Sbjct  199  NEKLQVELHRSRANMDVDQCDVIRHLIEVTENVANIPPERKHFQHSNCEENHPCADCCEE  258

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
                 D SY +  +     R  SS+SS  DLIS +GSHRYEEW +DL GCC EP LC KT
Sbjct  259  QPSPMDGSYLRKQDG----RQDSSISSGRDLISQRGSHRYEEWKTDLFGCCMEPYLCFKT  314

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
             ++PCGTFS IA  A+N  IS  +ACN+LM YSL+  CCCYTCC+RRKLRK L+I GG  
Sbjct  315  CIYPCGTFSNIAAVASNGKISPEQACNDLMTYSLVFGCCCYTCCMRRKLRKLLNIAGGMC  374

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFL+H+ CCCCALVQEWREIE RG++ +H  K SPP +Q MES
Sbjct  375  DDFLTHMTCCCCALVQEWREIECRGLDDSHMKKMSPPPSQQMES  418



>ref|XP_010489415.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=420

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 157/225 (70%), Gaps = 6/225 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSD  601
            EKL+ ELQRS+A  D +QCE IQHL+DVT+ VA+  L  +K L  K    E   + +   
Sbjct  197  EKLKHELQRSRARYDTDQCEVIQHLIDVTQTVASADLDSEKVLTKKKSSKEELTTSSKKK  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              +Y+   G      S+S +  S SS+H+L+S K S   E+WH+DLL CCS P+LC+KT 
Sbjct  257  DDSYETDSGIR--TTSSSTSYVSFSSEHELVSGKSSRHREDWHTDLLDCCSAPVLCLKTF  314

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPC T ++I+T ATNR ISSA ACNELM YSLILSCCCYTCCIR+KLRK L+I GG ID
Sbjct  315  FFPCCTLAKISTVATNRQISSATACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSID  374

Query  240  DFLSHLMCCCCALVQEWreieirgieG--THKTK-TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG     T K K  SPP+ QFME
Sbjct  375  DFLSHLMCCCCALVQELREVEIRGASSHGTEKDKEMSPPTPQFME  419



>ref|XP_010489410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489413.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489414.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=421

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 157/226 (69%), Gaps = 7/226 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSD  601
            EKL+ ELQRS+A  D +QCE IQHL+DVT+ VA+  L  +K L  K    E   + +   
Sbjct  197  EKLKHELQRSRARYDTDQCEVIQHLIDVTQTVASADLDSEKVLTKKKSSKEELTTSSKKK  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              +Y+   G      S+S +  S SS+H+L+S K S   E+WH+DLL CCS P+LC+KT 
Sbjct  257  DDSYETDSGIR--TTSSSTSYVSFSSEHELVSGKSSRHREDWHTDLLDCCSAPVLCLKTF  314

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPC T ++I+T ATNR ISSA ACNELM YSLILSCCCYTCCIR+KLRK L+I GG ID
Sbjct  315  FFPCCTLAKISTVATNRQISSATACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSID  374

Query  240  DFLSHLMCCCCALVQEWreieirgieG---THKTK-TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG      T K K  SPP+ QFME
Sbjct  375  DFLSHLMCCCCALVQELREVEIRGASSHAGTEKDKEMSPPTPQFME  420



>ref|XP_008242042.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Prunus 
mume]
Length=385

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 6/175 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQLELQRSQ+  DV+QCE IQ LL+VTE VA+ S P+K+      K E  YSDA+S+
Sbjct  197  NEKLQLELQRSQSIYDVSQCEVIQRLLEVTETVASKSSPEKNNK----KTERNYSDANSE  252

Query  600  KQ-NYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K+ + ++SY K++ +   SRNTSSVSS HDL+S++GSHR+EEW++DLLGCCSEP LCIKT
Sbjct  253  KEPSSNESYQKSESR-KMSRNTSSVSSGHDLLSTRGSHRHEEWNTDLLGCCSEPSLCIKT  311

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
              +PCGTFS+IA+ ATNRH+SSAEACNELMAYSL+LSCCCYTCCIRRKLRK L+I
Sbjct  312  FFYPCGTFSKIASVATNRHMSSAEACNELMAYSLVLSCCCYTCCIRRKLRKTLNI  366



>gb|KJB17609.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=378

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 142/176 (81%), Gaps = 4/176 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKL+LELQRSQAN DV QCE IQHLLDVTEV A  S+PDKS   K  K  E  YSD D+
Sbjct  196  NEKLRLELQRSQANYDVKQCEVIQHLLDVTEVAA--SIPDKSSSPKVSKKVERNYSDVDN  253

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +   +Y+ +  K  +   TSRNTSSVSS HDL+S +GSHRYEEW++DLLGCCSEP LCIK
Sbjct  254  ENGHSYNDNSPKKPDSRMTSRNTSSVSSGHDLLSDRGSHRYEEWNADLLGCCSEPSLCIK  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            T  +PCGTFS+IAT ATNRH+SSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  314  TFFYPCGTFSKIATVATNRHMSSAEACNELMAYSLILSCCCYTCCVRRKLRKALNI  369



>ref|XP_010680412.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 149/198 (75%), Gaps = 7/198 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKL+LELQRSQ NLD+ QCE IQ LLDVT+  A     +KS   K  K  +  Y++   
Sbjct  193  NEKLRLELQRSQTNLDMTQCEVIQRLLDVTQTAAVVCETEKSESVKGNKRAQPPYAN---  249

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +K ++D +  K +E    SR  S+VSS+ DL+S++ SH + EWH+DLL CC+EP LC+KT
Sbjct  250  EKYSFDGTSPKKNE---ISRTASTVSSRRDLLSNRSSHHHGEWHTDLLDCCAEPCLCLKT  306

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            + +PCGTF++I+T A N+++SSAEACN+L+AYSLILSCCCYTCC+R KLRK L+I GG  
Sbjct  307  IFYPCGTFAKISTVANNKYMSSAEACNDLVAYSLILSCCCYTCCVRGKLRKILNINGGVF  366

Query  243  DDFLSHLMCCCCALVQEW  190
            DDFLSH MCCCCALVQE+
Sbjct  367  DDFLSHFMCCCCALVQEY  384



>ref|XP_006297774.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
 gb|EOA30672.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
Length=417

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 151/226 (67%), Gaps = 13/226 (6%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKLQ ELQRS+A  DV++CE IQ L+DVT+  A+    D      P KV+    D  S  
Sbjct  199  EKLQYELQRSRARYDVDECEVIQRLIDVTQTAASADDTD------PEKVKSSKEDLTS-S  251

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
            Q  D  Y  + +  +TSR+TS VSS HDL+S K S   EEWH+DLL CCSEP L +KT  
Sbjct  252  QKKDDLYETDSDIRTTSRSTSYVSSGHDLLSRKSSQHREEWHTDLLDCCSEPCLSLKTFF  311

Query  417  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  238
            FPC T ++I+T AT R ISSA+ACN+LM YSLILSCCCYTCCIR+KLRK L+I GG IDD
Sbjct  312  FPCCTLAKISTVATGRQISSAKACNQLMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDD  371

Query  237  FLSHLMCCCCALVQEWreieirgieGTHKT-----KTSPPSTQFME  115
            FLSHLMCCCCALVQE           +H T     + SPP+ QFME
Sbjct  372  FLSHLMCCCCALVQEL-REVKIRGANSHGTEKDMKEMSPPTPQFME  416



>gb|EYU17580.1| hypothetical protein MIMGU_mgv1a007522mg [Erythranthe guttata]
Length=404

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 168/228 (74%), Gaps = 21/228 (9%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDK------SLPAKPLKVEHGY  619
            +EKL++ELQRSQ+N+DV QC+ I+ LL+V E+ AA+S+ DK      S  ++P+K EH +
Sbjct  191  HEKLKVELQRSQSNMDVGQCQVIERLLEVAEI-AASSVTDKDSSHKASQVSEPVK-EHSF  248

Query  618  SDADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPL  439
            S+ +  K  YD +   + E         +VS  H++ +++ + R ++WH+DLLGCCSEP 
Sbjct  249  SENNPRK--YDNTSKGSRE--------VTVSRSHNMTTNRDAIRQDKWHADLLGCCSEPY  298

Query  438  LCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            LCIKT + PC T S+IA+ AT + ISSAEACN+++AYSLILSCCCYTCC+RRKLR+ L+I
Sbjct  299  LCIKTFVCPCDTLSKIASVATGKEISSAEACNDILAYSLILSCCCYTCCLRRKLRRTLNI  358

Query  258  PGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
             GG++DD LSH+MCCCCALVQE+RE+EIRG     +T TSPP +Q ME
Sbjct  359  QGGWLDDLLSHIMCCCCALVQEYRELEIRGGL---QTWTSPPKSQSME  403



>ref|XP_006409246.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
 gb|ESQ50699.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
Length=373

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 133/196 (68%), Gaps = 31/196 (16%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ+ELQRS+A  D +QCE IQ L+ VTE  A                       D D
Sbjct  198  NGKLQVELQRSRARYDTDQCEVIQRLIGVTETAA-----------------------DVD  234

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
             ++ ++   KN +K          SS+HD++S + S  +EEWH+DLL CCSEP LC+KT+
Sbjct  235  PESVEELCKKNSKK--------DDSSRHDIVSGRSSQHHEEWHTDLLDCCSEPSLCLKTV  286

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
            +FPCGT S+I+T A NRHISS EACNELM YSLILSCCCYTCCIR+KLRK L+I GG ID
Sbjct  287  IFPCGTLSKISTVAKNRHISSTEACNELMVYSLILSCCCYTCCIRQKLRKTLNIKGGSID  346

Query  240  DFLSHLMCCCCALVQE  193
            DFLSHLMCCCCALVQE
Sbjct  347  DFLSHLMCCCCALVQE  362



>gb|KDO71309.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=409

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKLQLELQRSQ  +DV+QCE IQ L+DVTE  +A  LP++  P K   KVE  YSD D+
Sbjct  196  NEKLQLELQRSQTQMDVSQCEVIQRLIDVTEAFSANHLPEEVSPKKSSKKVECNYSDTDN  255

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
             K  ++++   K D + ++   +S  S + DL+S +GS+++EEWH+DLLGCCSEPLLC+K
Sbjct  256  GKNHSFNEKSNKCDARTNSRNTSSVSSGR-DLLSREGSYQHEEWHTDLLGCCSEPLLCMK  314

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            T  +PCGTFS+IAT AT+RH+SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I
Sbjct  315  TFFYPCGTFSKIATVATSRHMSSAEACNELMAYSLILSCCCYTCCIRRKLRKTLNI  370



>ref|XP_002886128.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62387.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 151/227 (67%), Gaps = 15/227 (7%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKLQLEL RS+A  D +QCE IQ L+DVT+  A++  PD     K L  +   + +    
Sbjct  199  EKLQLELHRSRARYDADQCEVIQRLIDVTQTAASSVEPD---LEKVLTKKEELTSSKKKD  255

Query  597  QNYDQSYGKNDEKWstsr---ntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
              YD       + WS      +TS VSS H+L+S + S  +E WH+DLL CCSEP LC K
Sbjct  256  DLYDT------DSWSLMVECRSTSYVSSGHELLSGRSSQHHENWHADLLDCCSEPCLCFK  309

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            T  FPCGT ++I+T AT+R ISS EAC  LM YSLILSCCCYTCCIR+KLRK L+I GG 
Sbjct  310  TFFFPCGTLAKISTMATDRQISSTEACKNLMVYSLILSCCCYTCCIRKKLRKTLNITGGC  369

Query  246  IDDFLSHLMCCCCALVQEWreieirgi---eGTHKTKTSPPSTQFME  115
            IDDFLSHLMCCCCALVQE RE+EIRG+         + SPP+ QFME
Sbjct  370  IDDFLSHLMCCCCALVQELREVEIRGVSYGTEMSNKEMSPPTPQFME  416



>gb|KCW53204.1| hypothetical protein EUGRSUZ_J02474 [Eucalyptus grandis]
Length=316

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQLEL RSQA LD++QCE IQHL+DVTE V    + +   P K  K V +  SDA++
Sbjct  123  NEKLQLELHRSQATLDMSQCEVIQHLIDVTETVTMNMVSENDSPKKGSKGVINSASDANN  182

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K +  D+S  K  +  + +R   ++ S H+  S +G H++EEWH+DLLGCCSEPLLC+K
Sbjct  183  EKNHPSDESRSKKSDCSTPTRKVPTILSGHEAFSVRGLHQHEEWHADLLGCCSEPLLCVK  242

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGF  247
            TLLFPCGTFSR+AT A+NRHISSAEACNELMAYSL+LSCCCYTCC+RR+LR  L+I   F
Sbjct  243  TLLFPCGTFSRVATVASNRHISSAEACNELMAYSLVLSCCCYTCCVRRRLRMLLNIQVFF  302



>ref|XP_010413502.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413510.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413517.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
Length=419

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 156/225 (69%), Gaps = 7/225 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSD  601
            EKL+ ELQRS+A  D +QCE IQ L+D T+  A+  L  +K L  K    +   + +   
Sbjct  197  EKLKHELQRSRARYDNDQCEVIQRLIDYTQTAASADLDSEKGLLTKKKSSKEERTTSSKK  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K   D SY  +    +TSR+TS VSS+HDL+S   S   E+WH+DLL CCS P LC+KT 
Sbjct  257  K---DDSYETDSGIRTTSRSTSYVSSEHDLVSGISSRHREDWHTDLLDCCSAPSLCLKTF  313

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPC T ++I+T AT R ISSA+ACN+LM YSLILSCCCYTCCIR+KLRK L+I GG ID
Sbjct  314  FFPCCTLAKISTVATKRQISSAKACNDLMVYSLILSCCCYTCCIRKKLRKTLNIKGGSID  373

Query  240  DFLSHLMCCCCALVQEWreieirgieG--THKTK-TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG     T K K  SPP+ QFME
Sbjct  374  DFLSHLMCCCCALVQELREVEIRGASSYGTEKDKEMSPPTPQFME  418



>gb|KCW56602.1| hypothetical protein EUGRSUZ_I02323 [Eucalyptus grandis]
Length=472

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 144/197 (73%), Gaps = 9/197 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY-SDADS  604
            NEKL++ELQRSQ N+D+NQCE IQ LL+VTE VA+ SLPD   P K  K +  Y SDADS
Sbjct  196  NEKLRMELQRSQTNMDMNQCEVIQRLLEVTETVASNSLPDYGSPVKGSKKKEKYTSDADS  255

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            D+ Q+  ++Y  N      +  ++SVS  +DL+ SKGS+ + EWH+DLLGCCSEPLLCIK
Sbjct  256  DREQSTGETYPNNSTS--KTSRSTSVSLDNDLLPSKGSYGHYEWHTDLLGCCSEPLLCIK  313

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIP--G  253
            T   PC TFS+IAT ATNRH+S  EACN+L+AYSLILSCCCYTCC+RRKLRK L+I   G
Sbjct  314  TFFCPCDTFSKIATVATNRHMSPGEACNDLLAYSLILSCCCYTCCVRRKLRKMLNITVVG  373

Query  252  GFIDDFLSHLMCCCCAL  202
              I    SH++C   AL
Sbjct  374  LMIS---SHILCAAAAL  387



>ref|NP_001031366.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06683.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=414

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 149/224 (67%), Gaps = 12/224 (5%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADS  604
            EKLQLELQRS+A  D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    
Sbjct  199  EKLQLELQRSRARYDADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRD  254

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            D  + D S  + D +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KT
Sbjct  255  DLYDTDSSSIRADSR-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKT  309

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L FPCGT ++I+T AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG I
Sbjct  310  LFFPCGTLAKISTVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCI  369

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTK-TSPPSTQFME  115
            DDFLSHLMCCCCALVQE RE+EI         K  SPP+ QFME
Sbjct  370  DDFLSHLMCCCCALVQELREVEIHRASYEKSNKEMSPPTPQFME  413



>ref|XP_010467574.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 156/225 (69%), Gaps = 7/225 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLD-VTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            EKL+ ELQRS+A  D +QCE IQHL+D VT+  A+  L  + +  K    +   + +   
Sbjct  197  EKLKHELQRSRARYDTDQCEVIQHLIDHVTQTAASADLDSEKVLTKKKSSKEELTTSSKK  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K   D  Y  +    +TSR+TS VSS+H+L+S   S   E+WH+DLL CCS P LC+KT 
Sbjct  257  K---DDLYETDSGIRTTSRSTSYVSSEHELVSGISSRHREDWHTDLLDCCSAPSLCLKTF  313

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPC T ++I+T ATN  ISSA+ACNELM YSLILSCCCYTCCIR+KLRK L+I GG ID
Sbjct  314  FFPCCTLAKISTVATNTKISSAKACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSID  373

Query  240  DFLSHLMCCCCALVQEWreieirgieG--THKTK-TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG     T K K  SPP+ QFME
Sbjct  374  DFLSHLMCCCCALVQELREVEIRGASSHGTEKDKEMSPPTPQFME  418



>ref|XP_010467573.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=420

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 156/226 (69%), Gaps = 8/226 (4%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLD-VTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            EKL+ ELQRS+A  D +QCE IQHL+D VT+  A+  L  + +  K    +   + +   
Sbjct  197  EKLKHELQRSRARYDTDQCEVIQHLIDHVTQTAASADLDSEKVLTKKKSSKEELTTSSKK  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K   D  Y  +    +TSR+TS VSS+H+L+S   S   E+WH+DLL CCS P LC+KT 
Sbjct  257  K---DDLYETDSGIRTTSRSTSYVSSEHELVSGISSRHREDWHTDLLDCCSAPSLCLKTF  313

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPC T ++I+T ATN  ISSA+ACNELM YSLILSCCCYTCCIR+KLRK L+I GG ID
Sbjct  314  FFPCCTLAKISTVATNTKISSAKACNELMVYSLILSCCCYTCCIRKKLRKTLNIKGGSID  373

Query  240  DFLSHLMCCCCALVQEWreieirgieG---THKTK-TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EIRG      T K K  SPP+ QFME
Sbjct  374  DFLSHLMCCCCALVQELREVEIRGASSHAGTEKDKEMSPPTPQFME  419



>pir||D84556 hypothetical protein At2g17780 [imported] - Arabidopsis thaliana
Length=417

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 150/227 (66%), Gaps = 15/227 (7%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADS  604
            EKLQLELQRS+A  D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    
Sbjct  199  EKLQLELQRSRARYDADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRD  254

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            D  + D S  + D +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KT
Sbjct  255  DLYDTDSSSIRADSR-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKT  309

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L FPCGT ++I+T AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG I
Sbjct  310  LFFPCGTLAKISTVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCI  369

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKT----SPPSTQFME  115
            DDFLSHLMCCCCALVQE RE+EI         K+    SPP+ QFME
Sbjct  370  DDFLSHLMCCCCALVQELREVEIHRASYAGTEKSNKEMSPPTPQFME  416



>ref|XP_010692506.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692507.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692508.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 154/222 (69%), Gaps = 14/222 (6%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDA-DSD  601
            EKLQ+ELQ+SQ   DV QC+ IQHL+ VTE  +  S            +E  YS++ D  
Sbjct  197  EKLQVELQQSQ---DVKQCQVIQHLIGVTEAASRHSR----------NLEASYSNSRDRK  243

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              + D++  K+++  ST R TS  S +HDL   KGS   E+WH+DLL CCSEP LC KT 
Sbjct  244  ALSGDENCRKSNDALSTVRMTSLPSREHDLKYPKGSDPVEDWHTDLLDCCSEPKLCAKTC  303

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT SRIA+ A N H+SS EACNEL AYSL +SCCCYTCCIR+K RK  +I GG  D
Sbjct  304  FFPCGTISRIASVANNTHMSSGEACNELAAYSLFMSCCCYTCCIRKKFRKIFNIKGGLCD  363

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DFLSHL+CCCC+LVQE+RE+EIRG++G  K+ TSPPS Q ME
Sbjct  364  DFLSHLLCCCCSLVQEYREMEIRGVKGPVKSMTSPPSAQQME  405



>ref|NP_179369.2| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 sp|Q3EBY6.1|MCAC2_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 2 [Arabidopsis 
thaliana]
 dbj|BAF46390.1| Mca2 [Arabidopsis thaliana]
 gb|AEC06682.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=416

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 154/226 (68%), Gaps = 14/226 (6%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADS  604
            EKLQLELQRS+A  D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    
Sbjct  199  EKLQLELQRSRARYDADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRD  254

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            D  + D S  + D +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KT
Sbjct  255  DLYDTDSSSIRADSR-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKT  309

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L FPCGT ++I+T AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG I
Sbjct  310  LFFPCGTLAKISTVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCI  369

Query  243  DDFLSHLMCCCCALVQEWreiei-rgieGTHKT--KTSPPSTQFME  115
            DDFLSHLMCCCCALVQE RE+EI R   GT K+  + SPP+ QFME
Sbjct  370  DDFLSHLMCCCCALVQELREVEIHRASYGTEKSNKEMSPPTPQFME  415



>emb|CDY30346.1| BnaA09g09310D [Brassica napus]
Length=389

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 140/227 (62%), Gaps = 42/227 (19%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ+ELQRS+A  D +QC+ IQ L+ VTE V                      D    
Sbjct  199  NGKLQVELQRSRARYDTDQCQVIQRLIAVTETV------------------EDVDDETEK  240

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKG---SHRYEEWHSDLLGCCSEPLLCI  430
             ++YD +Y K                     S++G   S   EEWH+DLL CCSEP LC+
Sbjct  241  DESYDTAYPKKS-------------------STRGLESSQHQEEWHTDLLDCCSEPTLCL  281

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KTL FPCGT ++I+T ATN+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L+I GG
Sbjct  282  KTLFFPCGTLAKISTVATNKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLNIKGG  341

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTK--TSPPSTQFME  115
             IDDFLSHLMCCCCALVQE RE+EI G     K K   +PPS QFME
Sbjct  342  SIDDFLSHLMCCCCALVQELREVEIHGASYAEKKKKNMTPPSPQFME  388



>ref|XP_009112457.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Brassica rapa]
Length=376

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 140/224 (63%), Gaps = 36/224 (16%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ+ELQRS+A  D +QC+ IQ L+ VTE V       + +  +P+K E         
Sbjct  186  NGKLQVELQRSRARYDTDQCQVIQRLIAVTETV-------EDVDDEPVKDE---------  229

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              +YD  Y K                K      + S   EEWH+DLL CCSEP LC+KT 
Sbjct  230  --SYDTVYAK----------------KSRTRGMESSQHQEEWHTDLLDCCSEPTLCLKTF  271

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT ++I+T ATN+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L I GG ID
Sbjct  272  FFPCGTLAKISTVATNKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLKIKGGSID  331

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTK--TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EI G     K K   +PPS QFME
Sbjct  332  DFLSHLMCCCCALVQELREVEIHGASYAEKKKKNMTPPSPQFME  375



>ref|XP_009112455.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Brassica rapa]
Length=389

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 140/224 (63%), Gaps = 36/224 (16%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ+ELQRS+A  D +QC+ IQ L+ VTE V       + +  +P+K E         
Sbjct  199  NGKLQVELQRSRARYDTDQCQVIQRLIAVTETV-------EDVDDEPVKDE---------  242

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              +YD  Y K                K      + S   EEWH+DLL CCSEP LC+KT 
Sbjct  243  --SYDTVYAK----------------KSRTRGMESSQHQEEWHTDLLDCCSEPTLCLKTF  284

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT ++I+T ATN+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L I GG ID
Sbjct  285  FFPCGTLAKISTVATNKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLKIKGGSID  344

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTK--TSPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EI G     K K   +PPS QFME
Sbjct  345  DFLSHLMCCCCALVQELREVEIHGASYAEKKKKNMTPPSPQFME  388



>ref|XP_009112456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Brassica rapa]
Length=388

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 140/223 (63%), Gaps = 35/223 (16%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ+ELQRS+A  D +QC+ IQ L+ VTE V       + +  +P+K E         
Sbjct  199  NGKLQVELQRSRARYDTDQCQVIQRLIAVTETV-------EDVDDEPVKDE---------  242

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              +YD  Y K                K      + S   EEWH+DLL CCSEP LC+KT 
Sbjct  243  --SYDTVYAK----------------KSRTRGMESSQHQEEWHTDLLDCCSEPTLCLKTF  284

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
             FPCGT ++I+T ATN+ I+S+EAC+ELM YSL+LSCCCYTC IR+KLRK L I GG ID
Sbjct  285  FFPCGTLAKISTVATNKQITSSEACSELMVYSLMLSCCCYTCSIRKKLRKTLKIKGGSID  344

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKT-SPPSTQFME  115
            DFLSHLMCCCCALVQE RE+EI G     K K  +PPS QFME
Sbjct  345  DFLSHLMCCCCALVQELREVEIHGASYEKKKKNMTPPSPQFME  387



>ref|XP_011083456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=405

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 149/225 (66%), Gaps = 14/225 (6%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK---PLKVEHGYSDA  610
            +EKL++ELQ SQAN+DV++CE I+ LL+VTE  AA+S  +K  P K    L+ E G+  +
Sbjct  191  HEKLRVELQHSQANMDVSECEVIERLLEVTEN-AASSAREKESPCKVSQKLEPEKGHFSS  249

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            + +    D      +  +S+          H+  S   +   E+W +DLLGCCSEP LCI
Sbjct  250  EKNPSKVDALMTSREATFSSV---------HNTGSKGEATWQEDWQADLLGCCSEPYLCI  300

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT   PC T S+IA+AAT   IS AEACNE+MAYSLI++CCCYTCC+RRKLR+ L+I GG
Sbjct  301  KTFFCPCDTLSKIASAATGEEISPAEACNEIMAYSLIMACCCYTCCVRRKLRRTLNIRGG  360

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            + DDFLSH MCCCCALVQEWRE+EIRG        T PP  Q ME
Sbjct  361  WFDDFLSHFMCCCCALVQEWREVEIRGGPQKSWI-TRPPPYQEME  404



>ref|XP_004512162.1| PREDICTED: cell number regulator 13-like isoform X6 [Cicer arietinum]
Length=387

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 131/176 (74%), Gaps = 7/176 (4%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVE-HGYSDADSD  601
            EKL LELQRSQANLD+NQCE IQ LLDVT+V A  SLPD   P K  K E + YS+A+ D
Sbjct  197  EKLNLELQRSQANLDMNQCEVIQRLLDVTKV-AEYSLPDNCSPEKSHKKEKYSYSNANDD  255

Query  600  K--QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            K   + ++ Y K D   ST   +    S+ DL+S+ GS++  EWH+DLL CCSEP LC+K
Sbjct  256  KGLSSDEKYYAKTD---STVSTSRFSVSQKDLMSTGGSYQQAEWHTDLLACCSEPSLCLK  312

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            T  +PCGTFS+IAT A NR +SSAEACNELMAYSLILSCCCYTCCIRRKLRK L+I
Sbjct  313  TFFYPCGTFSKIATVAKNRPMSSAEACNELMAYSLILSCCCYTCCIRRKLRKMLNI  368



>ref|NP_001031367.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06684.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=410

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 135/197 (69%), Gaps = 11/197 (6%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADS  604
            EKLQLELQRS+A  D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    
Sbjct  199  EKLQLELQRSRARYDADQCEVIQRLIDVTQT-AATVEPNLEKVLTKKE---ELTSSKKRD  254

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            D  + D S  + D +     +TS VSS H+L+S +       WH+DLL CCSEP LC+KT
Sbjct  255  DLYDTDSSSIRADSR-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKT  309

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            L FPCGT ++I+T AT+R ISS E C  L+ YSLILSCCCYTCCIR+KLRK L+I GG I
Sbjct  310  LFFPCGTLAKISTVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCI  369

Query  243  DDFLSHLMCCCCALVQE  193
            DDFLSHLMCCCCALVQE
Sbjct  370  DDFLSHLMCCCCALVQE  386



>emb|CDY26830.1| BnaC09g09570D [Brassica napus]
Length=391

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 143/229 (62%), Gaps = 44/229 (19%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ+ELQRS+A  D +QC+ IQ L+ VTE V       + +  +P+K           
Sbjct  199  NGKLQVELQRSRARYDTDQCQVIQRLIAVTETV-------EDVDDEPVK-----------  240

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKG---SHRYEEWHSDLLGCCSEPLLCI  430
              +YD  Y K                     S++G       EEWH+DLL CCSEP LC+
Sbjct  241  DDSYDAVYPKKS-------------------STRGLESPQHQEEWHTDLLDCCSEPTLCL  281

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT  FPCGT ++I+T ATN+ I+S+EAC++LM YSLILSCCCYTCCIR+KLRK LSI GG
Sbjct  282  KTFFFPCGTLAKISTVATNKQITSSEACSDLMVYSLILSCCCYTCCIRKKLRKTLSIKGG  341

Query  249  FIDDFLSHLMCCCCALVQEWreieirgie-GTHKTK---TSPPSTQFME  115
             IDDFLSHLMCCCCALVQE RE+EIRG    T K K    +PP  QFME
Sbjct  342  SIDDFLSHLMCCCCALVQELREVEIRGASYETEKKKMKNMTPPLPQFME  390



>ref|XP_009386557.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 8/180 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQ+ELQRSQ NLDV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   
Sbjct  197  NEKLQMELQRSQTNLDVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLD  255

Query  603  DKQNYDQSYG-----KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPL  439
            DK++Y  SYG     ++D   ++SR +S  SS HDL+S+K S RYEEWHSDLLGCCSEP 
Sbjct  256  DKEDYS-SYGNYYSQQDDTCKASSRISSIASSGHDLLSNKASSRYEEWHSDLLGCCSEPF  314

Query  438  LCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            LCIKT  FPCGTFS+IA+ A NRH+SSAEACN+ MAY+L+LSCCCYTCCIRRKLRK L+I
Sbjct  315  LCIKTCCFPCGTFSKIASVAKNRHVSSAEACNDFMAYALVLSCCCYTCCIRRKLRKMLNI  374



>gb|AFK40961.1| unknown [Lotus japonicus]
Length=386

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVEHGYSDADS  604
            NEKL+LELQRSQANLD+NQCE IQ LL+VTEV A+ S+P+K S      K E+ YSDA+ 
Sbjct  196  NEKLKLELQRSQANLDMNQCEVIQRLLEVTEV-ASYSVPEKCSSEKSHKKEEYNYSDANG  254

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +K  + D+ Y     K  T   +    S+ DL S+ GS+  E+WH+DLL CCSEP LC+K
Sbjct  255  EKVHSSDEKYHA---KVDTVSPSRFSVSRKDLQSNGGSYHQEDWHTDLLACCSEPSLCMK  311

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            T  +PCGTFS+IA+ A NR ISS EACN LMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  312  TFFYPCGTFSKIASVAKNRPISSGEACNGLMAYSLILSCCCYTCCVRRKLRKMLNI  367



>ref|XP_006574667.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X6 [Glycine max]
 ref|XP_006574668.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X7 [Glycine max]
Length=378

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 10/177 (6%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKV-EHGYSDADS  604
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV A   L D     K ++  ++ YSDA+ 
Sbjct  200  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEVAA---LYDSKKNHKTVEYSDYSYSDANG  256

Query  603  DK--QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DK   + ++ + KND    T   + S  S+ DL+S+ GS+  E+WH+DLL CCSEP LC 
Sbjct  257  DKAHSSNEKIHKKND----THSASGSSVSEKDLLSTGGSYHREDWHTDLLACCSEPCLCF  312

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            KT  +PCGT S+IAT A NR ISSAEACNELMAYSLILSCCCYTCC+RRKLRK L+I
Sbjct  313  KTCFYPCGTLSKIATVANNRPISSAEACNELMAYSLILSCCCYTCCMRRKLRKMLNI  369



>gb|EPS70744.1| mid1-complementing activity 2 [Genlisea aurea]
Length=376

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 135/222 (61%), Gaps = 37/222 (17%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
             EKLQ EL  SQANLDV QCE I+ L++VTE  A  ++  +S    P KV     D ++ 
Sbjct  191  REKLQAELHHSQANLDVKQCEVIERLMEVTETAACAAVETES----PRKVAVPEVDDETT  246

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
              ++++S       W                        E+WH+DLLGCCSEP LC+KT 
Sbjct  247  NSSHNES-----RVWD-----------------------EDWHADLLGCCSEPYLCVKTC  278

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
            + PC T S+IAT A+ + I   EACN+++AYSLILSCCCYTCCIRRKLR+ L I GG +D
Sbjct  279  VCPCDTLSKIATVASGKEI--WEACNDILAYSLILSCCCYTCCIRRKLRRALGIEGGCLD  336

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DFLSHLMCCCCA+VQEW       I G   ++ +PP +Q ME
Sbjct  337  DFLSHLMCCCCAVVQEW---REVKIRGAEGSRIAPPPSQTME  375



>gb|EEE65313.1| hypothetical protein OsJ_20556 [Oryza sativa Japonica Group]
Length=458

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 135/200 (68%), Gaps = 29/200 (15%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVE--HGYSDA  610
            +EKLQ+ELQRSQ+N+D+ QCE IQHLL VT+ VA +S+P+K + P    K +  H     
Sbjct  166  SEKLQVELQRSQSNMDMGQCEVIQHLLGVTKTVA-SSIPEKCATPKVSEKADSNHTKVSE  224

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            DS K  +D S  K  +  +  R++   S  HDL+SS+GS+  +EWH+DLLGCCSEP L  
Sbjct  225  DSAKTYHDDSPKKQKDACTAPRSSPPSSYGHDLVSSRGSYS-DEWHADLLGCCSEPSL--  281

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
                                  SS+EACN++MAYSLILSCCCYTCC+RRKLR+KL+I GG
Sbjct  282  ----------------------SSSEACNDIMAYSLILSCCCYTCCVRRKLRQKLNIAGG  319

Query  249  FIDDFLSHLMCCCCALVQEW  190
             IDDFLSHLMCCCCALVQEW
Sbjct  320  CIDDFLSHLMCCCCALVQEW  339



>ref|XP_009386556.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 134/224 (60%), Gaps = 36/224 (16%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQ+ELQRSQ NLDV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   
Sbjct  197  NEKLQMELQRSQTNLDVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLD  255

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            DK++Y  SYG               S + D  + K S R+++                  
Sbjct  256  DKEDYS-SYGN------------YYSQQDD--TCKASSRHQD------------------  282

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
            +LFP   F +       +  SSAEACN+ MAY+L+LSCCCYTCCIRRKLRK L+I GG  
Sbjct  283  MLFPLWDFFK-NRFGCKKQTSSAEACNDFMAYALVLSCCCYTCCIRRKLRKMLNITGGLC  341

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            DDFLSHLMCCCCA VQEWRE+E RG     KTKT+PP++Q+MES
Sbjct  342  DDFLSHLMCCCCAFVQEWREVEFRGTNVVDKTKTNPPASQYMES  385



>gb|KDP44714.1| hypothetical protein JCGZ_01214 [Jatropha curcas]
Length=381

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 128/225 (57%), Gaps = 40/225 (18%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDA  610
            EKL +ELQRS+ + D NQC  I+HL++VTE V   ++P+K     L  +P  +  GY D+
Sbjct  192  EKLHIELQRSRTSNDPNQCRVIEHLIEVTENVV-NAIPEKKVTKVLVNEPTYILSGYEDS  250

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            + D                                 KG     EW  DL  CC EP L +
Sbjct  251  NPD--------------------------------DKGQF---EWQVDLFDCCEEPCLSL  275

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT ++PCGTFS IA   +   IS   A N+LMAY++   CCCY+C IRRK+R+ L+I GG
Sbjct  276  KTCIYPCGTFSSIANVVSKGEISRERAINDLMAYAIFCGCCCYSCGIRRKVRQVLNIEGG  335

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
              DDFL+HLMCCCCA+VQEWRE+E+RG EG    K  PP  QFM+
Sbjct  336  ICDDFLTHLMCCCCAMVQEWRELEVRGFEGCQGRKMIPPPYQFMK  380



>ref|XP_010087526.1| hypothetical protein L484_006931 [Morus notabilis]
 gb|EXB29257.1| hypothetical protein L484_006931 [Morus notabilis]
Length=388

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 131/222 (59%), Gaps = 27/222 (12%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +ELQRS+ N D +QC  I+HL+DVTE V   +LP K +  K L  E  Y     D 
Sbjct  194  EKLNIELQRSRTNNDPDQCRVIEHLIDVTENVV-NALPSKKV-KKVLSNEPTYV-VSGDI  250

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
             N D     ++E  S                        EW +DL+GCC+EP L +KT +
Sbjct  251  TNGDFELKTDNEVQS------------------------EWQADLIGCCNEPCLSLKTFI  286

Query  417  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  238
            +PCGTFS +A   +   IS   A N L+AYSL+  CCCY+CC+RRKLR+ L+I GG  DD
Sbjct  287  YPCGTFSWMANIVSRGKISRERAINNLLAYSLVGGCCCYSCCMRRKLRELLNIEGGSCDD  346

Query  237  FLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            FL+HLMCCCCA+VQE RE+E+R  EG    K  PP  Q+M++
Sbjct  347  FLTHLMCCCCAMVQERRELELRNFEGCQGRKMIPPPFQYMKT  388



>ref|NP_001242304.1| uncharacterized protein LOC100811369 [Glycine max]
 gb|ACU17641.1| unknown [Glycine max]
Length=372

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 6/157 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADS  604
            NEKL+LELQRSQANLD+NQCE IQ LLDVTEV AA S+P K  P K   K E+ YSDA+S
Sbjct  196  NEKLKLELQRSQANLDMNQCEVIQRLLDVTEV-AAYSVPAKCSPEKSHKKEEYNYSDANS  254

Query  603  DK-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            DK  + D+ Y    +K      +    ++ DL S+ GS++ E+WH+DLL CCSEP LC+K
Sbjct  255  DKDHSSDEKYHAKIDK---HSPSRYSVAQKDLASTGGSYQQEDWHTDLLACCSEPSLCMK  311

Query  426  TLLFPCGTFSRIATAATNRHISSAEACNELMAYSLIL  316
            T  +PCGTFS+IA+ A NR ISS EACN+LMAYSLI 
Sbjct  312  TFFYPCGTFSKIASVARNRPISSGEACNDLMAYSLIF  348



>gb|KHG10652.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=332

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 105/140 (75%), Gaps = 5/140 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQRSQ+N DV QCE IQHLL+VTEV AATS PDK    +  KVE  YSDA+S+
Sbjct  197  NEKLQVELQRSQSNYDVQQCEVIQHLLEVTEVAAATSAPDK----RSKKVERNYSDANSE  252

Query  600  K-QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            K  +YD+   K      TSRNTSSVSS  DL+S +G  RY+EWH+DLLGCCSEP LCIKT
Sbjct  253  KGHSYDEISPKKPGSGITSRNTSSVSSGRDLLSDRGLDRYDEWHADLLGCCSEPYLCIKT  312

Query  423  LLFPCGTFSRIATAATNRHI  364
               PCGT S+IAT ATNRH+
Sbjct  313  FFCPCGTLSKIATVATNRHM  332



>ref|XP_006435802.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
 gb|ESR49042.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
Length=393

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 128/221 (58%), Gaps = 21/221 (10%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +ELQRS+ N D  QC+ I+HL+DVTE V    LP K +  K +  E  Y  +    
Sbjct  193  EKLHIELQRSRTNNDTKQCQLIEHLIDVTENVV-NELPGKKM-QKLVANEPTYVISGYVT  250

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
               +  YG                   D  S        EW +DL GC  EP L +KT +
Sbjct  251  NAVNSGYG-------------------DPGSKAADESRSEWEADLFGCLREPCLSLKTCI  291

Query  417  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  238
            +PCGTFS+IA A T   IS  +A N LMAYS+   CCCY+CCIR+KLR+  +I GG  DD
Sbjct  292  YPCGTFSKIANAVTEGKISREQAINTLMAYSIFCGCCCYSCCIRKKLRETFNIQGGSCDD  351

Query  237  FLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            FL+HLMCCCCA+VQEWRE+E+RG EG    K  PP  Q+M+
Sbjct  352  FLTHLMCCCCAMVQEWRELELRGFEGCQGRKMIPPPYQYMK  392



>ref|XP_010067558.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Eucalyptus 
grandis]
Length=390

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 122/226 (54%), Gaps = 34/226 (15%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSD  613
             EKL +ELQ  ++  +  QC  I+HL+ V E   + +LP K     L  +P  V  GY +
Sbjct  194  REKLHVELQWLRSRNETKQCRVIEHLISVAEN-PSNTLPSKRVTKLLVNQPAFVMSGYIN  252

Query  612  ADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
                     Q  G++D                             W +DL GCC EP L 
Sbjct  253  NVKSITESFQDQGQDD-----------------------------WQADLFGCCMEPCLS  283

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
             KT L+PCG F++IA A +   IS   A N + A+SLI SCCCYT C+RR+LRK  +I G
Sbjct  284  FKTCLYPCGMFAKIANAVSRGEISREVAVNNVFAFSLIGSCCCYTFCVRRRLRKLFNIQG  343

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
               DDFL+HLMCCCCA+VQEWRE+E+RG+EG    K  PP  QFM+
Sbjct  344  SLCDDFLTHLMCCCCAMVQEWRELELRGVEGYQGRKMIPPPYQFMK  389



>ref|XP_009369211.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Pyrus 
x bretschneideri]
Length=242

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 123/223 (55%), Gaps = 25/223 (11%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADS  604
            EKL +ELQR+    D +QC  I+HL+ V E V +  LP K +  K L  E  Y  S   +
Sbjct  42   EKLNIELQRAITINDPDQCRMIEHLIHVAENVVSGVLPGKKV-EKLLVNEPSYVVSGCIT  100

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +  +     G   E                    +G     EW ++L GCCSEP L +KT
Sbjct  101  NANSIYTGPGFQPEN-----------------EGRG-----EWQAELFGCCSEPCLSLKT  138

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
             ++PCGTFS IA   +   IS  +A + L+AYSL   CCCY CC+RRKLR+  +I G   
Sbjct  139  CIYPCGTFSWIANVVSKGKISREQAASNLIAYSLFGGCCCYACCVRRKLRELFNIEGSCC  198

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DD L+HLMCCCCALVQE RE+E+R  EG H  K  PP  Q+M+
Sbjct  199  DDLLTHLMCCCCALVQELRELELRSFEGCHGRKMVPPPFQWMK  241



>ref|XP_006575552.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
Length=384

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 120/222 (54%), Gaps = 22/222 (10%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +EL RS+ N D  QC  I+HL++VT+ V   S P+K    K  K+          +
Sbjct  185  EKLHVELSRSRTNNDPEQCRVIEHLIEVTKNVVNMS-PNK----KVTKIVFNEPTDLIAR  239

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
               D +                     DL    G     EW +DL GCC EP LC+KT  
Sbjct  240  HITDNAIAS-----------------EDLELESGDKSQSEWKTDLFGCCREPCLCLKTCF  282

Query  417  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  238
            FPCGTFS IA   T    S   A   L+AYS+   CCCY+CCIRRKLR + +I GG  DD
Sbjct  283  FPCGTFSWIANVVTRGETSRKRAMTNLVAYSIFCGCCCYSCCIRRKLRNQFNIEGGLCDD  342

Query  237  FLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            FL+HLMCCCCA+VQEWRE+E+ G     + K  PP  QFMES
Sbjct  343  FLTHLMCCCCAMVQEWRELELSGFGDCQERKMFPPPNQFMES  384



>gb|KHN38534.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=372

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 120/222 (54%), Gaps = 22/222 (10%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +EL RS+ N D  QC  I+HL++VT+ V   S P+K    K  K+          +
Sbjct  173  EKLHVELSRSRTNNDPEQCRVIEHLIEVTKNVVNMS-PNK----KVTKIVFNEPTDLIAR  227

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
               D +                     DL    G     EW +DL GCC EP LC+KT  
Sbjct  228  HITDNAIAS-----------------EDLELESGDKSQSEWKTDLFGCCREPCLCLKTCF  270

Query  417  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  238
            FPCGTFS IA   T    S   A   L+AYS+   CCCY+CCIRRKLR + +I GG  DD
Sbjct  271  FPCGTFSWIANVVTRGETSRKRAMTNLVAYSIFCGCCCYSCCIRRKLRNQFNIEGGLCDD  330

Query  237  FLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFMES  112
            FL+HLMCCCCA+VQEWRE+E+ G     + K  PP  QFMES
Sbjct  331  FLTHLMCCCCAMVQEWRELELSGFGDCQERKMFPPPNQFMES  372



>ref|XP_007008883.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY17693.1| PLAC8 family protein [Theobroma cacao]
Length=385

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 94/225 (42%), Positives = 124/225 (55%), Gaps = 30/225 (13%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDA  610
            EK+ +ELQRS+   D  QC  I+HL+DVTE V    LP K     L  +P  V  GY   
Sbjct  186  EKMHVELQRSRTIDDSKQCRVIEHLIDVTENVVNV-LPGKEVHKLLVNEPAYVLAGY--M  242

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
             ++K    +   K +E+  +                       EW  DL  CCSEP L +
Sbjct  243  TNEKPRGRELGLKTEERCQS-----------------------EWQVDLFDCCSEPCLSL  279

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT  +PCG FS I    +    S  +A ++LMAYSLI  C CY+CCIR+KLR+  +I GG
Sbjct  280  KTCFYPCGVFSSITNVVSKGKTSREQAISDLMAYSLICGCRCYSCCIRKKLRELFNIKGG  339

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
              DD+L+HL+CCCCA+VQEWRE+E RG EG    +  PP  Q+M+
Sbjct  340  SGDDYLTHLICCCCAMVQEWRELEARGFEGCEGREMIPPPYQYMK  384



>ref|XP_008234071.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Prunus 
mume]
Length=398

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 123/228 (54%), Gaps = 31/228 (14%)
 Frame = -2

Query  777  EKLQLELQRSQA-NLDVNQCEFIQHLLDVTEVVAATSLP----DKSLPAKPLKVEHGYSD  613
            EKL +ELQRS+  N D +QC  I+HL+DV E V +  LP    +K L  +P  V  GY  
Sbjct  196  EKLNIELQRSRTINDDPDQCRVIEHLIDVAENVVSGVLPGRKVEKLLVNEPSYVVSGYI-  254

Query  612  ADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
             ++     D      +E W                          W +DL GCCSEP L 
Sbjct  255  TNAKSIYGDHGLRPENEGWFG------------------------WQADLFGCCSEPCLS  290

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +KT ++PCGTFS IA   +    S  +A N+L+A S+   CCCYTC +RRKLR+  SI G
Sbjct  291  LKTCVYPCGTFSWIANVVSKGKTSREQATNDLIACSVFGGCCCYTCFVRRKLRQLFSIEG  350

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTK-TSPPSTQFMES  112
               DDF +HLMCCCCA+VQE RE+E+R  EG   T    PPS Q M +
Sbjct  351  SSCDDFFTHLMCCCCAMVQERRELELRNFEGCRGTNMIVPPSLQCMNA  398



>ref|XP_008363765.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Malus domestica]
Length=392

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 124/229 (54%), Gaps = 40/229 (17%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLP----DKSLPAKPLKVEHGYSDA  610
            EKL +ELQR+    D +QC  I+HL+ V E V +  LP    +K L  +P  V  GY   
Sbjct  195  EKLNIELQRAITINDPDQCRVIEHLIHVAENVVSGVLPGKKVEKLLVNEPSYVVSGYVVF  254

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
            +  +                             + ++G     EW ++L GCCSEP L +
Sbjct  255  EGLR-----------------------------LENEGRG---EWQAELFGCCSEPCLSL  282

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMA----YSLILSCCCYTCCIRRKLRKKLS  262
            KT ++PCGTFS IA   +   IS  +A + LMA    YSL   CCCYTCC+RRKLR+  +
Sbjct  283  KTCIYPCGTFSWIANVVSKGKISREQAASNLMAXTCPYSLFGGCCCYTCCMRRKLREFFN  342

Query  261  IPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            I G   DD L+HLMCCCCALVQE RE+E+R  EG +  K  PP  Q+M+
Sbjct  343  IEGSCCDDLLTHLMCCCCALVQERRELELRNFEGCNGRKMVPPPFQWMK  391



>ref|XP_010658231.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Vitis vinifera]
Length=453

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 124/223 (56%), Gaps = 31/223 (14%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADS  604
            EKLQ+EL RSQ + D  QC  I+HL++VT+ V        ++P + L   H Y  S  ++
Sbjct  259  EKLQIELHRSQVDNDPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEA  311

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            + ++    +G   E    S                      EW +DL GCC EP L +KT
Sbjct  312  NAKSCHGGHGSQPEDQDES----------------------EWQADLFGCCREPCLSLKT  349

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCG FS IA   +   IS   ACNELM YSL   CCCYTCC+RR LRK  +I GG  
Sbjct  350  CFYPCGIFSFIANVVSKGKISRERACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSC  409

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFL+HLMCCCCA+VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  410  DDFLTHLMCCCCAMVQERRELELRNFDGCQGRKMIPPPFQYMK  452



>ref|XP_010658233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Vitis vinifera]
Length=446

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 124/223 (56%), Gaps = 31/223 (14%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADS  604
            EKLQ+EL RSQ + D  QC  I+HL++VT+ V        ++P + L   H Y  S  ++
Sbjct  252  EKLQIELHRSQVDNDPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEA  304

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            + ++    +G   E    S                      EW +DL GCC EP L +KT
Sbjct  305  NAKSCHGGHGSQPEDQDES----------------------EWQADLFGCCREPCLSLKT  342

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCG FS IA   +   IS   ACNELM YSL   CCCYTCC+RR LRK  +I GG  
Sbjct  343  CFYPCGIFSFIANVVSKGKISRERACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSC  402

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFL+HLMCCCCA+VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  403  DDFLTHLMCCCCAMVQERRELELRNFDGCQGRKMIPPPFQYMK  445



>ref|XP_010658232.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Vitis vinifera]
Length=450

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 124/223 (56%), Gaps = 31/223 (14%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADS  604
            EKLQ+EL RSQ + D  QC  I+HL++VT+ V        ++P + L   H Y  S  ++
Sbjct  256  EKLQIELHRSQVDNDPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEA  308

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            + ++    +G   E    S                      EW +DL GCC EP L +KT
Sbjct  309  NAKSCHGGHGSQPEDQDES----------------------EWQADLFGCCREPCLSLKT  346

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
              +PCG FS IA   +   IS   ACNELM YSL   CCCYTCC+RR LRK  +I GG  
Sbjct  347  CFYPCGIFSFIANVVSKGKISRERACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSC  406

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFL+HLMCCCCA+VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  407  DDFLTHLMCCCCAMVQERRELELRNFDGCQGRKMIPPPFQYMK  449



>ref|XP_007219349.1| hypothetical protein PRUPE_ppa019431mg [Prunus persica]
 gb|EMJ20548.1| hypothetical protein PRUPE_ppa019431mg [Prunus persica]
Length=398

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 124/228 (54%), Gaps = 31/228 (14%)
 Frame = -2

Query  777  EKLQLELQRSQA-NLDVNQCEFIQHLLDVTEVVAATSLP----DKSLPAKPLKVEHGYSD  613
            EKL +ELQRS+  N   +QC  I+HL+DV E V +  LP    +K L  +P  V  GY  
Sbjct  196  EKLNIELQRSRTINDGPDQCRVIEHLIDVAENVVSGVLPGKKVEKLLVNEPSYVVSGYIT  255

Query  612  ADSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
                  N    YG +                   +  +   R+  W +DL  CCSEP L 
Sbjct  256  ------NAKSIYGDHG------------------LRPENEGRFG-WQADLFSCCSEPCLS  290

Query  432  IKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPG  253
            +K+ ++PCGTFS IA   +   IS  +A N L+A S+  +CCCYTC +RRKLR+  +I G
Sbjct  291  LKSCVYPCGTFSWIANVVSEGKISREQATNNLIACSVFGACCCYTCFVRRKLRQLFNIEG  350

Query  252  GFIDDFLSHLMCCCCALVQEWreieirgieGTHKTK-TSPPSTQFMES  112
               DDF +HLMCCCCA+VQE RE+E+R  EG   T    PPS Q M +
Sbjct  351  SSCDDFFTHLMCCCCAMVQERRELELRNFEGCRGTNMIVPPSLQCMNA  398



>ref|XP_002520777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41486.1| conserved hypothetical protein [Ricinus communis]
Length=393

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 128/226 (57%), Gaps = 31/226 (14%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +ELQRS+   D NQC  I+HL+DVTE V   ++P+K +  K L  E  Y  + S  
Sbjct  191  EKLHIELQRSRTINDTNQCRVIEHLIDVTENVV-NAIPEKKV-TKLLVNEPTYLISGSGF  248

Query  597  Q---NYDQSYGK---NDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLL  436
            +   N   SYG    +DEK  +                       EW  DL  CC EP L
Sbjct  249  RYISNAQSSYGDLKPDDEKGQS-----------------------EWQVDLFDCCKEPCL  285

Query  435  CIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIP  256
             + T ++PCGTFSRIA   +   I    A N++MAY++   CCCYTCC RR++R+   I 
Sbjct  286  SLNTCIYPCGTFSRIANLVSEGEIPHERAVNDVMAYAIFCGCCCYTCCFRRRIRQIFDIE  345

Query  255  GGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFM  118
            GG  DDFL+HLMCCCCA+VQE RE+E+RG EG  + K  PP  Q+M
Sbjct  346  GGACDDFLTHLMCCCCAMVQELRELEVRGFEGCQERKMIPPPYQYM  391



>ref|XP_003518431.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=403

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 105/196 (54%), Gaps = 22/196 (11%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +EL RS+ N D  QC  I+HL++VT+ V   S P+K    K  K+          +
Sbjct  185  EKLHVELSRSRTNNDPEQCRVIEHLIEVTKNVVNMS-PNK----KVTKIVFNEPTDLIAR  239

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
               D +                     DL    G     EW +DL GCC EP LC+KT  
Sbjct  240  HITDNAIAS-----------------EDLELESGDKSQSEWKTDLFGCCREPCLCLKTCF  282

Query  417  FPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDD  238
            FPCGTFS IA   T    S   A   L+AYS+   CCCY+CCIRRKLR + +I GG  DD
Sbjct  283  FPCGTFSWIANVVTRGETSRKRAMTNLVAYSIFCGCCCYSCCIRRKLRNQFNIEGGLCDD  342

Query  237  FLSHLMCCCCALVQEW  190
            FL+HLMCCCCA+VQEW
Sbjct  343  FLTHLMCCCCAMVQEW  358



>ref|XP_002316192.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
 gb|EEF02363.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
Length=396

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 123/227 (54%), Gaps = 35/227 (15%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDA  610
            EKLQ+ELQRS+ + + NQC  I+HL++VTE V    +P K     L  +P  V  GY   
Sbjct  196  EKLQIELQRSRTSKEPNQCRVIEHLIEVTENVV-NDVPAKKVTKLLVNEPTYVVSGYI--  252

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
                 N   S G                     +   G     EW  DL  CC EP L +
Sbjct  253  ----TNARSSNG---------------------VLKPGDKCQSEWQVDLFDCCKEPCLSL  287

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT ++PCG FSRIA   +    S   A N+LMAYS+   CCCYTCCIR+K+R    I GG
Sbjct  288  KTCIYPCGVFSRIANVVSKGKTSRERAINDLMAYSIFCGCCCYTCCIRKKIRHLFDIEGG  347

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGT---HKTKTSPPSTQFM  118
              DDFL+H MCCCCA+VQEWRE+E+RG EGT    + K  PP  Q+M
Sbjct  348  SCDDFLTHFMCCCCAMVQEWRELEVRGFEGTCGCPERKMIPPPYQYM  394



>ref|XP_009386559.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386560.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 101/145 (70%), Gaps = 8/145 (6%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLK-VEHGYSDADS  604
            NEKLQ+ELQRSQ NLDV  C  IQ LL +TE +A ++ P+ ++  K  + VE    D   
Sbjct  197  NEKLQMELQRSQTNLDVGACGLIQQLLGLTETMA-SAFPENTVELKNYENVESASVDVLD  255

Query  603  DKQNYDQSYG-----KNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPL  439
            DK++Y  SYG     ++D   ++SR +S  SS HDL+S+K S RYEEWHSDLLGCCSEP 
Sbjct  256  DKEDYS-SYGNYYSQQDDTCKASSRISSIASSGHDLLSNKASSRYEEWHSDLLGCCSEPF  314

Query  438  LCIKTLLFPCGTFSRIATAATNRHI  364
            LCIKT  FPCGTFS+IA+ A NRH+
Sbjct  315  LCIKTCCFPCGTFSKIASVAKNRHL  339



>ref|XP_011035883.1| PREDICTED: cell number regulator 13-like [Populus euphratica]
Length=388

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 122/224 (54%), Gaps = 32/224 (14%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKS----LPAKPLKVEHGYSDA  610
            EKLQ+ELQRS+ + + +QC  I+HL++VTE V    +P K     L  +P  V  GY   
Sbjct  191  EKLQIELQRSRTSKEPDQCRVIEHLIEVTENVV-NDVPAKKVTKLLVNEPTYVVSGYI--  247

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
                 N   S G                     +   G     EW  DL  C  EP L +
Sbjct  248  ----TNARSSNG---------------------VLKPGDKCQSEWQVDLFDCFKEPCLSL  282

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            KT ++PCG FSRIA   +    S   A N+LMAYS+   CCCYTCCIR+K+R    I GG
Sbjct  283  KTCIYPCGVFSRIANVVSKGKTSRERAINDLMAYSIFCGCCCYTCCIRKKIRHLFDIEGG  342

Query  249  FIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFM  118
              DDFL+H+MCCCCA+VQEWRE+E+RG EG  + K  PP  Q+M
Sbjct  343  SCDDFLTHVMCCCCAMVQEWRELEVRGFEGCPERKMIPPPYQYM  386



>ref|XP_004235233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum lycopersicum]
Length=390

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 123/216 (57%), Gaps = 31/216 (14%)
 Frame = -2

Query  750  SQANLDVNQCEFIQHLLDVTEVVAATSLPDK---SLPAKPLKVEHGYSDADSDK-QNYDQ  583
            SQAN D  QC  I+HL+DVT+ V   ++PD+   +L A+P       S A   + Q  + 
Sbjct  201  SQANNDPKQCRIIEHLIDVTQNV--VNVPDEKFLALSAQPYIRTGLVSAAKVGQVQMVNV  258

Query  582  SYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGT  403
            S  ++ EK                          +W +DL  CCSEP LC K  ++PCG 
Sbjct  259  SQAEHQEK-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGI  293

Query  402  FSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHL  223
            FSR+A+  ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I GG  DDFL+HL
Sbjct  294  FSRVASLVSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRQLFNIEGGSCDDFLTHL  353

Query  222  MCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            MCCCCA++QEWRE+E+R  +G    K  PP  Q+M+
Sbjct  354  MCCCCAMIQEWRELELRDFKGCQGRKMIPPPYQYMK  389



>gb|ACF79860.1| unknown [Zea mays]
Length=84

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  366  ISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEWr  187
            +SS EACN++MAYSLILSCCCYTCC+RRKLR+KL I GG  DDFLSHL+CCCCALVQEW 
Sbjct  1    MSSGEACNDIMAYSLILSCCCYTCCVRRKLRQKLDIAGGCCDDFLSHLLCCCCALVQEW-  59

Query  186  eieirgieGTHKTKTSPPSTQFME  115
                     + KTK +PP+ Q+ME
Sbjct  60   REVEIRGAYSEKTKVTPPACQYME  83



>ref|XP_006356473.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=274

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 118/214 (55%), Gaps = 27/214 (13%)
 Frame = -2

Query  750  SQANLDVNQCEFIQHLLDVTE-VVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSY  577
            SQAN D  QC  I+HL+DVT+ VV   +    +L  +P       S A   + Q  + S 
Sbjct  85   SQANNDPKQCRIIEHLIDVTQNVVNVPAEKFLALNTQPYIGTRWVSAAKVGQVQMVNASQ  144

Query  576  GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFS  397
             ++ EK                          +W +DL  CCSEP LC K  ++PCG  S
Sbjct  145  AEHQEK-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGMVS  179

Query  396  RIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMC  217
            RIA+  ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I GG  DDFL+HL+C
Sbjct  180  RIASLVSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRRLFNIEGGSCDDFLTHLIC  239

Query  216  CCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            CCCA++QEWRE+++R  EG    K  PP  Q+M+
Sbjct  240  CCCAMIQEWRELKLRDFEGCQGRKMIPPPYQYMK  273



>ref|XP_006356472.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
Length=389

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 118/214 (55%), Gaps = 27/214 (13%)
 Frame = -2

Query  750  SQANLDVNQCEFIQHLLDVTE-VVAATSLPDKSLPAKPLKVEHGYSDADSDK-QNYDQSY  577
            SQAN D  QC  I+HL+DVT+ VV   +    +L  +P       S A   + Q  + S 
Sbjct  200  SQANNDPKQCRIIEHLIDVTQNVVNVPAEKFLALNTQPYIGTRWVSAAKVGQVQMVNASQ  259

Query  576  GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFS  397
             ++ EK                          +W +DL  CCSEP LC K  ++PCG  S
Sbjct  260  AEHQEK-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGMVS  294

Query  396  RIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMC  217
            RIA+  ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I GG  DDFL+HL+C
Sbjct  295  RIASLVSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRRLFNIEGGSCDDFLTHLIC  354

Query  216  CCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            CCCA++QEWRE+++R  EG    K  PP  Q+M+
Sbjct  355  CCCAMIQEWRELKLRDFEGCQGRKMIPPPYQYMK  388



>ref|XP_006599316.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=335

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            NEKLQ+ELQ SQAN+D++Q EFIQHLLDVTEV AA    +KS        ++ +SDA+ D
Sbjct  197  NEKLQVELQHSQANMDLHQYEFIQHLLDVTEV-AALYHSEKSHKTVEYS-DYSFSDANGD  254

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K +   S  K  EK  T   + S  S+ D +S+ GS+ +E+WH+DLL CCSEP LCIKT 
Sbjct  255  KGH--SSNEKIHEKNDTHSTSRSSVSEKDQLSTGGSYHWEDWHTDLLACCSEPCLCIKTC  312

Query  420  LFPCGTFSRIATAATNRHI  364
             +PCGT S+IAT A NR I
Sbjct  313  FYPCGTLSKIATVANNRPI  331



>emb|CDP13977.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 119/221 (54%), Gaps = 36/221 (16%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTE-VVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            +KL  EL R + N D  Q   I+HL+DVTE VV   +  + +L  +P  +  G+   +S 
Sbjct  191  DKLLFELHRLRENNDPKQYRVIEHLIDVTENVVNVPAEKNLALNLQPY-IGPGW---EST  246

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTL  421
            K   D                           + GS    EW +DL  CCSEP L +K  
Sbjct  247  KLRTD---------------------------ADGS----EWQADLFECCSEPCLSMKAC  275

Query  420  LFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFID  241
            ++PCG FSRIA   +   I+  EA N LMAYSL   CCCYTCCIR K+RK   I GG  D
Sbjct  276  IYPCGIFSRIANVVSCGKITREEALNNLMAYSLFCGCCCYTCCIRGKVRKLFGIEGGSCD  335

Query  240  DFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFM  118
            DFL+HLMCCCCALVQEWRE+E+R  EG  + K   P  Q M
Sbjct  336  DFLTHLMCCCCALVQEWRELELRDFEGCQRRKNIAPPYQCM  376



>ref|XP_002970226.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
 gb|EFJ28356.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
Length=395

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 104/190 (55%), Gaps = 21/190 (11%)
 Frame = -2

Query  756  QRSQANLDVNQCEFIQHLLDVTEV-VAATSLPDKSLPAKPLKVEH-GYSDADSDKQNYDQ  583
            Q+ Q+ ++ +QC+ I+ L+D+TE  V  T   D     +  K E   Y  ++SD   Y +
Sbjct  203  QKMQSLMEEDQCDVIRRLIDITETDVKGTYEKDPDYMKEAKKYEQSNYEQSNSDAYTYQE  262

Query  582  SYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGT  403
            S+  N+                   ++  S + ++WH DL GCC  PLLC+ T L PC T
Sbjct  263  SHKSNE-------------------TASKSWQLQDWHHDLYGCCGSPLLCVGTFLCPCCT  303

Query  402  FSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHL  223
            F+ +A  ATN  +    AC   + Y+++LSCC YTCC RRKLRK  +I GG  DD  +H 
Sbjct  304  FATVAATATNGIMPKHAACTNCLIYTMVLSCCFYTCCFRRKLRKLYNIEGGSCDDCWAHF  363

Query  222  MCCCCALVQE  193
            +C CCALVQE
Sbjct  364  LCFCCALVQE  373



>ref|XP_008440857.1| PREDICTED: cell number regulator 13 isoform X2 [Cucumis melo]
Length=336

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADS  604
            NEKLQLELQ SQ+N+DV QC+ I+ L D+TE ++A    +K L    P + E+ YSDA+ 
Sbjct  196  NEKLQLELQISQSNMDVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHEYNYSDANG  255

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +  + YD ++ KN +    +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+K
Sbjct  256  ETTHAYDGNFHKNRDG-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMK  312

Query  426  TLLFPCGTFSRIATAATN  373
            T   PC T S++A+ ATN
Sbjct  313  TFFCPCWTLSKVASVATN  330



>gb|KGN48940.1| hypothetical protein Csa_6G507150 [Cucumis sativus]
Length=336

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLP-AKPLKVEHGYSDADS  604
            NEKLQLELQ SQ+N+DV QC+ I+ L D+TE ++A    +K L    P + ++ YSD + 
Sbjct  197  NEKLQLELQISQSNMDVGQCQIIERLFDITEALSANYFIEKDLQRGIPTQHDYNYSDTNG  256

Query  603  DKQN-YDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIK  427
            +  + Y  ++ KN +    +R  SSVSS+HDL+SS   H  EEWH+DL GCCS+P LC+K
Sbjct  257  ETTHAYVGNFHKNRDG-IMTRKGSSVSSRHDLLSSNCQH--EEWHADLFGCCSQPYLCMK  313

Query  426  TLLFPCGTFSRIATAATNRHI  364
            T   PC T S++A+ ATNRH+
Sbjct  314  TFFCPCWTLSKVASVATNRHV  334



>ref|XP_001768983.1| predicted protein [Physcomitrella patens]
 gb|EDQ66181.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 110/199 (55%), Gaps = 7/199 (4%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KLQ EL+  +A +++ +C  I+HL+D TE  AA    D  + A+ +       + + +
Sbjct  193  NAKLQKELEHMRACMELEKCGVIEHLIDFTEAAAA----DPVILAEAMAEIPEEDNEEEE  248

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEE-WHSDLLGCCSEPLLCI  430
            +     +  +  E           S     +SS+     R+E+ W  DL  CC +P LCI
Sbjct  249  RHRKPHTRTEVVESSKRHMKHLKPSFSTLSLSSQKVVQCRHEDNWRYDLFDCCVDPCLCI  308

Query  429  KTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGG  250
            +T  +PCGTF+ +A++ T+   S   AC++L  +SL   CCCYT CIRRK+R++  IPG 
Sbjct  309  ETFCYPCGTFTLVASSVTDGGTSEDSACSQLAFHSLYGGCCCYTSCIRRKVRRRFDIPGD  368

Query  249  FIDDFLSHLMCCCCALVQE  193
               D+ +H+ CCCCA++QE
Sbjct  369  CFSDYWAHVCCCCCAVLQE  387



>ref|XP_010658234.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Vitis vinifera]
Length=429

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 112/223 (50%), Gaps = 55/223 (25%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGY--SDADS  604
            EKLQ+EL RSQ + D  QC  I+HL++VT+ V        ++P + L   H Y  S  ++
Sbjct  259  EKLQIELHRSQVDNDPKQCLVIEHLIEVTQNVV-------NVPGEKLVDAHAYIGSGYEA  311

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            + ++    +G   E    S                      EW +DL GCC EP      
Sbjct  312  NAKSCHGGHGSQPEDQDES----------------------EWQADLFGCCREP------  343

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
                C T  R              ACNELM YSL   CCCYTCC+RR LRK  +I GG  
Sbjct  344  ----CLTRER--------------ACNELMTYSLFCGCCCYTCCVRRNLRKHFNIEGGSC  385

Query  243  DDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            DDFL+HLMCCCCA+VQE RE+E+R  +G    K  PP  Q+M+
Sbjct  386  DDFLTHLMCCCCAMVQERRELELRNFDGCQGRKMIPPPFQYMK  428



>ref|XP_001785848.1| predicted protein [Physcomitrella patens]
 gb|EDQ49335.1| predicted protein, partial [Physcomitrella patens]
Length=399

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 103/204 (50%), Gaps = 11/204 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSD  601
            N KL+ EL   +A  +V  C  I+HL+D TE   A  +    L    L++     +   +
Sbjct  188  NAKLRKELDHMKACKEVEDCNVIKHLIDFTEATVADPV---ILGEAMLQIREEEEEEREE  244

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISS-------KGSHRYEE-WHSDLLGCCSE  445
                 +S  +   K S+ R+        D           + +++ EE WH  L  CC E
Sbjct  245  IPQKSRSVTETQRKESSQRHIKHPKPSKDSSFPSSRCSSIRSNYQIEEDWHHGLCDCCIE  304

Query  444  PLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKL  265
            P LC++T  +PC TF+ +A  AT+   S   AC+ L  +SL   C CYTCCIRRK+R++ 
Sbjct  305  PCLCMETFCYPCETFTLVAETATDGETSQDTACHLLAFHSLYGGCYCYTCCIRRKVRQRF  364

Query  264  SIPGGFIDDFLSHLMCCCCALVQE  193
            +IPG    D+ +H  CC CA++QE
Sbjct  365  NIPGDCCSDYWTHACCCWCAILQE  388



>ref|XP_002978386.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
 gb|EFJ20372.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
Length=380

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 96/190 (51%), Gaps = 36/190 (19%)
 Frame = -2

Query  756  QRSQANLDVNQCEFIQHLLDVTEV-VAATSLPDKSLPAKPLKVEH-GYSDADSDKQNYDQ  583
            Q+ Q+ ++ +QC+ I+ L+D+TE  V  T   D     +  K E   Y  ++SD   Y +
Sbjct  202  QKMQSLMEEDQCDVIRRLIDITETDVKGTYEKDPDYMKEAKKYEQSNYEQSNSDAYTYQE  261

Query  582  SYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGT  403
            S+  N+                   ++  S + ++WH DL GCC  PLLC+ T L PC T
Sbjct  262  SHKSNE-------------------TASKSWQLQDWHHDLYGCCGSPLLCVGTFLCPCCT  302

Query  402  FSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHL  223
            F+ +A  ATN                ++  CC YTCC RRKLRK  +I GG  DD  +H 
Sbjct  303  FATVAATATN---------------GIMRDCCFYTCCFRRKLRKLYNIEGGSCDDCWAHF  347

Query  222  MCCCCALVQE  193
            +C CCALVQE
Sbjct  348  LCFCCALVQE  357



>gb|EMT07324.1| hypothetical protein F775_31025 [Aegilops tauschii]
Length=395

 Score = 60.5 bits (145),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  264  SIPGGFIDDFLSHLMCCCCALVQEWreieirgieGTHKTKTSPPSTQFME  115
            S+ GG  DDFLSH+MCCCCALVQEWRE+EIRG  G  KTK +PP+ Q+ME
Sbjct  346  SVEGGCCDDFLSHVMCCCCALVQEWREVEIRGAYGG-KTKITPPAHQYME  394


 Score = 53.1 bits (126),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPA  646
            +EKLQ+ELQRSQ+N+D+ QCE I HLL VT  V  +S+PD+S  A
Sbjct  193  SEKLQVELQRSQSNMDMAQCEVIHHLLGVTRTV-ESSIPDESTDA  236


 Score = 26.6 bits (57),  Expect(3) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (11%)
 Frame = -1

Query  547  KKHFFSFIQTRLDFF*GLTSI*R-MAFRSFGLLFRTSSVHKNLTISLWDIFKNCNRSNQQ  371
            KK   +++  R+  F  L  I   M  + +G   R S   ++L  S+W++ KNC    +Q
Sbjct  263  KKQKDAYVAPRMLLFLTLLQIMPLMCEKQYG---RRS---EDLLFSMWNVLKNCFNRQEQ  316

Query  370  AYIF  359
            A++ 
Sbjct  317  AHVL  320



>gb|AAM51833.1|AC105730_7 Unknown protein [Oryza sativa Japonica Group]
Length=1202

 Score = 58.5 bits (140),  Expect(3) = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDK-SLPAKPLKVE--HGYSDA  610
            +EKLQ+ELQRSQ+N+D+ QCE IQHLL VT+ V A+S+P+K + P    K +  H     
Sbjct  196  SEKLQVELQRSQSNMDMGQCEVIQHLLGVTKTV-ASSIPEKCATPKVSEKADSNHTKVSE  254

Query  609  DSDKQNYDQSYGKNDE  562
            DS K  +D S  K  +
Sbjct  255  DSAKTYHDDSPKKQKD  270


 Score = 51.2 bits (121),  Expect(3) = 9e-17, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -2

Query  255  GGFIDDFLSHLMCCCCALVQEW  190
            GG IDDFLSHLMCCCCALVQEW
Sbjct  300  GGCIDDFLSHLMCCCCALVQEW  321


 Score = 24.6 bits (52),  Expect(3) = 9e-17, Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = -1

Query  445  TSSVHKNLTISLWDIFKNCNRSNQQAY  365
            T+   +N+   LW+I K+C    +QA+
Sbjct  273  TAPRFENILFPLWNILKDCFNCEEQAH  299



>ref|XP_002531154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31239.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKP-LKVEHGYSDADSD  601
            +KLQLELQRSQANLDVNQCE IQHL+DVTE  AA SLP+KS P K   K+E  YSD    
Sbjct  197  QKLQLELQRSQANLDVNQCEVIQHLIDVTEAAAANSLPEKSSPVKTSQKLEPNYSDVSEK  256

Query  600  KQNYDQSYGK  571
              ++D SY K
Sbjct  257  NHSFDGSYHK  266



>emb|CAN71842.1| hypothetical protein VITISV_036262 [Vitis vinifera]
Length=425

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = -2

Query  780  NEKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAK-PLKVEHGYSDADS  604
            NEKLQLELQRSQAN DV QCE IQHL+ VTE VAA S+P+ +LP +   K E  YSDA+S
Sbjct  293  NEKLQLELQRSQANYDVXQCEVIQHLIGVTEAVAANSVPEXNLPVRSSKKAESDYSDANS  352

Query  603  DKQ-NYDQSYGK  571
            DK+ + D+SY K
Sbjct  353  DKEYSVDESYPK  364



>ref|XP_010318233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum lycopersicum]
Length=377

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 88/168 (52%), Gaps = 31/168 (18%)
 Frame = -2

Query  750  SQANLDVNQCEFIQHLLDVTEVVAATSLPDK---SLPAKPLKVEHGYSDADSDK-QNYDQ  583
            SQAN D  QC  I+HL+DVT+ V   ++PD+   +L A+P       S A   + Q  + 
Sbjct  201  SQANNDPKQCRIIEHLIDVTQNV--VNVPDEKFLALSAQPYIRTGLVSAAKVGQVQMVNV  258

Query  582  SYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGT  403
            S  ++ EK                          +W +DL  CCSEP LC K  ++PCG 
Sbjct  259  SQAEHQEK-------------------------SKWQTDLFDCCSEPCLCFKACIYPCGI  293

Query  402  FSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSI  259
            FSR+A+  ++  I+   A N+L+ YSL   CCCYTCC+RR LR+  +I
Sbjct  294  FSRVASLVSHGKITREHALNDLLTYSLFCGCCCYTCCVRRSLRQLFNI  341



>ref|XP_006486524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Citrus 
sinensis]
Length=342

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 66/142 (46%), Gaps = 29/142 (20%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPA----KPLKVEHGYSDA  610
            EKL +ELQRS+ N D  QC+ I+HL+DVTE V    LP K +      +P  V  GY   
Sbjct  190  EKLHIELQRSRTNNDTKQCQLIEHLIDVTENVV-NELPGKKMQKLVANEPTYVISGYV--  246

Query  609  DSDKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCI  430
                   +  YG                   D  S        EW +DL GC  EP L +
Sbjct  247  ---TNAVNSGYG-------------------DPGSKAADESRSEWEADLFGCLREPCLSL  284

Query  429  KTLLFPCGTFSRIATAATNRHI  364
            KT ++PCGTFS+IA A T   I
Sbjct  285  KTCIYPCGTFSKIANAVTEGKI  306



>gb|KDO68875.1| hypothetical protein CISIN_1g020555mg [Citrus sinensis]
Length=324

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 66/138 (48%), Gaps = 21/138 (15%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDK  598
            EKL +ELQRS+ N D  QC+ I+HL+DVTE V    LP K L  K +  E  Y  +    
Sbjct  193  EKLHIELQRSRTNNDTKQCQLIEHLIDVTENVV-NELPGKKL-QKLVANEPTYVISGYVT  250

Query  597  QNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLL  418
               +  YG                   D  S  G     EW +DL  C  EP L +KT +
Sbjct  251  NAVNSGYG-------------------DPGSKAGDESRSEWEADLFCCLREPCLSLKTCI  291

Query  417  FPCGTFSRIATAATNRHI  364
            +PCGTFS+IA A T   I
Sbjct  292  YPCGTFSKIANAVTEGKI  309



>ref|XP_010489416.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Camelina sativa]
Length=315

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 69/115 (60%), Gaps = 3/115 (3%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSL-PDKSLPAKPLKVEHGYSDADSD  601
            EKL+ ELQRS+A  D +QCE IQHL+DVT+ VA+  L  +K L  K    E   + +   
Sbjct  197  EKLKHELQRSRARYDTDQCEVIQHLIDVTQTVASADLDSEKVLTKKKSSKEELTTSSKKK  256

Query  600  KQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLL  436
              +Y+   G      S+S +  S SS+H+L+S K S   E+WH+DLL CCS P+L
Sbjct  257  DDSYETDSGIR--TTSSSTSYVSFSSEHELVSGKSSRHREDWHTDLLDCCSAPVL  309



>ref|NP_001031368.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06685.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=314

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 67/117 (57%), Gaps = 11/117 (9%)
 Frame = -2

Query  777  EKLQLELQRSQANLDVNQCEFIQHLLDVTEVVAATSLP--DKSLPAKPLKVEHGYSDADS  604
            EKLQLELQRS+A  D +QCE IQ L+DVT+  AAT  P  +K L  K    E   S    
Sbjct  199  EKLQLELQRSRARYDADQCEVIQRLIDVTQ-TAATVEPNLEKVLTKKE---ELTSSKKRD  254

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
            D  + D S  + D +     +TS VSS H+L+S +       WH+DLL CCSEP LC
Sbjct  255  DLYDTDSSSIRADSR-----STSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLC  306



>ref|XP_009604568.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nicotiana 
tomentosiformis]
Length=209

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 9/101 (9%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC--  304
            W +++  CC +P  C+KT   PC T  +IA   +    S    C E +  + +L C C  
Sbjct  72   WSTNIFACCRDPKNCLKTCFCPCITSGQIAEIVSEGRTS----CMEGVIINFLLCCFCLA  127

Query  303  ---YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
               YT   R KLR+K  + G  + D L+H +CC CAL QE+
Sbjct  128  APLYTFYNRVKLRRKFKLEGNGVLDCLTHTLCCYCALCQEY  168



>ref|XP_011097029.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6 [Sesamum indicum]
Length=299

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 47/102 (46%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC--  310
            + W SDL  C   P   I T+ FPC TF +IA    +   S   +    M Y LI  C  
Sbjct  163  QAWRSDLFDCMKNPQNAIITMFFPCVTFGQIAEIVDSGSTSCGTSG---MLYGLIACCLA  219

Query  309  --CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              C  +C  R K+R +  +      D+L H  C CCAL QE+
Sbjct  220  IPCIMSCTYRSKMRSRFGLIESPAPDWLVHCFCECCALCQEY  261



>ref|XP_008346854.1| PREDICTED: uncharacterized protein LOC103409845 [Malus domestica]
Length=388

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 51/99 (52%), Gaps = 7/99 (7%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  310
            W + L  C  +P   I TLL PC TF +IA    N    S+ A N L+ Y LI+ C    
Sbjct  249  WKTGLFECMEDPPNAIMTLLCPCWTFGQIAEIVNNG--RSSCAANALI-YMLIMLCIFVP  305

Query  309  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            C  +C  R+KLR K  +P     D ++H +C  CAL QE
Sbjct  306  CLLSCTYRKKLRNKFDLPESPAPDCITHFLCEWCALCQE  344



>ref|XP_010265197.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Nelumbo nucifera]
Length=323

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS---  313
            E W + L  C  +P   + T  FPC TF ++A    N   S   +    + Y L+L    
Sbjct  186  EGWKTGLFDCMDDPTNTLITFFFPCLTFGQVAEIVDNGQTSCGTSG---LLYGLVLGFIG  242

Query  312  -CCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              C Y+C  R KLR K  +      D+++H +C  CAL QE+
Sbjct  243  LPCIYSCTYRTKLRSKFGLVESPAPDWVTHFLCEYCALCQEY  284



>ref|XP_010265196.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 4-like [Nelumbo nucifera]
Length=314

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-C  307
            E W + L  C  +P   + T  FPC TF ++A    N + +   +     A +L++   C
Sbjct  176  EPWSTGLFDCMEDPTNAVTTAFFPCLTFGQVAEIVDNGYTNCGTSGLLYGAIALLIWIPC  235

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             Y+C  R KLR K  +      D+++H +C  CAL QE+
Sbjct  236  IYSCTYRTKLRNKFGLMEAPAPDWVTHFLCEWCALCQEY  274



>gb|KCW83842.1| hypothetical protein EUGRSUZ_B00710 [Eucalyptus grandis]
Length=380

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = -2

Query  498  GSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI  319
            G+   E W + L  C  +PL  + T LFPC TF ++A    N   + A A    M Y+LI
Sbjct  236  GNVNTEGWTTGLFDCMDDPLNAVITCLFPCLTFGQVAELIDNGTTTCATAG---MMYALI  292

Query  318  LSC-----CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              C     C Y+C  R KLR K  +      D++ H +   CAL QE+
Sbjct  293  -GCFIGLPCIYSCTFRSKLRSKFGLVESPAPDWIVHFLFEPCALCQEY  339



>ref|XP_010045639.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Eucalyptus 
grandis]
Length=397

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = -2

Query  498  GSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI  319
            G+   E W + L  C  +PL  + T LFPC TF ++A    N   + A A    M Y+LI
Sbjct  253  GNVNTEGWTTGLFDCMDDPLNAVITCLFPCLTFGQVAELIDNGTTTCATAG---MMYALI  309

Query  318  LSC-----CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              C     C Y+C  R KLR K  +      D++ H +   CAL QE+
Sbjct  310  -GCFIGLPCIYSCTFRSKLRSKFGLVESPAPDWIVHFLFEPCALCQEY  356



>ref|XP_002964322.1| hypothetical protein SELMODRAFT_28363, partial [Selaginella moellendorffii]
 ref|XP_002967711.1| hypothetical protein SELMODRAFT_28366, partial [Selaginella moellendorffii]
 gb|EFJ31058.1| hypothetical protein SELMODRAFT_28366, partial [Selaginella moellendorffii]
 gb|EFJ34655.1| hypothetical protein SELMODRAFT_28363, partial [Selaginella moellendorffii]
Length=105

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS---CC  307
            W S + GC  +P  C  T + PC TF R+A    N   S     N L+ Y L+ +   CC
Sbjct  8    WKSGICGCWRDPESCCVTGIAPCITFGRLAETVDNDLRSCLF--NGLL-YCLLCAAGLCC  64

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            C +   R KLR+K  +PG    DF+SH  C CC+L QE+
Sbjct  65   CLSAHYRTKLREKYKLPGSRSQDFISHCFCECCSLAQEF  103



>ref|XP_006485849.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Citrus sinensis]
Length=315

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 56/113 (50%), Gaps = 9/113 (8%)
 Frame = -2

Query  510  ISSKGSHRYEE--WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNEL  337
            + S G    +E  W S L  C ++P+  + T  FPC TF ++A    + H +   +    
Sbjct  165  VPSPGPKSIQENAWSSGLFDCMNDPMNALVTACFPCLTFGQLAEIVDDGHTTCGTSG---  221

Query  336  MAYSLILSC----CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            + Y+ I  C    C  +C  R KLR K ++P     D+++H +C  CAL QE+
Sbjct  222  LLYAGIAFCIAIPCIMSCTYRTKLRSKFNLPEAPAPDWITHCLCEWCALCQEY  274



>gb|EYU36803.1| hypothetical protein MIMGU_mgv1a011010mg [Erythranthe guttata]
Length=295

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 21/108 (19%)
 Frame = -2

Query  756  QRSQANLDVNQCEFIQHLLDVTEVVAATSLPDKSLPAKPLKVEHGYSDADSDKQNYDQSY  577
            Q SQAN+DV QC+ I+ L++VTE +AA S+ +K  P K       +S  +++    + + 
Sbjct  199  QNSQANMDVGQCQVIERLIEVTE-IAANSVTEKDSPRKSSPQREHFSSKNNNNICRETTI  257

Query  576  GKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLC  433
                                +  S K +   +EWHSDLLGCCS+P LC
Sbjct  258  --------------------NTASMKETIWQDEWHSDLLGCCSDPYLC  285



>ref|XP_010465946.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 5-like [Camelina 
sativa]
Length=183

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  304
              W S L  C ++    + TLL PC TF +IA          A A     A     +C  
Sbjct  50   NRWSSQLFDCMNDSENAVITLLAPCVTFGQIAEIVDEGATPCATAGVLYGAIFFTGACFV  109

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            Y+   R K+R K  +P     D+L+HL+C  CAL QE+
Sbjct  110  YSHIFRAKIRNKYGLPDAPAPDWLTHLVCMPCALCQEY  147



>gb|KJB39330.1| hypothetical protein B456_007G006900 [Gossypium raimondii]
Length=341

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-C  307
            + W + L     +P+  + T  FPC TF +IA    + H +   +     A + ++   C
Sbjct  205  DGWRTGLFDFMDDPMNALVTAFFPCLTFGQIAEIVDDGHTTCGTSGLLYGAIAFLIGLPC  264

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              +C  R KLR K  +P     D+++H +C  CAL QE+
Sbjct  265  LMSCTYRTKLRNKFGLPEAPAPDWVTHFLCEWCALCQEY  303



>ref|XP_006826803.1| hypothetical protein AMTR_s00010p00033430 [Amborella trichopoda]
 gb|ERM94040.1| hypothetical protein AMTR_s00010p00033430 [Amborella trichopoda]
Length=162

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 48/103 (47%), Gaps = 3/103 (3%)
 Frame = -2

Query  492  HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS  313
              +  W + L GCC +P  C  T   PC TF RIA    +R  +S    + L    L  +
Sbjct  24   QNFSPWSTGLCGCCEDPTNCFTTCCCPCITFGRIA-EVVDRGTTSCAVSSSLFCCLLWFT  82

Query  312  CC--CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            CC   Y+C  R KLR + ++      D L H  C  CAL QE+
Sbjct  83   CCPYLYSCTYRSKLRGQFNLEESPCADCLVHWACGYCALCQEY  125



>ref|XP_010506915.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 5-like [Camelina 
sativa]
Length=183

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  304
              W S L  C ++    + TLL PC TF +IA          A A     A     +C  
Sbjct  50   NRWSSQLFDCMNDSENAVITLLAPCVTFGQIAEIVDEGATPCATAGVLYGAIFFTGACFV  109

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            Y+   R K+R K  +P     D+++HL+C  CAL QE+
Sbjct  110  YSHIFRAKIRNKYGLPDAPAPDWITHLVCMPCALCQEY  147



>ref|XP_009025528.1| hypothetical protein HELRODRAFT_189206 [Helobdella robusta]
 gb|ESN96350.1| hypothetical protein HELRODRAFT_189206 [Helobdella robusta]
Length=230

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 8/97 (8%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  304
            E+W   L GC  +  LCI T  FPC T +R A           E  NE M     L  C 
Sbjct  119  EQWSFRLFGCLEDINLCISTFCFPCYTEARNAAYF-------YEEENE-MGIGYCLGFCG  170

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
                +R +LR+   I G  + D  +H++C CCAL+QE
Sbjct  171  VGAVMRWRLRQHKRIEGHMLADVATHMLCPCCALIQE  207



>ref|XP_007036477.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20978.1| PLAC8 family protein [Theobroma cacao]
Length=229

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-C  307
            + W S L     +P+  + T  FPC TF +IA    + H +   +     A + ++   C
Sbjct  91   DGWRSGLFDFMDDPMNALVTAFFPCLTFGQIAEIVDDGHTTCGTSGLLYGAIAFLIGMPC  150

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              +C  R KLR K  +P     D+++H +C  CAL QE+
Sbjct  151  LLSCTYRTKLRNKFGLPEAPGPDWVTHFLCEWCALCQEY  189



>ref|XP_009785412.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nicotiana 
sylvestris]
 ref|XP_009785413.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nicotiana 
sylvestris]
Length=208

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC--  304
            W +++  CC +P  C+ T   PC T   +    +    S    C E +  +L+L CC   
Sbjct  72   WSTNIFACCRDPKNCLTTCFCPCITSGHVTEIVSEGRTS----CMEGVIVNLLLCCCLAA  127

Query  303  --YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              YT   R KLRKK  + G  + D ++H +CC CAL QE+
Sbjct  128  PLYTFYNRVKLRKKFKLEGNGVLDCITHTLCCYCALCQEY  167



>ref|XP_009146119.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 4-like [Brassica 
rapa]
Length=173

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 45/97 (46%), Gaps = 0/97 (0%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
             W+SD+  C ++    + T + PC TF +IA        + A       A  L L    Y
Sbjct  41   RWNSDIFDCMNDSENAVITFIVPCVTFGQIAEIVDEGATTCAIGGVLYGAIFLTLFPSVY  100

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +   R K+R K  +P     D+L+HL C  CAL QE+
Sbjct  101  SSLFRAKIRNKYGLPDAPAPDWLTHLFCEPCALCQEY  137



>ref|XP_007036475.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20976.1| PLAC8 family protein [Theobroma cacao]
Length=369

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L     +P+  + T  FPC TF +IA    + H +   +     A + ++   C  
Sbjct  233  WRSGLFDFMDDPMNALVTAFFPCLTFGQIAEIVDDGHTTCGTSGLLYGAIAFLIGMPCLL  292

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +C  R KLR K  +P     D+++H +C  CAL QE+
Sbjct  293  SCTYRTKLRNKFGLPEAPGPDWVTHFLCEWCALCQEY  329



>ref|XP_010042703.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like, partial [Eucalyptus 
grandis]
Length=165

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 11/114 (10%)
 Frame = -2

Query  513  LISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELM  334
            +++   S  Y  W +DL  C S+P LC  T   PC TF +I+       +    +C  L 
Sbjct  14   VVTPPPSLDYVPWSTDLFDCFSDPNLCCITFFCPCVTFGKISEI-----VDRGNSCCVLN  68

Query  333  A--YSLILSCCCYTCCI----RRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
               Y LI     Y  C     R K+R++  I G  I+DF+ H  C  CAL QE+
Sbjct  69   GAIYFLIAWLTGYARCFSFFNRLKMRRQYKIRGDVIEDFILHCFCEPCALTQEY  122



>ref|XP_008244010.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Prunus mume]
Length=415

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 47/99 (47%), Gaps = 7/99 (7%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  310
            W + L  C  +P   I TL  PC TF ++A    N   S A   N L+ Y LI  C    
Sbjct  276  WKTGLFQCLDDPPNAIMTLFCPCWTFGQVAEIVNNGQTSCA--VNSLI-YMLITVCIFVP  332

Query  309  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            C  +C  R+KLR K  +P     D + H +C  CAL QE
Sbjct  333  CLLSCTYRKKLRNKFDLPESPAPDCIIHFLCEWCALCQE  371



>ref|XP_006817786.1| PREDICTED: cell number regulator 13-like [Saccoglossus kowalevskii]
Length=128

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
            +W + L GC  +  LC+ T   PC T  + A A     +  +   + L+    ++ C C 
Sbjct  12   DWENGLFGCFGDCGLCLVTSFLPCCTAGKNAQA-----VGKSCLVHSLLGLIPVVGCVCQ  66

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            +  +RR +R++ SI G    D+L HL+C CCAL+QE
Sbjct  67   SG-VRRDIREQRSIDGSCCGDYLVHLLCGCCALIQE  101



>ref|XP_002885257.1| hypothetical protein ARALYDRAFT_479347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61516.1| hypothetical protein ARALYDRAFT_479347 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 46/97 (47%), Gaps = 0/97 (0%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
             W S+L  C ++    + TL+ PC TF +IA          A A     A     +C  Y
Sbjct  51   RWSSELFDCMNDSENAVITLIAPCVTFGQIAEVVDEGATPCATAGLLYGAIFFSGACFVY  110

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +   R K+R K  +P     D+++HL+C  CAL QE+
Sbjct  111  SYMFRAKIRNKYGLPDAPAPDWITHLVCMQCALCQEY  147



>ref|XP_009339371.1| PREDICTED: proline-rich proteoglycan 2-like [Pyrus x bretschneideri]
Length=406

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  307
            E+W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  265  EQWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVIDNGTSSCATSG---LFYGLIASFIG  321

Query  306  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  322  IPFIMSCTYRTKLRSKYNLIESPAPDWVTHLFCEPCALCQEY  363



>ref|XP_010489915.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 5-like, partial [Camelina 
sativa]
Length=158

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  304
              W S L  C ++    + TLL PC TF +IA          A A     A     +C  
Sbjct  25   NRWSSQLFDCMNDSENAVITLLAPCVTFGQIAEIVDEGATPCATAGVLYGAIFFTGACFV  84

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            Y+   R K+R K  +P     D+++HL+C  CAL QE+
Sbjct  85   YSHIFRAKIRNKYGLPDAPAPDWITHLVCMPCALCQEY  122



>ref|XP_006817787.1| PREDICTED: cell number regulator 11-like [Saccoglossus kowalevskii]
Length=124

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 6/96 (6%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
            +W + L GC  +  LCI T   PC T  R A       +  +   + L+    +L   C 
Sbjct  11   QWKNGLFGCFGDVGLCIFTFFLPCWTAGRNAEG-----VGKSCLIHSLLCLVPVLGWVCQ  65

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            +  +RR++R++ +I G   +D+L H+ C CCAL+QE
Sbjct  66   SG-VRREIREQRTIAGTCCNDYLVHIFCGCCALIQE  100



>ref|XP_006826802.1| hypothetical protein AMTR_s00010p00032660 [Amborella trichopoda]
 gb|ERM94039.1| hypothetical protein AMTR_s00010p00032660 [Amborella trichopoda]
Length=258

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 7/101 (7%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC---  310
             W SD+  CC +P+  + T LFPC TF++IA        +   +    + Y+ I  C   
Sbjct  119  PWSSDIFSCCDDPMNALITALFPCLTFAQIAEIVDEGRTTCTTSG---IMYAGIACCIGL  175

Query  309  -CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             C  +C  R KLR K  +      D++SH +C  CAL QE+
Sbjct  176  PCLLSCTYRTKLRAKYELVEAPAPDWVSHFLCEWCALCQEY  216



>emb|CDX92237.1| BnaA05g21700D [Brassica napus]
Length=173

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 45/97 (46%), Gaps = 0/97 (0%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
             W+SDL  C ++    + T + PC TF +IA        + A       A  L L    Y
Sbjct  41   RWNSDLFDCMNDSENAVITCIVPCVTFGQIAEIVDEGATTCAIGGVLYGAIFLTLFPSVY  100

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +   R K+R K  +P     D+L+HL C  CAL QE+
Sbjct  101  SSLFRAKIRNKYGLPDAPAPDWLTHLFCEPCALCQEY  137



>ref|XP_009339439.1| PREDICTED: uncharacterized protein LOC103931645 [Pyrus x bretschneideri]
Length=952

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  307
            E+W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  214  EQWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVIDNGTSSCATSG---LFYGLIASFIG  270

Query  306  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  271  IPFIMSCTYRTKLRSKYNLIESPAPDWVTHLFCEPCALCQEY  312



>ref|XP_007036480.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20981.1| PLAC8 family protein [Theobroma cacao]
Length=381

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 54/111 (49%), Gaps = 3/111 (3%)
 Frame = -2

Query  516  DLISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACN  343
            D  SS      + W++ L  C  +P+  + T+ FPC TF R+A      H S  ++    
Sbjct  230  DAASSGFPLPVKVWNTGLFDCMDDPMNALITVCFPCLTFGRVAEIVDEGHTSCGTSGLLY  289

Query  342  ELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             L+A+  I   C  +C  R KLR KL +      D+++H  C  CAL QE+
Sbjct  290  GLIAF-FIGVPCILSCAYRTKLRNKLGLVESPAPDWVTHCFCDWCALCQEY  339



>ref|XP_010527531.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 12 [Tarenaya hassleriana]
Length=162

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 48/95 (51%), Gaps = 0/95 (0%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYT  298
            W + L  C  +P +C +T + PC TF + +   +   I  + + +  M  SL+  CC Y 
Sbjct  30   WTTGLCDCHEDPQICFQTAVLPCITFGQNSEIVSRGTIPWSNSSSIHMVLSLVGCCCIYG  89

Query  297  CCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
               R +LR+ LS+P     D L H+ C  CAL QE
Sbjct  90   FPNRTRLREHLSLPEEPCRDCLLHIFCTHCALCQE  124



>ref|XP_008244011.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Prunus mume]
Length=412

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 46/99 (46%), Gaps = 10/99 (10%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  310
            W + L  C  +P   I TL  PC TF ++A    N      +  N L+ Y LI  C    
Sbjct  276  WKTGLFQCLDDPPNAIMTLFCPCWTFGQVAEIVNN-----GQTFNSLI-YMLITVCIFVP  329

Query  309  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            C  +C  R+KLR K  +P     D + H +C  CAL QE
Sbjct  330  CLLSCTYRKKLRNKFDLPESPAPDCIIHFLCEWCALCQE  368



>ref|XP_008393299.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6-like [Malus domestica]
Length=402

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  307
            E+W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI +   
Sbjct  261  EQWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVVDNGRSSCATSG---LFYGLIAAFIG  317

Query  306  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 +C  R KLR K ++      D++ HL+C  CAL QE+
Sbjct  318  IPFIMSCTYRTKLRSKYNLIESPAPDWVIHLLCEPCALCQEY  359



>ref|XP_010663577.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 6 [Vitis vinifera]
 emb|CBI15431.3| unnamed protein product [Vitis vinifera]
Length=313

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACNELMAYSLILSC  310
            E W S L  C ++P   + T+ FPC TF ++A      H S  ++     L+A+ LI   
Sbjct  174  EYWTSGLFDCMNDPTNALVTVFFPCVTFGQVAEIVDRGHTSCGTSGLLYGLIAF-LIGLP  232

Query  309  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            C  +C  R K+R   ++      D++ H +C CCAL QE+
Sbjct  233  CIMSCTYRTKMRSMYNLSESPGPDWVVHCLCECCALCQEY  272



>gb|EJT99228.1| PLAC8-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
Length=206

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 15/109 (14%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSA--EACNELMA-------Y  328
            EWH+ L GCC    +C   L+ PC  +SR    A  RH+S        E  A       Y
Sbjct  43   EWHTGLFGCCGAIDICCPALVCPCWVYSR--NRARLRHLSGTGQPLGRETSAWDGNCGLY  100

Query  327  SLILSCCCYTCC----IRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            +L+ +  C+       +RR +R++ +IPG    D L+ L+C  CAL QE
Sbjct  101  ALLTAVGCWGWVLEGNVRRGIRERYNIPGDSCTDTLTTLLCPPCALTQE  149



>ref|XP_009348105.1| PREDICTED: proline-rich protein HaeIII subfamily 1-like [Pyrus 
x bretschneideri]
Length=414

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (48%), Gaps = 9/103 (9%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEAC-NELMAYSLILSCC  307
            E W S+L  C  +P+  + T   PC TF +IA    N     A +C    + Y LI +  
Sbjct  273  EPWSSELFDCMDDPMNALTTAFVPCLTFGQIAEVVDN----GASSCVTSGLFYGLIAAFV  328

Query  306  ----CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                  +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  329  GIPFIMSCTYRTKLRSKYNLIESPAPDWITHLFCEPCALCQEY  371



>ref|XP_006393318.1| hypothetical protein EUTSA_v10011755mg [Eutrema salsugineum]
 gb|ESQ30604.1| hypothetical protein EUTSA_v10011755mg [Eutrema salsugineum]
Length=227

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 45/102 (44%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI----L  316
            + W S L  C ++    I T  FP  TF +IA        S   A    M Y LI     
Sbjct  89   QNWTSGLFDCMNDGENAIITCFFPFVTFGQIAEVTDEGATSCGTAG---MLYGLICCLFG  145

Query  315  SCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              C YTC  R KLR K  +P     D+++H  C  CAL QE+
Sbjct  146  IPCVYTCTYRAKLRNKFGLPDAPAPDWITHCFCEYCALCQEY  187



>ref|XP_006826804.1| hypothetical protein AMTR_s00010p00034340 [Amborella trichopoda]
 gb|ERM94041.1| hypothetical protein AMTR_s00010p00034340 [Amborella trichopoda]
Length=191

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSL-ILSC-CC  304
            W + L  CC +P  C  T   PC TF +IA  A +R I+S      L    L I+ C CC
Sbjct  57   WSTGLCDCCEDPANCCITCWCPCITFGQIAEIA-DRGITSCGVSGSLYGLMLLIVGCACC  115

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            Y+C  R KLR + ++      D L H  C  CAL QE+
Sbjct  116  YSCFYRSKLRSQYNLSKSPCADCLVHFFCEGCALCQEY  153



>ref|XP_002318695.2| hypothetical protein POPTR_0012s09370g [Populus trichocarpa]
 gb|EEE96915.2| hypothetical protein POPTR_0012s09370g [Populus trichocarpa]
Length=184

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA-YSLILS-C  310
             +W + L  CC +P  C+ T   PC TF +IA    NR  +   AC    A Y+L+L   
Sbjct  48   RKWSTGLCHCCDDPANCLITCFCPCITFGQIAEI-VNRGSTRIAACFISGAVYALLLGFA  106

Query  309  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            C Y+CC R KLR +  +      D L H  C  CAL QE+
Sbjct  107  CLYSCCYRSKLRGQYDLEEAPCVDCLVHFCCETCALSQEY  146



>ref|XP_006469221.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Citrus sinensis]
Length=176

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVISLVTGCGCLY  99

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            + C R K+R++  + GG   D L+H  C  CAL QE+
Sbjct  100  SACYRSKMRQQYMLKGGPCGDCLAHFCCETCALSQEY  136



>ref|XP_007210160.1| hypothetical protein PRUPE_ppa021734mg [Prunus persica]
 gb|EMJ11359.1| hypothetical protein PRUPE_ppa021734mg [Prunus persica]
Length=429

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  307
            E W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  317  EGWSSELFDCMDDPMNALTTAFVPCLTFGQIAEIVDNGTTSCAISG---LFYGLIASFLG  373

Query  306  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 +C  R KLR    +      D+++HL C  CAL QE+
Sbjct  374  VPFIMSCTYRTKLRSMFGLVEAPAPDWVTHLFCEPCALCQEY  415



>gb|KJB37241.1| hypothetical protein B456_006G195300 [Gossypium raimondii]
Length=268

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 49/108 (45%), Gaps = 1/108 (1%)
 Frame = -2

Query  510  ISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA  331
            + S      E W + L  C  +P+  + T+ FPC TF ++A        S A +      
Sbjct  119  VHSTYQQHVEGWKTGLFDCMDDPINALITVCFPCVTFGQVAEIVDEGRTSCASSGLLYGV  178

Query  330  YSLILSC-CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             +L++   C  +C  R KLR K  +      D++ H  C CCAL QE+
Sbjct  179  IALLIGIPCILSCGYRTKLRSKFQLSESPAPDWVVHCFCDCCALCQEY  226



>ref|XP_008346788.1| PREDICTED: proline-rich protein HaeIII subfamily 1-like [Malus 
domestica]
Length=414

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  307
            E W S L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI +   
Sbjct  273  EPWSSKLFDCMDDPMNALTTAFVPCLTFGQIAEVVDNGTSSCATSG---LFYGLIAAFIG  329

Query  306  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 +C  R KLR K ++      D+++HL C  CAL QE+
Sbjct  330  VPFIMSCTYRTKLRSKYNLIESPAPDWVTHLFCEPCALCQEY  371



>ref|XP_007036476.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY20977.1| PLAC8 family protein [Theobroma cacao]
Length=391

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACNELMAYSLILSCCC  304
            W + L  C  +P+  + T+ FPC TF ++A      H S  ++     L+A+  I   C 
Sbjct  132  WKTGLFDCMDDPMNALITVCFPCVTFGQVAEIVDEGHTSCGTSGLLYGLIAF-FIGVPCI  190

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             +C  R KLR KL +      D+++H  C  CAL QE+
Sbjct  191  LSCAYRTKLRNKLGLVESPAPDWVTHCFCDWCALCQEY  228



>gb|KJB12064.1| hypothetical protein B456_002G175600, partial [Gossypium raimondii]
Length=162

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W +    CCS+   C  +   PC TF +IA        S   +    +    I  C C Y
Sbjct  40   WSAGFCDCCSDLKTCCISYWCPCITFGQIAEIVDKGSTSCGASGALYILIMFITGCGCLY  99

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +CC R KLRK+ ++ GG   D + H  C  CAL QE+
Sbjct  100  SCCYRSKLRKQYNLKGGDCGDCMRHFCCEPCALTQEY  136



>ref|XP_006857399.1| hypothetical protein AMTR_s00067p00142050 [Amborella trichopoda]
 gb|ERN18866.1| hypothetical protein AMTR_s00067p00142050 [Amborella trichopoda]
Length=139

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 6/105 (6%)
 Frame = -2

Query  495  SHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI-  319
            S R  +W + L G C + +LC  T + PC TF +IA      H S          Y L+ 
Sbjct  5    SSRPPQWTTSLTGSCDDGVLCCITCVLPCITFGQIAEVLDEGHTSCLV---HGFIYGLLW  61

Query  318  -LSC-CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             + C C ++C  R +LR+K ++P    +DF  H  C  CAL QE+
Sbjct  62   TMGCHCLHSCTYRGRLREKYNLPEEPCNDFCVHWCCDACALCQEY  106



>gb|KDO38128.1| hypothetical protein CISIN_1g031916mg [Citrus sinensis]
Length=150

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALYLVISLVTGCGCLY  99

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            + C R K+R++  + GG   D L+H  C  CAL QE+
Sbjct  100  SSCYRSKMRQQYMLKGGPCGDCLAHFCCDTCALSQEY  136



>ref|XP_008244012.1| PREDICTED: proline-rich protein 2-like [Prunus mume]
Length=461

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 7/102 (7%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC-  307
            E W S+L  C  +P+  + T   PC TF +IA    N   S A +    + Y LI S   
Sbjct  317  EGWSSELFDCMDDPMNALTTAFVPCLTFGQIAEIVDNGTTSCAISG---LFYGLIASFLG  373

Query  306  ---CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 +C  R KLR    +      D+++HL C  CAL QE+
Sbjct  374  VPFIMSCTYRTKLRSMFGLVEAPAPDWVTHLFCEPCALCQEY  415



>emb|CDP00820.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC-Y  301
            W + L  C S+   C  TL  PC T  RIA    ++  +S EAC  L A   IL C C +
Sbjct  36   WSTGLYDCFSDVPNCCLTLWCPCVTLGRIAEI-VDKGSTSREACGALYAVLNILGCACLH  94

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            +   R +LRK+ ++P     D L H  C  CAL QE
Sbjct  95   SRLYRSRLRKQYNLPATPCGDCLVHFFCEPCALCQE  130



>ref|XP_004297458.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=196

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCC  304
            E W S LL C S+P  C  T   PC TF +IA        S   +       + +  C C
Sbjct  56   EPWKSGLLDCFSDPKSCCLTFWCPCVTFGQIAEIVDKGSTSCGASGALYALIAFVTGCSC  115

Query  303  -YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             Y+C  R K+R++ S+      D L H  C  CAL QE+
Sbjct  116  IYSCFYRSKMRQQYSLEESPCGDCLVHCFCEACALCQEY  154



>ref|XP_007160407.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
 gb|ESW32401.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
Length=164

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLI---LSC  310
            EW + L  C S+   C  T L PC TF +IA    ++  +S  A   L  YSLI   L C
Sbjct  28   EWSTGLFDCFSDLKNCFITCLCPCITFGQIAEV-VDKGATSCGASGAL--YSLIYCLLGC  84

Query  309  -CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
             C Y+C  R K+R++  + G    DFL+H  C  CAL QE
Sbjct  85   GCIYSCVYRTKMRQQYKLKGTPFLDFLTHCCCETCALCQE  124



>ref|XP_006448197.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
 gb|ESR61437.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
Length=150

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVISLVTGCGCLY  99

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            + C R K+R++  + GG   D L H  C  CAL QE+
Sbjct  100  SACYRSKMRQQYMLKGGPCGDCLVHFCCETCALSQEY  136



>ref|XP_010066569.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Eucalyptus grandis]
Length=187

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L  C  +  +C  +   PC TF RIA    +  +S         A +L+  C CC+
Sbjct  54   WSSGLFSCFGDIPICCLSFWCPCITFGRIAEITDHGSVSCPVHGAIYTAIALLTGCACCF  113

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +CC R K+R++  +      D L H  C  CAL QE+
Sbjct  114  SCCYRTKMRQQYQLKEDPCADCLVHFCCETCALTQEY  150



>ref|XP_006448196.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
 gb|ESR61436.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
Length=176

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L  C S+   C  T   PC TF RIA        S + +    +  SL+  C C Y
Sbjct  40   WSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVISLVTGCGCLY  99

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            + C R K+R++  + GG   D L H  C  CAL QE+
Sbjct  100  SACYRSKMRQQYMLKGGPCGDCLVHFCCETCALSQEY  136



>ref|XP_009009567.1| hypothetical protein HELRODRAFT_184849 [Helobdella robusta]
 gb|ESO12847.1| hypothetical protein HELRODRAFT_184849 [Helobdella robusta]
Length=105

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 8/97 (8%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNR-HISSAEACNELMAYSLILSCCC  304
            EW + + GC ++  +CI T   PC T  + A A      +     C E +   L  +   
Sbjct  3    EWKNGIFGCFNDCTVCIITYFLPCYTAGKNAEAVGKSCFLYGCLTCIEPIGCILRST---  59

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
                IR+++R++ SI G F  D L H+ C CCALVQE
Sbjct  60   ----IRQQIREQYSIDGSFGGDLLCHMCCPCCALVQE  92



>ref|XP_011016153.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Populus euphratica]
Length=181

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 50/99 (51%), Gaps = 4/99 (4%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS-CC  307
             +W + L  CC +P  C  T L PC TF +IA    NR  ++      +  Y+L+L   C
Sbjct  48   RKWSTGLCHCCDDPANCFITCLCPCITFGQIAEI-VNRGSTTCFMSGSV--YALLLGFAC  104

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             Y+CC R KLR +  +      D L+H  C  CAL QE+
Sbjct  105  LYSCCYRSKLRGQYDLEEAPCMDCLAHFCCETCALSQEY  143



>ref|XP_009346952.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Pyrus x bretschneideri]
Length=132

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 58/130 (45%), Gaps = 23/130 (18%)
 Frame = -2

Query  447  EPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----CCYTCCIRRK  280
            +P   I TLL PC TF +IA    N    S+ A N L+ Y LI+ C    C  +C  R+K
Sbjct  3    DPPNAIMTLLCPCWTFGQIAEIVNNGR--SSCAANALI-YMLIMLCIFVPCLLSCTYRKK  59

Query  279  LRKKLSIPGGFIDDFLSHLMCCCCALVQE--------------WreieirgieGTHKTKT  142
            LR K  +P     D ++H +C  CAL QE              W     +      K + 
Sbjct  60   LRNKFDLPESPAPDCITHFLCEWCALCQEHRELQLRGLDPTLGWVGNLEQIQRMQQKRQA  119

Query  141  --SPPSTQFM  118
              SPP+TQ M
Sbjct  120  AMSPPTTQRM  129



>gb|AFM43805.1| fruit weight 2.2-2 protein [Dimocarpus longan]
Length=175

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  DQSYGKNDEKWstsrntssvsSKHDLISSKGSH--RYEEWHSDLLGCCSEPLLCIKTLLF  415
             Q + K  ++++ + N       H   +  G+H     +W + L  CC +P  C+ T  +
Sbjct  5    SQDHHKYAQRYAGAMNIQPTQPYHSSYTPPGAHGTATTQWSTGLCHCCDDPANCLITCFW  64

Query  414  PCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDF  235
            PC TF +IA       IS   +        L    C Y+C  R +LR +  +      D 
Sbjct  65   PCITFGQIAEIVNQGSISCVASGMVYGLLGLTGLSCLYSCLYRSRLRGQYDLEEAPCADC  124

Query  234  LSHLMCCCCALVQEW  190
            L H  C  CAL QE+
Sbjct  125  LVHFCCETCALCQEY  139



>gb|KCW64493.1| hypothetical protein EUGRSUZ_G02100 [Eucalyptus grandis]
Length=237

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L  C  +  +C  +   PC TF RIA    +  +S         A +L+  C CC+
Sbjct  104  WSSGLFSCFGDIPICCLSFWCPCITFGRIAEITDHGSVSCPVHGAIYTAIALLTGCACCF  163

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +CC R K+R++  +      D L H  C  CAL QE+
Sbjct  164  SCCYRTKMRQQYQLKEDPCADCLVHFCCETCALTQEY  200



>ref|NP_188474.1| PLAC8 family protein [Arabidopsis thaliana]
 sp|Q9LS45.1|PCR5_ARATH RecName: Full=Protein PLANT CADMIUM RESISTANCE 5; Short=AtPCR5 
[Arabidopsis thaliana]
 dbj|BAB01111.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAR24222.1| At3g18450 [Arabidopsis thaliana]
 gb|AAR92357.1| At3g18450 [Arabidopsis thaliana]
 gb|AEE76099.1| PLAC8 family protein [Arabidopsis thaliana]
Length=184

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 45/97 (46%), Gaps = 0/97 (0%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
            +W S L  C ++    + TL+ PC TF +IA          A A     A     +   Y
Sbjct  51   QWSSQLFDCMNDSENAVITLIAPCVTFGQIAEIVDEGATPCATAGLLYGALFFTGASFVY  110

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +   R ++RKK  +P     D+++HL+C   AL QE+
Sbjct  111  SYMFRARIRKKFGLPDAPAPDWITHLVCMPFALCQEY  147



>ref|XP_002527777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34587.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-CCY  301
            W S L GCCS+   C  T   PC TF +IA  A     S A +       +    C C Y
Sbjct  54   WSSGLCGCCSDVKNCCITCWCPCITFGQIAEIADKGTTSCATSGAIYGILAWFTGCGCIY  113

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            +C  R KLR++  +P    +D L H  C  CAL QE+
Sbjct  114  SCLYRSKLRQQYMLPESPCNDCLVHCCCEACALCQEY  150



>ref|XP_007046277.1| PLAC8 family protein, putative [Theobroma cacao]
 gb|EOY02109.1| PLAC8 family protein, putative [Theobroma cacao]
Length=157

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 43/97 (44%), Gaps = 0/97 (0%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCY  301
            +W + L  CC +P  C+ T   PC TF RIA        S   +C    A   I     Y
Sbjct  24   QWTTGLYDCCDDPSNCLTTCFCPCITFGRIAEIIDRGDRSCGLSCLVYFAMHSIHCAWLY  83

Query  300  TCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                R +LR+  S+P     D L H  CC C+L QE+
Sbjct  84   GGIYRTQLRQLFSLPETPRGDKLVHRCCCLCSLSQEY  120



>ref|XP_004297457.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 3-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 46/98 (47%), Gaps = 1/98 (1%)
 Frame = -2

Query  483  EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC-C  307
            E W+S LL C S+P  C  T L PC TF RI   A     S        +  +L+  C C
Sbjct  3    EPWNSGLLDCFSDPKSCCLTYLCPCVTFGRIVEIADKGSTSCCLGGAAYVLVALMFGCPC  62

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
              +   R +LR++ S+ G    D L H  C  CAL QE
Sbjct  63   LLSFRYRSRLRQQYSLEGNSCGDCLVHCFCETCALCQE  100



>ref|XP_001756741.1| predicted protein [Physcomitrella patens]
 gb|EDQ78338.1| predicted protein, partial [Physcomitrella patens]
Length=107

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHIS--SAEACNELMAYSLILSCCC  304
            W + L  CC++  +C  T+ FPC  F   A A      S  +A     ++ +++ L C  
Sbjct  1    WSTGLFDCCADMPMCCFTMFFPCLAFGWNAQALDESKNSCWTAATAWWVLQHTIALGCL-  59

Query  303  YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQE  193
            Y+   R KLR K +IP G   D L H +C  CA  QE
Sbjct  60   YSASYRGKLRSKYNIPEGPFSDSLIHCLCWPCAFCQE  96



>ref|XP_006362555.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 9-like [Solanum tuberosum]
Length=144

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 45/99 (45%), Gaps = 4/99 (4%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCC--  307
            +W +DL  C  +P LC+KT   PC T   +         S   AC  L+AY++    C  
Sbjct  10   QWTTDLFDCWDDPSLCVKTCFCPCVTIGEVVEMLDQGTTSKGHAC--LLAYAMGSIHCGW  67

Query  306  CYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
             Y    RRKLR+   +P     D L    CC C + QE+
Sbjct  68   IYGRRYRRKLREMFKLPESPYSDTLISCCCCVCGISQEY  106



>ref|XP_010068707.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
Length=146

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 1/108 (1%)
 Frame = -2

Query  510  ISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA  331
            +++ G+     W + L  CC +   C  T   PC TF +I+        S    C     
Sbjct  3    LTNPGNVEEHPWSTGLCDCCGDIKSCCITFWCPCITFGQISEILDKGATSCVMNCAIYTL  62

Query  330  YSLILSCCC-YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              L+ SC C Y+CC R KLR++  +     +D L H  C  CAL QE+
Sbjct  63   IYLLTSCACLYSCCYRTKLRREFGLKEDPCNDCLVHCCCMYCALCQEY  110



>ref|XP_010265361.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 7-like [Nelumbo nucifera]
Length=214

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 7/100 (7%)
 Frame = -2

Query  477  WHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSC----  310
            W + L  C  +P   I+T  FPC TF  +A    +   S    C   + Y +I++C    
Sbjct  70   WTTGLFDCMEDPENAIETFFFPCCTFGEVAEIVDDGETS---CCLAALLYLIIMNCSLPP  126

Query  309  CCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            C  +C  R  LRKK  +    + D+  HL    CAL QE+
Sbjct  127  CILSCGFRSMLRKKFGLVESPLPDWAVHLFFEPCALCQEY  166



>gb|KCW64542.1| hypothetical protein EUGRSUZ_G02148, partial [Eucalyptus grandis]
Length=149

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 1/108 (1%)
 Frame = -2

Query  510  ISSKGSHRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMA  331
            +++ G+     W + L  CC +   C  T   PC TF +I+        S    C     
Sbjct  6    LTNPGNVEEHPWSTGLCDCCGDIKSCCITFWCPCITFGQISEILDKGETSCVMNCAIYKL  65

Query  330  YSLILSCCC-YTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              L+ SC C Y+CC R KLR++  +     +D L H  C  CAL QE+
Sbjct  66   IYLLTSCACLYSCCYRTKLRREFGLKEDPCNDCLVHCCCMHCALCQEY  113



>ref|XP_004298295.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 9-like [Fragaria 
vesca subsp. vesca]
Length=157

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 43/108 (40%), Gaps = 22/108 (20%)
 Frame = -2

Query  480  EWHSDLLGCCSEPLLCIKTLLFPCGTFSRIA-----------TAATNRHISSAEACNELM  334
            +W + L  C  +   CI T   PC TF RIA            A T  H   A  C  L 
Sbjct  24   QWSTGLFDCLEDRSNCIFTCFCPCITFGRIAEIVDRGTTSCAVAGTIYHFLGAVGCGWLY  83

Query  333  AYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
            A S            R K+R   S+P     DFL H  CC C+L QE+
Sbjct  84   AGSY-----------RTKMRGLFSLPAAPCHDFLVHSFCCVCSLCQEY  120



>ref|XP_004294815.1| PREDICTED: cell number regulator 2-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 5/112 (4%)
 Frame = -2

Query  513  LISSKGSHRY--EEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAE--AC  346
            ++S+  S R+   EW + L  CC +P  C+ T   PC TF +IA        S A+   C
Sbjct  42   VVSTGHSARHVGGEWSTGLCHCCDDPPNCMITCFCPCITFGQIAEIVDQGSSSCAQQGTC  101

Query  345  NELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
              ++  + +L+ C Y+C  R KLR +  +      D L H  C  CAL QE+
Sbjct  102  YGILLATTVLA-CLYSCFYRSKLRGQYDLEESPCVDCLVHFCCPGCALCQEY  152



>ref|XP_004294816.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=188

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 48/105 (46%), Gaps = 7/105 (7%)
 Frame = -2

Query  492  HRYEEWHSDLLGCCSEPLLCIKTLLFPCGTFSRIATAATNRHISSAEACNELMAYSLILS  313
            H   EW + L  CC +P  C+ T   PC TF +IA        S A+   +   Y ++L+
Sbjct  51   HVGGEWSTGLCHCCDDPANCLITFFCPCITFGQIAEIVEQGSSSCAQ---QGTCYGILLA  107

Query  312  ----CCCYTCCIRRKLRKKLSIPGGFIDDFLSHLMCCCCALVQEW  190
                 C Y+C  R +LR +  +      D L H  C  CAL QE+
Sbjct  108  TTGLACLYSCFFRSRLRGQYDLEESPCVDCLVHFCCATCALCQEY  152



>ref|XP_007047233.1| Plant cadmium resistance 2 [Theobroma cacao]
 gb|EOX91390.1| Plant cadmium resistance 2 [Theobroma cacao]
Length=214

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 58/138 (42%), Gaps = 0/138 (0%)
 Frame = -2

Query  603  DKQNYDQSYGKNDEKWstsrntssvsSKHDLISSKGSHRYEEWHSDLLGCCSEPLLCIKT  424
            +K+ Y  S+G      +    T+  +    +    G+     W + L  CC +P  C+ T
Sbjct  30   EKEMYTSSHGNAKYAPAGYPATAMKAQPSHVSPFHGTASATGWSTGLCHCCDDPANCLIT  89

Query  423  LLFPCGTFSRIATAATNRHISSAEACNELMAYSLILSCCCYTCCIRRKLRKKLSIPGGFI  244
             L PC TF +IA       IS A +       +L    C Y+C  R +LR +  +     
Sbjct  90   CLCPCVTFGQIAEIVNKGSISCAASGAVYGLLALAGLSCLYSCVYRSRLRGQYDLEEAPC  149

Query  243  DDFLSHLMCCCCALVQEW  190
             D L H  C  C+L QE+
Sbjct  150  ADCLVHFCCETCSLCQEY  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940