BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016O01

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759318.1|  PREDICTED: tip elongation aberrant protein 3...    286   4e-88   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    285   4e-87   Nicotiana tomentosiformis
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    276   1e-83   Solanum tuberosum [potatoes]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    270   1e-81   Solanum lycopersicum
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    267   2e-80   Sesamum indicum [beniseed]
gb|KDO75101.1|  hypothetical protein CISIN_1g0050432mg                  241   6e-74   Citrus sinensis [apfelsine]
emb|CDO98898.1|  unnamed protein product                                246   2e-72   Coffea canephora [robusta coffee]
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    244   9e-72   Prunus mume [ume]
ref|XP_007222490.1|  hypothetical protein PRUPE_ppa004126mg             238   1e-70   
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    241   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    241   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    241   2e-70   Vitis vinifera
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    239   1e-69   
emb|CAN77820.1|  hypothetical protein VITISV_043441                     241   3e-69   Vitis vinifera
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             236   1e-68   Citrus clementina [clementine]
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   1e-68   Citrus sinensis [apfelsine]
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    235   3e-68   
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    233   1e-67   Nelumbo nucifera [Indian lotus]
gb|KJB72598.1|  hypothetical protein B456_011G187500                    231   3e-67   Gossypium raimondii
gb|KJB72601.1|  hypothetical protein B456_011G187500                    231   3e-67   Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                    231   5e-67   Gossypium raimondii
gb|KJB72596.1|  hypothetical protein B456_011G187500                    231   6e-67   Gossypium raimondii
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    231   7e-67   Elaeis guineensis
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   1e-66   Populus euphratica
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            230   2e-66   Gossypium arboreum [tree cotton]
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            230   2e-66   Gossypium arboreum [tree cotton]
gb|KJB38636.1|  hypothetical protein B456_006G264600                    228   4e-66   Gossypium raimondii
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   5e-66   
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   7e-66   Populus euphratica
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   8e-66   Elaeis guineensis
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   8e-66   Phoenix dactylifera
gb|KJB38635.1|  hypothetical protein B456_006G264600                    228   9e-66   Gossypium raimondii
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   Populus euphratica
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   Populus euphratica
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   2e-65   Fragaria vesca subsp. vesca
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      227   3e-65   Gossypium arboreum [tree cotton]
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    226   6e-65   
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    226   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             225   2e-64   
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   3e-64   Nelumbo nucifera [Indian lotus]
gb|KDP40010.1|  hypothetical protein JCGZ_02008                         223   5e-64   Jatropha curcas
ref|XP_004486293.1|  PREDICTED: uncharacterized protein LOC101494304    210   6e-64   
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    223   7e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    223   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    223   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    222   2e-63   
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    221   3e-63   
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   4e-63   Cucumis melo [Oriental melon]
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    221   5e-63   
dbj|BAH19562.1|  AT5G18590                                              221   6e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                       220   7e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                             220   7e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873905.1|  kelch repeat-containing protein                    219   2e-62   
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    218   4e-62   Solanum tuberosum [potatoes]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    218   4e-62   Cucumis sativus [cucumbers]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    216   1e-61   Solanum lycopersicum
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                216   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    213   1e-60   
gb|KJB72597.1|  hypothetical protein B456_011G187500                    213   1e-60   Gossypium raimondii
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 214   2e-60   Ricinus communis
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             213   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    213   4e-60   Elaeis guineensis
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    213   4e-60   Elaeis guineensis
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    213   4e-60   
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    213   5e-60   Elaeis guineensis
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    211   6e-60   Cicer arietinum [garbanzo]
emb|CDY13903.1|  BnaC09g39230D                                          211   8e-60   Brassica napus [oilseed rape]
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             211   2e-59   Phaseolus vulgaris [French bean]
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    211   3e-59   Cicer arietinum [garbanzo]
gb|AES91803.2|  acyl-CoA-binding domain protein                         209   7e-59   Medicago truncatula
gb|KEH32273.1|  acyl-CoA-binding domain protein                         209   7e-59   Medicago truncatula
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         209   9e-59   
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             208   1e-58   
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    208   2e-58   Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                          207   3e-58   
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   4e-58   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   6e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN47303.1|  hypothetical protein glysoja_020171                     196   1e-57   Glycine soja [wild soybean]
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    204   4e-57   
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    204   6e-57   
gb|AES64218.2|  acyl-CoA-binding domain protein                         203   1e-56   Medicago truncatula
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    203   2e-56   Glycine max [soybeans]
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         203   2e-56   
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            202   3e-56   Glycine soja [wild soybean]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             201   1e-55   Phaseolus vulgaris [French bean]
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    201   1e-55   
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    197   3e-54   Glycine max [soybeans]
gb|EPS74438.1|  hypothetical protein M569_00314                         191   1e-53   Genlisea aurea
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   2e-53   Glycine max [soybeans]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            191   2e-52   Glycine soja [wild soybean]
gb|AES91804.2|  acyl-CoA-binding domain protein                         187   6e-51   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         187   7e-51   
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   6e-50   Cicer arietinum [garbanzo]
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   7e-50   Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   9e-50   
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   9e-50   
ref|XP_006855461.1|  hypothetical protein AMTR_s00057p00182130          180   2e-48   
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   2e-46   Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   2e-46   Populus euphratica
ref|NP_001068393.1|  Os11g0657000                                       166   1e-43   
gb|EEC68565.1|  hypothetical protein OsI_36893                          166   2e-43   Oryza sativa Indica Group [Indian rice]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          165   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    164   9e-43   Oryza brachyantha
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    164   1e-42   
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    162   3e-42   Setaria italica
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    161   8e-42   
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    159   7e-41   
ref|XP_010098333.1|  hypothetical protein L484_023581                   159   7e-41   
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    159   8e-41   Brachypodium distachyon [annual false brome]
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    157   2e-40   Zea mays [maize]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    155   9e-40   Brachypodium distachyon [annual false brome]
gb|KDO75103.1|  hypothetical protein CISIN_1g0050432mg                  149   8e-39   Citrus sinensis [apfelsine]
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    150   9e-38   Oryza brachyantha
dbj|BAJ86800.1|  predicted protein                                      150   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00700.1|  predicted protein                                      150   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180          146   1e-36   
gb|EEC69433.1|  hypothetical protein OsI_38606                          146   3e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001066944.1|  Os12g0538800                                       146   3e-36   
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    145   7e-36   
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    145   8e-36   
dbj|BAK00043.1|  predicted protein                                      139   9e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001145999.1|  uncharacterized protein LOC100279529               145   1e-35   
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   1e-35   
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   1e-35   Setaria italica
ref|NP_001146281.1|  uncharacterized protein LOC100279856               144   1e-35   Zea mays [maize]
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    139   1e-33   
gb|EMT26901.1|  hypothetical protein F775_29769                         134   3e-32   
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    128   1e-29   
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315             125   4e-29   Selaginella moellendorffii
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505             125   5e-29   Selaginella moellendorffii
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            120   1e-26   Triticum urartu
gb|EMT25879.1|  hypothetical protein F775_10881                         115   2e-25   
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            114   7e-25   Triticum urartu
ref|XP_001759823.1|  predicted protein                                  114   1e-24   
ref|XP_001760924.1|  predicted protein                                  107   8e-23   
ref|XP_001751751.1|  predicted protein                                97.4    5e-19   
ref|XP_001761501.1|  predicted protein                                84.0    8e-16   
gb|ABA95166.1|  Kelch motif family protein, expressed                 87.0    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        83.2    2e-14   
emb|CDY02611.1|  BnaC02g08240D                                        72.0    6e-13   
gb|ABR25493.1|  rangap1 interacting protein                           69.3    4e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_001765510.1|  predicted protein                                66.6    2e-09   
gb|EEE53353.1|  hypothetical protein OsJ_36377                        66.2    4e-09   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009759318.1| PREDICTED: tip elongation aberrant protein 3-like [Nicotiana 
sylvestris]
Length=634

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 200/234 (85%), Gaps = 4/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNF  608
            K+PK+S DES SQ  E+G +QLD G++   S  K + EE+ TI ESG++  H +Q SGNF
Sbjct  403  KIPKTSGDESPSQ--EQGAKQLDVGIKTSSSGGKIVTEEMSTITESGHLPNHYRQASGNF  460

Query  607  PLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksl  428
              D+DDFVFQESD K G++A  G  Q YEAKL+AL+RKN +LEGQLAAALA+REAA+K+L
Sbjct  461  FQDTDDFVFQESDYKAGLTASSGACQQYEAKLSALMRKNEILEGQLAAALANREAAEKNL  520

Query  427  ssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLK  248
            SSALKSKQD EK++ D +KE++LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLK
Sbjct  521  SSALKSKQDMEKRMGDTVKEVELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLK  580

Query  247  AVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            AVLDDTQKELH+TRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  581  AVLDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  634



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 199/234 (85%), Gaps = 4/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNF  608
            K PK+S DES SQ  E+G +QLD G++   S  K + EE+ TI ESG++  H +Q SGNF
Sbjct  476  KRPKTSGDESPSQ--EQGAKQLDIGIKTSSSGGKIVTEEMSTITESGHLPNHYRQASGNF  533

Query  607  PLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksl  428
              D+DDFVFQESD K G++A  G  Q YEAKL+AL+RKN +LEGQLAAALA+REAA+K+L
Sbjct  534  FQDTDDFVFQESDYKAGLTASSGACQQYEAKLSALMRKNEILEGQLAAALANREAAEKNL  593

Query  427  ssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLK  248
            SSALKSKQD EK++ D +KE++LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLK
Sbjct  594  SSALKSKQDVEKRMGDTVKEVELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLK  653

Query  247  AVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            AVLDDTQKELH+TRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  654  AVLDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  707



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 177/235 (75%), Gaps = 12/235 (5%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDS---KTIPEEICTIPESGNMATHKKQGSGN  611
            KM K+S DES SQ  E+G +QLD G     S   K + EE+ TI ESG++ TH +Q S N
Sbjct  476  KMTKTSGDESPSQ--EQGAKQLDIGGPKTSSNGGKIMSEEMSTISESGHLPTHYRQASAN  533

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            F  D+DDFVFQE D K G+ A  G  Q YEAKL++L+RKN                A   
Sbjct  534  FFQDTDDFVFQEGDYKAGLPASSGACQQYEAKLSSLMRKN-------GILEGQLATALAG  586

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
              +A+KSKQD EKK+ADA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFL
Sbjct  587  REAAVKSKQDMEKKMADAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFL  646

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAV+DDTQKELH+TRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  647  KAVMDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  701



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 179/234 (76%), Gaps = 11/234 (5%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNF  608
            KM K+S DES SQ  E+G +QLD GL+   +  K + EE+ TI ESG++ TH +Q S NF
Sbjct  476  KMTKTSGDESPSQ--EQGAKQLDIGLKTCSNGGKIMSEEMSTISESGHLPTHYRQASANF  533

Query  607  PLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksl  428
              D+DDFV QE D K G+ A  G  Q +EAKL++L+RKN               AA    
Sbjct  534  FQDTDDFVSQEGDYKAGLPASSGACQQHEAKLSSLMRKN-------GILEGQLAAALAGR  586

Query  427  ssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLK  248
             +A++SKQD EKK++DA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLK
Sbjct  587  EAAVRSKQDMEKKMSDAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLK  646

Query  247  AVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            AV+DDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  647  AVMDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  700



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 192/230 (83%), Gaps = 2/230 (1%)
 Frame = -1

Query  772  KSSDDESSSQVMERGTRQLDSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDS  596
            KSS+D + S++ME+ T+ LDSG+        I EE   + ES N+    K GSG+  L+S
Sbjct  484  KSSEDTNLSRMMEQNTKPLDSGIGVSYSGDRITEETSLVSESDNL-NLDKHGSGSLSLES  542

Query  595  DDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssal  416
            +D VFQE+D K  ISAP G+YQ YEAKL +LLRKNG+LEGQLAAALA+REAA+K+LS A+
Sbjct  543  EDLVFQETDGKSRISAPSGVYQIYEAKLASLLRKNGILEGQLAAALAAREAAEKNLSLAI  602

Query  415  ksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLD  236
            KS+QD E+KL +AM+EI+LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLD
Sbjct  603  KSRQDMERKLGEAMREIELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLD  662

Query  235  DTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            DTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQ+LE RAPTPRKPFHV
Sbjct  663  DTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQTLETRAPTPRKPFHV  712



>gb|KDO75101.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
 gb|KDO75102.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=365

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 184/236 (78%), Gaps = 7/236 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSG  614
            KM K+S+DE+S  Q  E    Q D G +    +    I E      E+ N      QG G
Sbjct  133  KMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIG  189

Query  613  NFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
            NF +D+D+ +F ++D    +S P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +REAA+K
Sbjct  190  NFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEK  249

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            + SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAF
Sbjct  250  NFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAF  309

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  310  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  365



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 181/200 (91%), Gaps = 3/200 (2%)
 Frame = -1

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQ---SYEAKLTA  506
            +EI +  ESGN+ TH++QGSG+  LDSDD +FQESD K G+S P  ++Q   SYE KL A
Sbjct  511  KEISSASESGNLETHRRQGSGSLSLDSDDLLFQESDGKAGVSVPSNVHQFHQSYELKLGA  570

Query  505  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  326
            L+RKNG+LEGQLAAA++SRE+A+K+LS+A+KS+Q+ EKKLADAMKE++LLKEKLAGVELA
Sbjct  571  LIRKNGILEGQLAAAISSRESAEKNLSTAVKSRQEMEKKLADAMKEMELLKEKLAGVELA  630

Query  325  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  146
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  631  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  690

Query  145  KQRLQSLENRAPTPRKPFHV  86
            KQRLQSLENRAPTPRKPFHV
Sbjct  691  KQRLQSLENRAPTPRKPFHV  710



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   244 bits (624),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 191/234 (82%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
            K+ KSS+DESS SQ  E+   Q DSG++   + S+   EE+ +  E  N + H   G GN
Sbjct  482  KVVKSSEDESSFSQPTEKKNSQSDSGVQTNVLGSRLYSEEMLSGYEYEN-SNHHNHGIGN  540

Query  610  FPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
              +D++D +F E+D K G +SAP  +Y  YE+K+ +L+RKNG+LEGQLAAAL SREAA+K
Sbjct  541  LSVDNNDAMFLETDSKPGALSAPSSIYHYYESKMASLIRKNGILEGQLAAALTSREAAEK  600

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSSALKS+Q+ E+KLAD  KE++LLKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAF
Sbjct  601  NLSSALKSRQEMERKLADTAKEMELLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAF  660

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  661  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  714



>ref|XP_007222490.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
 gb|EMJ23689.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
Length=528

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 188/234 (80%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
            K+ KSS+DESS SQ  E+   + DSG++   + ++   EE+ +  E  N + H   G GN
Sbjct  296  KVVKSSEDESSFSQPTEKKNSRSDSGVQTNVLGNRLYSEEMLSGYEYEN-SNHHNHGIGN  354

Query  610  FPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
              +D++D +F E+D K G +SAP  +Y  YE+K+   +RKNG+LEGQLAAAL SREAA+K
Sbjct  355  LSVDNNDAMFLETDSKPGALSAPSSIYHYYESKMATQIRKNGILEGQLAAALTSREAAEK  414

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSSALKS+Q+ E+KLAD  KE++LLKEK AGVE+AQEEAN+LSNIVHSDNVRLEHDVAF
Sbjct  415  NLSSALKSRQEMERKLADTAKEMELLKEKAAGVEIAQEEANNLSNIVHSDNVRLEHDVAF  474

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  475  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  528



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 188/234 (80%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
            K+ KS++DESS SQ +E+ T Q DSG++      +   EEI +  +  N   H   G+GN
Sbjct  479  KVAKSTEDESSFSQPIEKKTSQSDSGVQTNIYGGRLFSEEILSGYDFENSNPHH-HGTGN  537

Query  610  FPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
              +D++D VF E+D K G +S    +Y  YE+K+ AL+RKNG+LEG+LA  +AS+EAA+K
Sbjct  538  LSMDNNDAVFPENDSKLGALSTASSMYHYYESKMAALIRKNGILEGKLATVMASQEAAEK  597

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSSALKS+Q+ E+KL+D+ KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAF
Sbjct  598  NLSSALKSRQEMERKLSDSAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAF  657

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  658  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 188/234 (80%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
            K+ KS++DESS SQ +E+ T Q DSG++      +   EEI +  +  N   H   G+GN
Sbjct  479  KVAKSTEDESSFSQPIEKKTSQSDSGVQTNIYGGRLFSEEILSGYDFENSNPHH-HGTGN  537

Query  610  FPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
              +D++D VF E+D K G +S    +Y  YE+K+ AL+RKNG+LEG+LA  +A++EAA+K
Sbjct  538  LSMDNNDAVFPENDSKLGALSTASSMYHYYESKMAALIRKNGILEGKLATVMANQEAAEK  597

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSSALKS+Q+ E+KL+D+ KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAF
Sbjct  598  NLSSALKSRQEMERKLSDSAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAF  657

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  658  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 185/236 (78%), Gaps = 5/236 (2%)
 Frame = -1

Query  781  KMPKSSDDES-SSQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
            K  +S +DE  SSQ  E   +  D+G+       K   +EI ++ +S N   +  QG+GN
Sbjct  483  KTLRSLEDECYSSQASEHRMKLFDTGIHGSLAGCKINVDEIPSVLDSENSNAYN-QGNGN  541

Query  610  FPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
              +D+DD VF ES  K    SAP  +YQ YE K+ AL+RKNG+LEGQL AALASREA +K
Sbjct  542  LLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALIRKNGILEGQLTAALASREAVEK  601

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQEEAN+LSN+VHSDNVRLEHDVAF
Sbjct  602  NLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQEEANNLSNMVHSDNVRLEHDVAF  661

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  662  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  717



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 185/234 (79%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
            K+ KSS+DESS SQ +E+ T Q DSG++      +   EEI +  +  N   H   G+GN
Sbjct  483  KVAKSSEDESSFSQPIEKKTSQSDSGVQTNIYGGRLFSEEILSGYDFENSNPHX-HGTGN  541

Query  610  FPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
               D++D VF E+D K G +S    +Y  YE+K+  L+RKNG+LEG+LA  +AS+EAA+K
Sbjct  542  LSXDNNDAVFPENDSKLGALSTASSMYHYYESKMAXLIRKNGILEGKLATVMASQEAAEK  601

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSSALKS+Q+ E+KL+D  KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAF
Sbjct  602  NLSSALKSRQEMERKLSDTAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAF  661

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  662  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  715



>emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera]
Length=1034

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 184/236 (78%), Gaps = 5/236 (2%)
 Frame = -1

Query  781   KMPKSSDDES-SSQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGN  611
             K  +S +DE  SSQ  E   +  D+G+       K   + I ++ +S N   +  QG+GN
Sbjct  800   KTLRSLEDECYSSQASEHRMKLFDTGIHGSLAGCKINVDXIPSVLDSENSNAYN-QGNGN  858

Query  610   FPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
               +D+DD VF ES  K    SAP  +YQ YE K+ AL+RKNG+LEGQL AALASREA +K
Sbjct  859   LLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALIRKNGILEGQLTAALASREAVEK  918

Query  433   slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
             +LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAF
Sbjct  919   NLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAF  978

Query  253   LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
             LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  979   LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  1034



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 182/236 (77%), Gaps = 7/236 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSG  614
            KM K+S+DE+S  Q  E    Q D G +    +    I E      E+ N      QG G
Sbjct  485  KMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIG  541

Query  613  NFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
            NF +D+D+ +F ++D    +S P  +YQ YE K+  L+RKNG+LEGQLAAAL +REAA+K
Sbjct  542  NFHVDNDNVIFPDNDKSGALSGPSSIYQFYETKMADLIRKNGILEGQLAAALVNREAAEK  601

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            + SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAF
Sbjct  602  NFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAF  661

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  662  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 182/236 (77%), Gaps = 7/236 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSG  614
            KM K+S+DE+S  Q  E    Q D G +    +    I E      E+ N      QG G
Sbjct  485  KMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIG  541

Query  613  NFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
            NF +D+D+ +F ++D    +S P  +YQ YE K+  L+RKNG+LEGQLAAAL +REAA+K
Sbjct  542  NFHVDNDNVIFPDNDKSGALSGPSSIYQFYETKMADLIRKNGILEGQLAAALVNREAAEK  601

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            + SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAF
Sbjct  602  NFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAF  661

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  662  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  625  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  449
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  536  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  595

Query  448  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  269
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  596  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  655

Query  268  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  89
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+
Sbjct  656  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFN  715

Query  88   V  86
            V
Sbjct  716  V  716



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 185/236 (78%), Gaps = 12/236 (5%)
 Frame = -1

Query  781  KMPKSSDDESSS----QVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSG  614
            K+ K+ +DE+SS    +V++ G +   +GL      +  EE   + +S N    +KQ + 
Sbjct  480  KILKNIEDENSSSQRTKVLDMGVQTDIAGL-----MSSAEETPFVFDSENTRPLQKQANV  534

Query  613  NFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
            N   +SD+    E+D   G SAP  +YQ Y++K+ AL+RKNG+LE QLAA+LA REAA+K
Sbjct  535  NLLSESDEIAIPETD---GKSAPSNVYQLYDSKIAALVRKNGILEAQLAASLAGREAAEK  591

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSS +KS+QD EKKLAD MKE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF
Sbjct  592  NLSSVIKSRQDIEKKLADTMKEMEMLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  651

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  652  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSVENRAPTPRKPFHM  707



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 182/235 (77%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNF  608
            ++ K+SDD SS  Q  E  T Q ++G+      T I  E  T  E  N      +G  N 
Sbjct  450  RITKNSDDSSSILQATEEKTNQSETGVRISAPGTKISSEFGT--ECLNPLV---EGIAND  504

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++
Sbjct  505  PIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERT  564

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  565  LASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFL  624

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  625  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  679



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 182/235 (77%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNF  608
            ++ K+SDD SS  Q  E  T Q ++G+      T I  E  T  E  N      +G  N 
Sbjct  436  RITKNSDDSSSILQATEEKTNQSETGVRISAPGTKISSEFGT--ECLNPLV---EGIAND  490

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++
Sbjct  491  PIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERT  550

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  551  LASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFL  610

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  611  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  665



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 182/235 (77%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNF  608
            ++ K+SDD SS  Q  E  T Q ++G+      T I  E  T  E  N      +G  N 
Sbjct  477  RITKNSDDSSSILQATEEKTNQSETGVRISAPGTKISSEFGT--ECLNPLV---EGIAND  531

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++
Sbjct  532  PIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERT  591

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  592  LASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFL  651

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  652  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 182/235 (77%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNF  608
            ++ K+SDD SS  Q  E  T Q ++G+      T I  E  T  E  N      +G  N 
Sbjct  480  RITKNSDDSSSILQATEEKTNQSETGVRISAPGTKISSEFGT--ECLNPLV---EGIAND  534

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++
Sbjct  535  PIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERT  594

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  595  LASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFL  654

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  655  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  709



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 174/222 (78%), Gaps = 0/222 (0%)
 Frame = -1

Query  751  SSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  572
            SSQ ME+ +++ ++ ++   +  +      + +S N   ++KQG+ N   DS+     E 
Sbjct  508  SSQAMEQRSKKHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEI  567

Query  571  DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEK  392
            D +  ++ P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEK
Sbjct  568  DNRSVLTNPSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEK  627

Query  391  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  212
            KLADA+KE++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHS
Sbjct  628  KLADAIKEVELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHS  687

Query  211  TRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            TRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  688  TRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  729



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 176/227 (78%), Gaps = 3/227 (1%)
 Frame = -1

Query  763  DDESSSQVMERGTRQLDSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDF  587
            +D SSS   E  +   D  ++ +     I  E+ +I E     +H  QG GN  +D++D 
Sbjct  391  NDNSSSPAAEHQSNHSDISIQPNNQVGKINAEMTSIFEMETPNSHN-QGIGNVSVDNEDV  449

Query  586  VFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksK  407
            V  +SDC  G  A   +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+
Sbjct  450  VSLDSDCTTG-GARASIYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSR  508

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q+ EKKL D+++E+DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ
Sbjct  509  QEMEKKLVDSVREMDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  568

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR  TPRKPFHV
Sbjct  569  KELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRTSTPRKPFHV  615



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 182/235 (77%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNF  608
            ++ K+SDD SS  Q  E    Q ++G+      T I  E  T  E  N      +G  N 
Sbjct  480  RITKNSDDSSSILQATEEKMNQSETGVRISAPGTKISSEFGT--ECLNPLV---EGIAND  534

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA ALASR+ A+++
Sbjct  535  PVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATALASRDTAERT  594

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA EEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  595  LAAALKSKEEMEKKFADAMKEMELLKEKLTGIELAHEEANNLSNIVHSDNVRLEHDVAFL  654

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  655  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  709



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 182/235 (77%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNF  608
            ++ K+SDD SS  Q  E    Q ++G+      T I  E  T  E  N      +G  N 
Sbjct  504  RITKNSDDSSSILQATEEKMNQSETGVRISAPGTKISSEFGT--ECLNPLV---EGIAND  558

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA ALASR+ A+++
Sbjct  559  PVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATALASRDTAERT  618

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA EEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  619  LAAALKSKEEMEKKFADAMKEMELLKEKLTGIELAHEEANNLSNIVHSDNVRLEHDVAFL  678

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  679  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  733



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 184/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT---IPEEICTIPESGNMATHKKQGSG  614
            ++ KSS+D SS  Q  E+ T Q D+G+E     T     E      E+ N +  + +G  
Sbjct  398  RITKSSEDLSSILQATEQKTNQTDTGVEVNAPGTKIRSDESFLYECENSNPSNPRVEGIT  457

Query  613  NFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaad  437
            + P+ +D+FVF E + K G +SAP  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +
Sbjct  458  SIPVGNDNFVFPEMEGKAGALSAPSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIE  515

Query  436  kslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVA  257
            ++L+SALKSK++ EK+LAD +KE+DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVA
Sbjct  516  RNLASALKSKEEMEKRLADTVKEMDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVA  575

Query  256  FLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            F+KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  576  FVKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  632



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  655  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  476
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  517  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  576

Query  475  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  296
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  577  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  636

Query  295  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  116
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  637  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  696

Query  115  APTPRKPFHV  86
            APTPRKPFH+
Sbjct  697  APTPRKPFHM  706



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 176/227 (78%), Gaps = 3/227 (1%)
 Frame = -1

Query  763  DDESSSQVMERGTRQLDSGLEHIDS-KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDF  587
            +D SSS   E  +   D  ++  +    I  E+ +I E     +H  QG GN  +D++D 
Sbjct  496  NDNSSSPAAEHQSNHSDISIQPNNQVGKINAEMTSIFEMETPNSHN-QGIGNVSVDNEDV  554

Query  586  VFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksK  407
            V  +SDC  G  A   +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+
Sbjct  555  VSLDSDCTTG-GARASIYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSR  613

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q+ EKKL D+++E+DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ
Sbjct  614  QEMEKKLVDSVREMDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  673

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR  TPRKPFHV
Sbjct  674  KELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRTSTPRKPFHV  720



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  655  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  476
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  543  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  602

Query  475  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  296
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  603  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  662

Query  295  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  116
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  663  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  722

Query  115  APTPRKPFHV  86
            APTPRKPFH+
Sbjct  723  APTPRKPFHM  732



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 177/225 (79%), Gaps = 6/225 (3%)
 Frame = -1

Query  751  SSQVMERGTRQLDSGLEHIDSKTI---PEEICTIPESGNMATHKKQGSGNFPLDSDDFVF  581
            SSQ ME+ +++ ++ ++ +D   I    EE     ES N+  ++KQG+ N   DS+    
Sbjct  507  SSQAMEQRSKKQETAIQ-MDIAGILASTEENLFDSESSNL--YQKQGNNNLMSDSNHIAP  563

Query  580  QESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQD  401
             E++ +  ++ P  +YQ YE K+  L RKN LLE QL  A+AS+EA +K+LSSA+KS+QD
Sbjct  564  PETENRSMLTNPSNIYQLYETKIVTLTRKNVLLEEQLNVAMASQEATEKNLSSAIKSRQD  623

Query  400  TEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKE  221
             EKK+ADAMKE++LLKEKLA VELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKE
Sbjct  624  MEKKIADAMKEVELLKEKLASVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKE  683

Query  220  LHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  684  LHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  728



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   228 bits (581),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 184/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT---IPEEICTIPESGNMATHKKQGSG  614
            ++ KSS+D SS  Q  E+ T Q D+G+E     T     E      E+ N +  + +G  
Sbjct  472  RITKSSEDLSSILQATEQKTNQTDTGVEVNAPGTKIRSDESFLYECENSNPSNPRVEGIT  531

Query  613  NFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaad  437
            + P+ +D+FVF E + K G +SAP  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +
Sbjct  532  SIPVGNDNFVFPEMEGKAGALSAPSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIE  589

Query  436  kslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVA  257
            ++L+SALKSK++ EK+LAD +KE+DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVA
Sbjct  590  RNLASALKSKEEMEKRLADTVKEMDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVA  649

Query  256  FLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            F+KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  650  FVKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQR
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQR  702

Query  136  LQSLENRAPTPRKPFHV  86
            LQS+ENR PTPRKPFHV
Sbjct  703  LQSMENRTPTPRKPFHV  719



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  137
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQR
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQR  702

Query  136  LQSLENRAPTPRKPFHV  86
            LQS+ENR PTPRKPFHV
Sbjct  703  LQSMENRTPTPRKPFHV  719



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 183/235 (78%), Gaps = 8/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS---QVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGN  611
            KM K+ +DESSS    VM++  + LD G++  D   I  E   + +SGN +  +KQ S N
Sbjct  481  KMLKNLEDESSSSQFHVMKQRAKALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASAN  538

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
               ++D+ V  E+  K   S P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+
Sbjct  539  LLSENDEIVIMETGDK---SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKN  595

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            LSS +KS+QD EKKLAD +KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL
Sbjct  596  LSSVIKSRQDMEKKLADTIKEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  655

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KA+LDDTQKELHSTRG+L GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  656  KAILDDTQKELHSTRGVLAGERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  710



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 187/234 (80%), Gaps = 10/234 (4%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLEHI--DSKTIPEEICTIPESGNMATHKKQGSGN  611
            K+ K S+DESS  Q  E+   Q +S ++      +   E+I +  E  N  ++   G GN
Sbjct  482  KVTKGSEDESSLLQPSEKKNSQSESAVQTNIHGGRLYSEDILSAYEFEN--SNHNHGLGN  539

Query  610  FPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
            FP+D++D +F ESD K G +SAP  +YQ YE     L+RKNG+LEGQLAAALASREAA+K
Sbjct  540  FPVDNNDALFPESDGKPGALSAPSSMYQYYEK----LIRKNGVLEGQLAAALASREAAEK  595

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            +LSSALKS+Q+ EKKLAD+ KEI+LLK+KLAGVELAQEEAN+LS+IVHSDNVRLEHDVAF
Sbjct  596  NLSSALKSRQEIEKKLADSGKEIELLKDKLAGVELAQEEANNLSSIVHSDNVRLEHDVAF  655

Query  253  LKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            LKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  656  LKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  709



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 186/235 (79%), Gaps = 6/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSS-QVMERGTRQLDSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNF  608
            ++ KSS+D SS  Q  E+ T Q D+G+E +     I  +   + E  N +  + +G  + 
Sbjct  472  RITKSSEDLSSILQATEQKTNQTDTGVEVNAPGTKIRSDESFLYECEN-SNPRVEGITSV  530

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+ +D+FVF E + K G +SAP  +Y  YE ++ AL RKNG+LE QL AA+ASR++ +++
Sbjct  531  PVGNDNFVFPEVEGKAGALSAPSSIY--YEMRMAALSRKNGILEVQLGAAMASRDSIERN  588

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SALKSK++ EK+LAD +KE+DL+KEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAFL
Sbjct  589  LASALKSKEEMEKRLADTVKEMDLVKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFL  648

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  649  KAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  703



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 177/231 (77%), Gaps = 13/231 (6%)
 Frame = -1

Query  778  MPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLD  599
            +P+++DD +   +   G      G   I S+  P        S N+   +KQ    FP++
Sbjct  481  LPRTADDRT--HINNSG------GANKITSEKTPSMSSDREFSSNL---QKQCPETFPME  529

Query  598  SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssa  419
            + D +F E+D     S+ +  YQ +EAK+ AL+R+NG+LEGQL AALA REAA+++LS A
Sbjct  530  NADGIFLETDTSLASSSSV--YQFHEAKMAALIRRNGILEGQLTAALAGREAAERNLSVA  587

Query  418  lksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVL  239
            +++KQ+TEKKLADAM+E++L+KEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVL
Sbjct  588  MRTKQETEKKLADAMREVELMKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVL  647

Query  238  DDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            DDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  648  DDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  698



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  524
            +K   E+  ++  + +++  +KQGS  FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  502  AKITAEKTLSMVSNHDISNLQKQGSETFPLETVDGALIFQEMDNISFAGSMSSSSVYQFH  561

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = -1

Query  682  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  503
            I  E+ +I E     +H  QG GN  +D++D V  ESDC  G  A   +YQ YE K+ AL
Sbjct  510  INAEMSSIFEMETPNSHN-QGIGNVSVDNEDVVSPESDCTTG-GARASIYQLYETKIAAL  567

Query  502  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  323
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E++LLKEKLAGVELAQ
Sbjct  568  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMELLKEKLAGVELAQ  627

Query  322  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  143
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  628  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  687

Query  142  QRLQSLENRAPTPRKPFHV  86
            QRLQS+ENR  TPRKPF V
Sbjct  688  QRLQSMENRTSTPRKPFRV  706



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 181/232 (78%), Gaps = 7/232 (3%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPL  602
            KM K+ +DESSS   ++  + LD G++  D   I  E   + +SGN +  +KQ S N   
Sbjct  481  KMLKNLEDESSSS--QQRAKALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLS  536

Query  601  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  422
            ++D+ V  E+  K   S P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS
Sbjct  537  ENDEIVIMETGDK---SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSS  593

Query  421  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  242
             +KS+QD EKKLAD +KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+
Sbjct  594  VIKSRQDMEKKLADTIKEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAI  653

Query  241  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LDDTQKELHSTRG+L GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  654  LDDTQKELHSTRGVLAGERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  705



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 2/201 (1%)
 Frame = -1

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  509
            K I EE     ES N+ + +    GN P+D+DD +  E+D   G  A   +YQ YE K+ 
Sbjct  511  KIIAEEASCGFESENLNS-QNPAIGNHPVDNDDVLVPETDGMAG-GAHSSIYQLYETKIA  568

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            AL+RKNG+LEGQLAAAL+SR++A+K+LSS LKSKQ+ EKKL DA++E++LLKE+LA VEL
Sbjct  569  ALIRKNGVLEGQLAAALSSRDSAEKNLSSVLKSKQELEKKLTDALREMELLKERLASVEL  628

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  629  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFH  688

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENR PTPRKPF+V
Sbjct  689  LKQRLQSMENRVPTPRKPFNV  709



>ref|XP_004486293.1| PREDICTED: uncharacterized protein LOC101494304 [Cicer arietinum]
Length=201

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  646  NMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqla  467
            +++  K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL 
Sbjct  15   DISLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLL  74

Query  466  aalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHS  287
            AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHS
Sbjct  75   AAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHS  134

Query  286  DNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPT  107
            DNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPT
Sbjct  135  DNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPT  194

Query  106  PRKPFHV  86
            PRKPFHV
Sbjct  195  PRKPFHV  201



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 180/232 (78%), Gaps = 8/232 (3%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPL  602
            KM K+ +DESSS    +  + LD G++  D   I  E   + +SGN +  +KQ S N   
Sbjct  481  KMLKNLEDESSSS---QRAKALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLS  535

Query  601  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  422
            ++D+ V  E+  K   S P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS
Sbjct  536  ENDEIVIMETGDK---SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSS  592

Query  421  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  242
             +KS+QD EKKLAD +KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+
Sbjct  593  VIKSRQDMEKKLADTIKEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAI  652

Query  241  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            LDDTQKELHSTRG+L GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  653  LDDTQKELHSTRGVLAGERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  704



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  524
            +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  502  AKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFH  561

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  524
            +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  486  AKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFH  545

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  546  EAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  605

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  606  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  665

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  666  VEVFHLKQRLQSLENRAATPRKPFHV  691



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 186/233 (80%), Gaps = 12/233 (5%)
 Frame = -1

Query  772  KSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSD  593
            KSS++E S   + R T + + G +  + KT+     ++  + +++   KQ S  FPL++ 
Sbjct  483  KSSEEEVS---VPRTTEENNGGAKITEEKTL-----SMVSNHDISNLHKQCSETFPLENV  534

Query  592  D--FVFQESD-CKFGIS-APIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            D   +FQE D  KFG S +   +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S
Sbjct  535  DGALIFQEMDNIKFGGSMSSSSVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVS  594

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
             AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKA
Sbjct  595  VALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKA  654

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRA T RKPFHV
Sbjct  655  VLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATHRKPFHV  707



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 181/235 (77%), Gaps = 7/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTI---PEEICTIPESGNMATHKKQGSGN  611
            +M KS +D+   + ME+ +++L++ +E +D   I    EE     ES N+   +K G+ +
Sbjct  485  RMLKSPEDDKH-KAMEQRSKKLETAVE-MDIAGILASTEENLFDSESSNLC--QKLGNND  540

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
               DS+     E+D   G+ A   +YQ YE K+  L RKN LLE QL AALA++EAA+K+
Sbjct  541  LMADSNHIAPPETDGISGLLANPYIYQLYETKIVTLTRKNVLLEEQLTAALANQEAAEKN  600

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            LSSALKS+QD EKKLADAMKE++LLKEKLAG+ELAQEEAN+LSN+ HSDNVRLEHDVAFL
Sbjct  601  LSSALKSRQDMEKKLADAMKEVELLKEKLAGMELAQEEANNLSNMSHSDNVRLEHDVAFL  660

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH+
Sbjct  661  KAVLDDTQKELHSTRGVLAGERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHI  715



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 178/227 (78%), Gaps = 10/227 (4%)
 Frame = -1

Query  763  DDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFV  584
            DD S+SQV E    Q  SG E    +T+P       ES N     K+G G  P+D+ D +
Sbjct  460  DDSSTSQVTENKLTQ--SGGE-FHGETLPS--VYEYESSNPF---KEGVGYHPIDNTD-L  510

Query  583  FQESDCKFGISAPIG-LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksK  407
            F E+  K   S+    +YQ YEAK+ AL+RKNG+LEGQLAAA ASREA +K+LSSALK +
Sbjct  511  FSENSGKIVTSSTFSSIYQFYEAKMAALIRKNGVLEGQLAAATASREAVEKNLSSALKIR  570

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q+ EK++AD +KE+++L++KLAGVE+A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ
Sbjct  571  QEMEKRIADMIKEMEMLRDKLAGVEIAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  630

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KELHSTRG+L GER+RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  631  KELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  677



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 170/212 (80%), Gaps = 6/212 (3%)
 Frame = -1

Query  712  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP---I  542
            S L+  + K+I EE     E  N++  +  G+ + P+++DD  + E++CK G  AP    
Sbjct  488  SSLQATECKSIGEETALAFEDENLSP-RINGNDSLPVNNDDLAYAETNCKVG--APPSTS  544

Query  541  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  362
             + Q Y+ K+ +L+RKNG+LEGQLAAALA++EA +KS SS LKSKQ+ +KKLAD MKE++
Sbjct  545  SICQLYKTKIDSLIRKNGILEGQLAAALANQEATEKSFSSILKSKQEVDKKLADTMKEME  604

Query  361  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  182
            +LKEKLA +E+ QEEANSL+NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  605  VLKEKLADLEVTQEEANSLNNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  664

Query  181  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            R FQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  665  RTFQLQVEVFHLKQRLQSIENRAPTPRKPFHV  696



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  524
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  524
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  524
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  163  VEVFHLKQRLQSLENRAPTPRKPFHV  86
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = -1

Query  631  KKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLRKNgllegqlaa  464
            +KQ S  FPL++ D   + QE D   F G ++   +YQ +EAK+TAL+R+NG+LEGQL A
Sbjct  524  QKQCSETFPLENVDGTLIIQEMDNINFAGSASSSSVYQFHEAKMTALIRRNGILEGQLEA  583

Query  463  alasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSD  284
            ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEEANSLSN+VHSD
Sbjct  584  ALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEEANSLSNMVHSD  643

Query  283  NVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  104
            NVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRA TP
Sbjct  644  NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATP  703

Query  103  RKPFHV  86
            RKPFHV
Sbjct  704  RKPFHV  709



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 159/232 (69%), Gaps = 45/232 (19%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPL  602
            KM K+S DES SQ  E+G +QLD G     S                             
Sbjct  476  KMTKTSGDESPSQ--EQGAKQLDIGGPKTSS-----------------------------  504

Query  601  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  422
                      D K G+ A  G  Q YEAKL++L+RKNG+LEGQLA ALA REAA KS   
Sbjct  505  -------NGGDYKAGLPASSGACQQYEAKLSSLMRKNGILEGQLATALAGREAAVKSK--  555

Query  421  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  242
                 QD EKK+ADA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV
Sbjct  556  -----QDMEKKMADAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAV  610

Query  241  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            +DDTQKELH+TRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  611  MDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  662



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 179/228 (79%), Gaps = 11/228 (5%)
 Frame = -1

Query  763  DDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSG-NFPLDSDDF  587
            DD S+SQV E    Q  SG E    +T+P       ES N     K+G G + P+D+ D 
Sbjct  460  DDSSTSQVTENKLTQ--SGGE-FHGETLPS--VYEYESSNPF---KEGVGYHHPIDNTD-  510

Query  586  VFQESDCKFGISAPIG-LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalks  410
            +F ES  K   S+    +YQ YEAK+ AL+RKNG+LEGQLAAA ASREA +K+LSSALK 
Sbjct  511  LFSESSGKIVTSSTFSSIYQFYEAKMAALIRKNGVLEGQLAAATASREAVEKNLSSALKI  570

Query  409  KQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDT  230
            +Q+ EK++AD +KE+++L++KLAGVE+A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDT
Sbjct  571  RQEMEKRIADMIKEMEMLRDKLAGVEIAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDT  630

Query  229  QKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            QKELHSTRG+L GER+RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  631  QKELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  678



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 163/232 (70%), Gaps = 46/232 (20%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPL  602
            KM K+S DES SQ  E+G +QLD GL+           C+                    
Sbjct  476  KMTKTSGDESPSQ--EQGAKQLDIGLK----------TCS--------------------  503

Query  601  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  422
                      D K G+ A  G  Q +EAKL++L+RKNG+LEGQLAAALA REAA +S   
Sbjct  504  -------NGGDYKAGLPASSGACQQHEAKLSSLMRKNGILEGQLAAALAGREAAVRSK--  554

Query  421  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  242
                 QD EKK++DA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV
Sbjct  555  -----QDMEKKMSDAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAV  609

Query  241  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            +DDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  610  MDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  661



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 178/230 (77%), Gaps = 13/230 (6%)
 Frame = -1

Query  772  KSSDDESSSQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQ-GSGNFPLDS  596
            K S D++S Q ME  T+  DSG               +  +G+ +T ++   S +   ++
Sbjct  485  KISVDKNSFQTMEPNTKLSDSGG------------VGVSYNGDRSTEERSYASESDKQET  532

Query  595  DDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssal  416
            +D + QE+D K  ++AP G+YQ  EAKL +L+RKNG+LEGQLAAALA+REAA+K+LS+A+
Sbjct  533  EDLILQENDGKSRMTAPPGVYQVSEAKLASLMRKNGILEGQLAAALAAREAAEKNLSAAI  592

Query  415  ksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLD  236
            +S+ + EKKL +AMKE+++L+EK+  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLD
Sbjct  593  RSRLEMEKKLGEAMKEMEMLREKVTSVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLD  652

Query  235  DTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            DTQKELHSTRG+L GE  RAFQLQVEVFHLKQRLQSLE RAPTPRKP+HV
Sbjct  653  DTQKELHSTRGVLAGEHGRAFQLQVEVFHLKQRLQSLEPRAPTPRKPYHV  702



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  509
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  432  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  488

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  489  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  548

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  549  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  608

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  609  LKQRLQSMENRAPTPRKPFHT  629



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  559  GISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLAD  380
             +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK AD
Sbjct  449  ALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFAD  508

Query  379  AMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGL  200
            AMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+
Sbjct  509  AMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGV  568

Query  199  LGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  569  LAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  606



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  688  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  509
            K I EE   + +S N +  + QG  N  ++++D +  E D   G  A   +YQ YE K+ 
Sbjct  515  KIIAEETSCVFDSEN-SHSQNQGVENHLVENEDALVSEPDGMTG-GAHSSIYQLYETKIA  572

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
            +L+RKNG+LEGQLAAALASREAA+K+LSS LKS+Q+ E+KL D ++E++LLKEKLAGVEL
Sbjct  573  SLIRKNGVLEGQLAAALASREAAEKNLSSVLKSRQEIERKLTDTLREMELLKEKLAGVEL  632

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  633  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLTGERARAFQLQVEVFH  692

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENR PTPRKPF+V
Sbjct  693  LKQRLQSMENRVPTPRKPFNV  713



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPIG---LYQS  527
            +K   E+  +      M+  +KQ S  FP     D  +F   D K  ++A      +YQ 
Sbjct  496  AKITAEKTLSTVSDREMSNLQKQCSETFPFAHIDDALIFPGMD-KTNLAANASSSSVYQF  554

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL DAM++++LLKEK
Sbjct  555  HEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLCDAMRDVELLKEK  614

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            L G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQL
Sbjct  615  LTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQL  674

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            QVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  675  QVEVFHLKQRLQSLENRAATPRKPFHV  701



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  509
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  536  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  592

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  593  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  652

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  653  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  712

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  713  LKQRLQSMENRAPTPRKPFHT  733



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  509
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  520  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  576

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  577  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  636

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  637  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  696

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  697  LKQRLQSMENRAPTPRKPFHT  717



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  509
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  530  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  586

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  587  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  646

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  647  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  706

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  707  LKQRLQSMENRAPTPRKPFHT  727



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  685  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  509
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  533  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  589

Query  508  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  329
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  590  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  649

Query  328  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  149
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  650  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  709

Query  148  LKQRLQSLENRAPTPRKPFHV  86
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  710  LKQRLQSMENRAPTPRKPFHT  730



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 177/235 (75%), Gaps = 6/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGN  611
            ++ K S+DESS  Q  +  T Q D G  +    +KT  E+   +  SG+ +  K  G GN
Sbjct  379  RIGKHSEDESSFPQAADGRTNQNDPGHQMNTRGAKTNIEQPVLV--SGD-SLQKNLGFGN  435

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
              L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL AA+AS+EA++K+
Sbjct  436  SLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKN  495

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFL
Sbjct  496  LASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFL  555

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  556  KAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  610



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = -1

Query  628  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  455
            KQ S +FP     D  +F E D    +++   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  492  KQTSESFPFAHIDDALIFPEMDNAATLASSSSVYQFHEAKMTALIRRNGILEGQLEAALA  551

Query  454  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  275
             REAA++++S AL+SKQ+++KKL+DA+++++LLKEKL G+ELAQ+EANSLSN+VHSDNVR
Sbjct  552  GREAAERNVSVALRSKQESDKKLSDALRDVELLKEKLTGLELAQDEANSLSNMVHSDNVR  611

Query  274  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  612  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  671

Query  94   FHV  86
            FHV
Sbjct  672  FHV  674



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 177/235 (75%), Gaps = 6/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGN  611
            ++ K S+DESS  Q  +  T Q D G  +    +KT  EE  ++  SGN +  +  G GN
Sbjct  479  RIDKHSEDESSFPQAGDHRTSQNDPGNQMRSSGAKTNMEEQVSV--SGN-SNQQNLGFGN  535

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
              L+SDD  F E+     +SA   ++  YE K+ +L+RK G+LEGQL+AALASREAA+KS
Sbjct  536  PFLESDDVSFPENSKSGSLSAASSIHHYYETKVASLMRKFGILEGQLSAALASREAAEKS  595

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SA KS+Q+  KKLAD +KE++LL EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFL
Sbjct  596  LASAFKSRQEMGKKLADTLKEMELLSEKLVSAELAQEEANNLSNLVHADNVRLEHDVAFL  655

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  656  KAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  710



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 177/235 (75%), Gaps = 6/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGN  611
            ++ K S+DESS  Q  +  T Q D G  +    +KT  E+   +  SG+ +  K  G GN
Sbjct  478  RIGKHSEDESSFPQAADGRTNQNDPGHQMNTRGAKTNIEQPVLV--SGD-SLQKNLGFGN  534

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
              L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL AA+AS+EA++K+
Sbjct  535  SLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKN  594

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFL
Sbjct  595  LASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFL  654

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  655  KAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  709



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 179/234 (76%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFP  605
            KM K+SD  S  QV +  T + D   L +I    +  E   +  SG M+  + Q   +  
Sbjct  488  KMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDA  545

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  546  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  604

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  605  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  664

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  86
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  665  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  718



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 179/234 (76%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFP  605
            KM K+SD  S  QV +  T + D   L +I    +  E   +  SG M+  + Q   +  
Sbjct  487  KMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDA  544

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  545  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  603

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  604  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  663

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  86
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  664  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  717



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   209 bits (533),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 179/234 (76%), Gaps = 5/234 (2%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFP  605
            KM K+SD  S  QV +  T + D   L +I    +  E   +  SG M+  + Q   +  
Sbjct  512  KMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDA  569

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  570  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  628

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  629  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  688

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  86
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  689  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  742



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -1

Query  574  SDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  395
            SDC  G  A   +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSALKS+Q+ E
Sbjct  501  SDCTTG-GARASIYRLYETKIAALTRKNRVLEGQLAAAFIGREAAEKNVSSALKSRQEME  559

Query  394  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  215
            KKL D ++E++LLKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELH
Sbjct  560  KKLVDTVREMELLKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELH  619

Query  214  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            STRG+L GERARAFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  620  STRGVLSGERARAFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  662



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -1

Query  628  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  455
            KQ S  FP     D  +F E D      +   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  518  KQSSEPFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIRRNGVLEGQLEAALA  577

Query  454  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  275
             REAA++++S AL+SKQ+T+KKL+DA+++++LLKEKL G+EL+Q+EANSLSN+VHSDNVR
Sbjct  578  GREAAERNVSVALRSKQETDKKLSDALRDVELLKEKLTGLELSQDEANSLSNMVHSDNVR  637

Query  274  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  638  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  697

Query  94   FHV  86
            FHV
Sbjct  698  FHV  700



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -1

Query  628  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  455
            K  S +FP     D  +F E D      +   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  518  KPPSESFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIRRNGVLEGQLEAALA  577

Query  454  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  275
             REAA++++S AL+SKQ+T+KKL+DA++++DLLKEKL G+EL+Q+EANSLSN+VHSDNVR
Sbjct  578  GREAAERNVSVALRSKQETDKKLSDALRDVDLLKEKLTGLELSQDEANSLSNMVHSDNVR  637

Query  274  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  638  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  697

Query  94   FHV  86
            FHV
Sbjct  698  FHV  700



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  577  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  398
            E+D +  ++ P  +YQ YE K+ +L RKN LLE QL AAL  REAA+K+LSSA+KSKQ+ 
Sbjct  542  ETDGRSVLTNPSNIYQLYETKIASLTRKNVLLEEQLKAALTCREAAEKNLSSAVKSKQEV  601

Query  397  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            E KLAD +KE++LLKEKLAGVELAQEEANSLSNIVHS NVRLEHDVAFLKA+LDDTQKEL
Sbjct  602  ETKLADTVKEVELLKEKLAGVELAQEEANSLSNIVHSHNVRLEHDVAFLKAILDDTQKEL  661

Query  217  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV*SSIL  71
            +STRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  + + +L
Sbjct  662  YSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPIQICNDVL  710



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 183/234 (78%), Gaps = 3/234 (1%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFP  605
            K+ + SDDE+S SQ +E       + L     + I E+I ++ ESGN +      S  FP
Sbjct  476  KLTRHSDDENSFSQFLEERRPPEAACLAETSGRFIMEDIPSLSESGNFSV-PSCVSEKFP  534

Query  604  LDSDDFVFQESDCKFGI-SAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksl  428
            LD++  +F ES+ K G+ SAP  +YQ YE ++ AL+RKNG+LEGQLAAALASREAA+K++
Sbjct  535  LDNEAIIFPESEDKCGVFSAPSSIYQLYETRMAALIRKNGMLEGQLAAALASREAAEKNV  594

Query  427  ssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLK  248
            SS LKS+Q+TEKKL D  KE++LLKEKL G+ELAQEEAN+LSNIVHSDNVRLEHDVAFLK
Sbjct  595  SSVLKSRQETEKKLVDTGKELELLKEKLGGLELAQEEANNLSNIVHSDNVRLEHDVAFLK  654

Query  247  AVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            AVLDDTQKELHSTRG+L  ERARAFQLQVEVFHLKQRLQSLENR  TPRKPF V
Sbjct  655  AVLDDTQKELHSTRGMLANERARAFQLQVEVFHLKQRLQSLENRTATPRKPFQV  708



>gb|KHN47303.1| hypothetical protein glysoja_020171 [Glycine soja]
Length=261

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  691  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  512
            +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S    ++  YE K+
Sbjct  63   AKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKV  119

Query  511  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  332
             +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  120  ASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAE  179

Query  331  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  152
            LAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVF
Sbjct  180  LAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVF  239

Query  151  HLKQRLQSLENRAPTPRKPFHV  86
            HLKQRLQS+ENR PTPRKPF V
Sbjct  240  HLKQRLQSMENRVPTPRKPFQV  261



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 173/235 (74%), Gaps = 6/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLD--SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGN  611
            ++ K S+DESS  +  +  T Q D  + +    +KT  EE  ++  S N    K  G GN
Sbjct  480  RIDKHSEDESSFPRAADHKTNQNDPRNHMSRSGAKTNMEEQVSVSRSSN---QKNLGFGN  536

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
              L+SDD  F E+     +SA   ++  YE K+ +L+RK G+LEGQLA ALASREA++KS
Sbjct  537  PVLESDDVSFPENSKSGSLSAASDIHHYYETKVASLMRKFGILEGQLAVALASREASEKS  596

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SA KS+Q+ E+KLAD +KE++LL+EKL   EL QEEAN+LSN+VH+DNVRLEHDVAFL
Sbjct  597  LASAFKSRQEMERKLADTLKEMELLREKLVSAELVQEEANNLSNMVHADNVRLEHDVAFL  656

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  657  KAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQRLQSMEKRAPTPRKPFQV  711



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 173/239 (72%), Gaps = 10/239 (4%)
 Frame = -1

Query  781  KMPKSSDDESSS-----QVMERGTRQLD--SGLEHIDSKTIPEEICTIPESGNMATHKKQ  623
            ++ K S+DESS      Q  +  T Q D  + +    +KT  EE  ++  S N    K  
Sbjct  480  RIDKHSEDESSFPRNSLQAADHKTNQNDPRNHMSRSGAKTNMEEQVSVSRSSN---QKNL  536

Query  622  GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasrea  443
            G GN  L+SDD  F E+     +SA   ++  YE K+ +L+RK G+LEGQLA ALASREA
Sbjct  537  GFGNPVLESDDVSFPENSKSGSLSAASDIHHYYETKVASLMRKFGILEGQLAVALASREA  596

Query  442  adkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHD  263
            ++KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   EL QEEAN+LSN+VH+DNVRLEHD
Sbjct  597  SEKSLASAFKSRQEMERKLADTLKEMELLREKLVSAELVQEEANNLSNMVHADNVRLEHD  656

Query  262  VAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  657  VAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVFHLKQRLQSMEKRAPTPRKPFQV  715



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  631  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  452
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  517  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  576

Query  451  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  272
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  577  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  636

Query  271  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  637  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  696

Query  91   HV  86
            HV
Sbjct  697  HV  698



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 177/239 (74%), Gaps = 14/239 (6%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSG--LEHIDSKTIPEE----ICTIPESGNMATHKKQG  620
            KM K+SD+ S  + ++  T + D G  +    +K I EE    +  IP   N+       
Sbjct  476  KMDKNSDENSFPRAVDHRTNENDHGKQMNSSGAKNITEEQQALLSGIPIQQNLVFE----  531

Query  619  SGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaa  440
              N  L+SD+  F E + K G      +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA
Sbjct  532  --NDMLESDNVSFTE-NIKSGSLTTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAA  588

Query  439  dkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDV  260
            +KSL+S LKS+Q+ E+KLA++ KE++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDV
Sbjct  589  EKSLASVLKSRQEMERKLAESHKEMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDV  648

Query  259  AFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  86
            AFLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  649  AFLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  707



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  631  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  452
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  582  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  641

Query  451  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  272
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  642  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  701

Query  271  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  92
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  702  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  761

Query  91   HV  86
            HV
Sbjct  762  HV  763



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 177/239 (74%), Gaps = 14/239 (6%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSG--LEHIDSKTIPEE----ICTIPESGNMATHKKQG  620
            KM K+SD+ S  + ++  T + D G  +    +K I EE    +  IP   N+       
Sbjct  504  KMDKNSDENSFPRAVDHRTNENDHGKQMNSSGAKNITEEQQALLSGIPIQQNLVFE----  559

Query  619  SGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaa  440
              N  L+SD+  F E + K G      +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA
Sbjct  560  --NDMLESDNVSFTE-NIKSGSLTTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAA  616

Query  439  dkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDV  260
            +KSL+S LKS+Q+ E+KLA++ KE++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDV
Sbjct  617  EKSLASVLKSRQEMERKLAESHKEMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDV  676

Query  259  AFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  86
            AFLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  677  AFLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  735



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 178/238 (75%), Gaps = 13/238 (5%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSG--LEHIDSKTIPEE---ICTIPESGNMATHKKQGS  617
            KM K+SD+ S  +  +  T +   G  +    +KT  EE   +  IP   N+    +   
Sbjct  478  KMDKNSDESSFPRSGDHRTNENHHGKQMNTCGTKTNIEEQAMLSGIPNQQNLVFENE---  534

Query  616  GNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaad  437
               P +SD+  F E++    +S+   +Y  YE+K+ +L+RKNG+LEGQLAA+LAS+EAA+
Sbjct  535  --MP-ESDNLSFSENNKSASLSSS-NVYHYYESKVASLIRKNGILEGQLAASLASKEAAE  590

Query  436  kslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVA  257
            KSL+S LKS+Q+ E+KLADA KE++L++EKLA +ELAQEEAN+LSNIVHSDNVRLEHDVA
Sbjct  591  KSLTSVLKSRQEMERKLADAHKEMELMREKLASLELAQEEANNLSNIVHSDNVRLEHDVA  650

Query  256  FLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  86
            FLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  651  FLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  708



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 145/193 (75%), Gaps = 3/193 (2%)
 Frame = -1

Query  655  ESGNMATHKKQGSGNFPLDSDD---FVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgl  485
            ESG    H K G G   L +D    F          ++ P  +YQ YE K  +L RKN L
Sbjct  541  ESGGTTVHHKHGIGISSLTADAEHLFPLGVDGGGLVLTNPTDVYQVYETKTASLTRKNVL  600

Query  484  legqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSL  305
            LE QL AA  SRE A+++LS  ++ KQD E+KLADA++E++LLK+K+AG+E+AQEEAN L
Sbjct  601  LEEQLKAATTSREIAERNLSCTVERKQDRERKLADALREVELLKDKVAGMEVAQEEANGL  660

Query  304  SNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSL  125
            SNI HSDNVRLEHDVAFLKA+L+DTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS 
Sbjct  661  SNIGHSDNVRLEHDVAFLKAILEDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSG  720

Query  124  ENRAPTPRKPFHV  86
            ++RAPTPRKPF +
Sbjct  721  DHRAPTPRKPFQM  733



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 6/235 (3%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLD--SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGN  611
            ++ K S+D+SS ++  +  T Q D  + +    +KT  EE   +  S N    +  G GN
Sbjct  479  RIGKHSEDKSSLTRAADHRTNQNDPRNHMSRNGAKTNMEEQVLVSGSSN---QQNLGFGN  535

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
              L+SDD  F ++     +S    ++  YE K+ +L+RK G+LEGQL+AALASREAA+KS
Sbjct  536  PLLESDDVSFPDNSKLGSLSTDSNIHHYYETKVASLMRKFGILEGQLSAALASREAAEKS  595

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            L+SA KS+Q+ E+KLAD +KE++LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFL
Sbjct  596  LASAFKSRQEMERKLADTLKEMELLREKLVNAELAQEEANNLSNMVHADNVRLEHDVAFL  655

Query  250  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            KAVLDDTQKELHSTRG+L  ER RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  656  KAVLDDTQKELHSTRGVLAAERTRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  710



>gb|EPS74438.1| hypothetical protein M569_00314, partial [Genlisea aurea]
Length=449

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 142/182 (78%), Gaps = 18/182 (10%)
 Frame = -1

Query  610  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            FP +SDD + Q              +  YE K+ AL++K G+LEGQLAAA A+REAA+K+
Sbjct  278  FPSESDDVLLQTRRS----------HHVYEEKIAALMKKTGILEGQLAAATAAREAAEKN  327

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
             +SA +S+Q+ EKKL D +KEIDLLKEKL+ VE++QEEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  328  SASATRSRQEMEKKLVDTLKEIDLLKEKLSSVEISQEEANNLSNIVHSDNVRLEHDVAFL  387

Query  250  KAVLDDTQK--------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            KAVLDDTQK        ELHSTRG+L GERARAFQLQVEVFHLKQRLQSLE RAPTPRK 
Sbjct  388  KAVLDDTQKASWKQKRLELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLETRAPTPRKQ  447

Query  94   FH  89
            FH
Sbjct  448  FH  449



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -1

Query  622  GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasrea  443
            G GN  L+SDD  F ++     +S    ++  YE K+ +L+RK G+LEGQL+AALASREA
Sbjct  521  GFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKVASLMRKFGILEGQLSAALASREA  580

Query  442  adkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHD  263
            A+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHD
Sbjct  581  AEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAELAQEEANNLSNMVHADNVRLEHD  640

Query  262  VAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  641  VAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  699



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 178/239 (74%), Gaps = 9/239 (4%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGNF  608
            KM K+SD+ S  + ++  T + D G  +   + KT  EE  T+  SG +         + 
Sbjct  478  KMDKNSDERSFPRAVDHRTNKDDHGKQMNTSEVKTNMEEQQTLL-SGILNQQNLVFENDM  536

Query  607  PLDSDDFVFQES---DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaad  437
            P +SD+ +F E+   +   G      +Y  YE+KL +L+RKNG+LEGQLAA++AS+EAA+
Sbjct  537  P-ESDNLLFSENINININSGSLTTSNVYYYYESKLASLIRKNGILEGQLAASIASKEAAE  595

Query  436  kslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVA  257
            KSL+S LKS+Q+ ++KL ++ KE++L++EKLAG+ELAQEE N+LSNIVHSDNVRLEHDVA
Sbjct  596  KSLTSVLKSRQEMDRKLTESEKEMELMREKLAGLELAQEETNNLSNIVHSDNVRLEHDVA  655

Query  256  FLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLE-NRAP-TPRKPFHV  86
            FLKAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+E NRA  TPRKPFHV
Sbjct  656  FLKAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMEKNRASTTPRKPFHV  714



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 13/234 (6%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFP  605
            KM K+SD  S  QV +  T + D   L +I    +  E   +  SG M+  + Q   +  
Sbjct  488  KMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDA  545

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  546  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  604

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  605  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  664

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  86
            VLDDTQKELHSTRG++ GERARAFQL        QRLQS+ENR + TPRKPFHV
Sbjct  665  VLDDTQKELHSTRGVIAGERARAFQL--------QRLQSMENRTSTTPRKPFHV  710



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 172/234 (74%), Gaps = 13/234 (6%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDS-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFP  605
            KM K+SD  S  QV +  T + D   L +I    +  E   +  SG M+  + Q   +  
Sbjct  512  KMDKNSDGSSLPQVADHRTNENDRRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDA  569

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  570  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  628

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  629  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  688

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  86
            VLDDTQKELHSTRG++ GERARAFQL        QRLQS+ENR + TPRKPFHV
Sbjct  689  VLDDTQKELHSTRGVIAGERARAFQL--------QRLQSMENRTSTTPRKPFHV  734



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  518  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  576

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  577  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  636

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  637  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  689



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  544  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  602

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  603  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  662

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  663  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  715



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  610  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  668

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  669  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  728

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  729  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  781



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  604  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  425
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  604  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  662

Query  424  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  245
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  663  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  722

Query  244  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  723  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  775



>ref|XP_006855461.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
 gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  556  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  377
            + AP   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKKL+++
Sbjct  536  VIAPANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKKLSES  595

Query  376  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  197
            +KE+++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL STRG+L
Sbjct  596  LKEMEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQSTRGVL  655

Query  196  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  86
             GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  656  AGERARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  692



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -1

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -1

Query  676  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  497
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  496  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  317
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  316  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  161
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|NP_001068393.1| Os11g0657000 [Oryza sativa Japonica Group]
 dbj|BAF28756.1| Os11g0657000, partial [Oryza sativa Japonica Group]
Length=530

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  384  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  443

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  444  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  503

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  504  QVEVFHLKQRLQTMEGRSPTPRKP  527



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  544  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  603

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  604  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  663

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  664  QLEVFHLKQRLQTMEGRSPTPRKPLNL  690



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  538  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  597

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  598  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  657

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFHV  86
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  658  QLEVFHLKQRLQTMEGRSPTPRKPLNL  684



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            ++ ++T L+R+N  LE QL+AAL +++ A+K+LS  + SK + EK+LA+  +E++ LKEK
Sbjct  539  HDTRITTLVRRNMALEEQLSAALTTKDEAEKNLSLVIDSKDELEKRLAERDREVEALKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQR+Q++E R+PTPRKP
Sbjct  659  QVEVFHLKQRVQTMEGRSPTPRKP  682



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -1

Query  625  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  449
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  536  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  595

Query  448  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  269
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  596  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  655

Query  268  HDVAFLKAVLDDTQKELHSTRGLL  197
            HDVAFLKAVLDDTQKELHSTRG+L
Sbjct  656  HDVAFLKAVLDDTQKELHSTRGVL  679



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  536  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  595

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  596  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  655

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  656  QVEVFHLKQRLPTMDGRSPTPRKP  679



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 137/189 (72%), Gaps = 4/189 (2%)
 Frame = -1

Query  781  KMPKSSDDESSSQVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNF  608
            KM K+ D+ S SQ  E    Q DSG     +  K   E++  + E  N+  H  QGS N 
Sbjct  481  KMAKAEDESSFSQAAEHKISQSDSGTRTSTVGGKLCTEDMVAVYEPENLNPHN-QGSANL  539

Query  607  PLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  431
            P+DS D VF  +D K G + AP  + Q YE K+T L+RKN +LEGQLAAA ASREA +K+
Sbjct  540  PVDSSDSVFPVNDIKLGSVPAPSSVSQFYETKITQLIRKNAILEGQLAAAFASREAVEKN  599

Query  430  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  251
            LSSALKSKQ+ EKKLA+ MK ++LLKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  600  LSSALKSKQEMEKKLAEMMKGMELLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAFL  659

Query  250  KAVLDDTQK  224
            KAVLDDTQK
Sbjct  660  KAVLDDTQK  668



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  539  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  598

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  659  QVEVFHLKQRLPTMDGRSPTPRKP  682



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  163  VEVFHLKQRLQSLENRAP-TPRKP  95
            VEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VEVFHLKQRLQTMEGRSPAAPRKP  692



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y +K+T L+R+N  LE QLAAALAS++ A+K+LS  + S++  EK+LA+  KE +LLKEK
Sbjct  547  YNSKITDLIRRNAALEDQLAAALASKDQAEKNLSLVINSREQLEKRLANKGKEAELLKEK  606

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            ++G+ELAQEE+N++SN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  607  ISGLELAQEESNNISNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  666

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ +E RA TPRKP
Sbjct  667  QVEVFHLKQRLQLVEGRAGTPRKP  690



>gb|KDO75103.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=342

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 139/190 (73%), Gaps = 7/190 (4%)
 Frame = -1

Query  781  KMPKSSDDESS-SQVMERGTRQLDSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSG  614
            KM K+S+DE+S  Q  E    Q D G +    +    I E      E+ N      QG G
Sbjct  133  KMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIG  189

Query  613  NFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadk  434
            NF +D+D+ +F ++D    +S P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +REAA+K
Sbjct  190  NFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEK  249

Query  433  slssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAF  254
            + SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAF
Sbjct  250  NFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAF  309

Query  253  LKAVLDDTQK  224
            LKAVLDDTQK
Sbjct  310  LKAVLDDTQK  319



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y AK+T L++++  LE QLA ALAS++ A+K+LS  + S++  E++LA+  KE ++LKEK
Sbjct  554  YNAKITDLIKRSSALEDQLATALASKDQAEKNLSLVINSREQLERRLANKDKEAEVLKEK  613

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  614  IAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  673

Query  166  QVEVFHLKQRLQSLENRAPTPRKPF  92
            QVEVFHLKQRLQ +E RA TP+ P 
Sbjct  674  QVEVFHLKQRLQMVEGRAGTPKNPL  698



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLRAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLGAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+  L+R+N  LE QL+ ALAS++  +KSLSS + S++  EK LA+  KE ++LKEK
Sbjct  475  YNTKIADLIRRNTTLEDQLSTALASKDQLEKSLSSVIHSREQLEKMLANKDKEAEMLKEK  534

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++RAFQL
Sbjct  535  IACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLAGEQSRAFQL  594

Query  166  QVEVFHLKQRLQSLENRAPTPRK  98
            QVEVFHLKQRLQ LE R+ TP K
Sbjct  595  QVEVFHLKQRLQILEGRSGTPTK  617



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  397  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  217  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  397  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  218
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  217  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 22/165 (13%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  167
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  166  --------------------QVEVFHLKQRLQSLENRAP-TPRKP  95
                                QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  713



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = -1

Query  625  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  449
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  541  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  600

Query  448  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  269
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  601  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  660

Query  268  HDVAFLKAVLDDTQKEL  218
            HDVAFLKAVLDDTQK L
Sbjct  661  HDVAFLKAVLDDTQKVL  677



>dbj|BAK00043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            ++ EKKLA+  +E+  LKEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQ
Sbjct  173  EELEKKLAERDREVVALKEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQ  232

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            KELH TRG+L GERARAFQLQVEVFHLKQRLQS++  +   RKP
Sbjct  233  KELHLTRGVLAGERARAFQLQVEVFHLKQRLQSMDGLSSAQRKP  276



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 122/166 (73%), Gaps = 23/166 (14%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  167
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  166  ---------------------QVEVFHLKQRLQSLENRAP-TPRKP  95
                                 QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFLFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  714



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  541  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  600

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  601  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  660

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFH  89
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  661  QVEVFHLKQRLQILEGRSGTPTKQPH  686



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  548  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  607

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  608  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  667

Query  166  QVEVFHLKQRLQSLENRAPTPRKPFH  89
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  668  QVEVFHLKQRLQILEGRSGTPTKQPH  693



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -1

Query  556  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  377
             S+ +G    Y  K+  L+R+N  LE QLA ALAS++  DKSL+S + S+   EK LA+ 
Sbjct  535  CSSDVGQSHLYNTKIADLIRRNTTLEDQLATALASKDQLDKSLASVIHSRGQLEKMLANK  594

Query  376  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  197
             KE ++LKEK+A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV  +TQKELHSTR +L
Sbjct  595  DKEAEMLKEKIACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTGETQKELHSTRRVL  654

Query  196  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRK  98
             GE++RAFQLQVEVFHLKQRLQ LE R+ TP K
Sbjct  655  AGEQSRAFQLQVEVFHLKQRLQILEGRSGTPNK  687



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  655  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  476
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  543  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  602

Query  475  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  296
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  603  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  662

Query  295  VHSDNVRLEHDVAFLKAVLDDTQKEL  218
            VHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  663  VHSDNVRLEHDVAFLKAVLDDTQKSL  688



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 27/171 (16%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            ++ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + +K++ E++LA+  +E+  LKEK
Sbjct  439  HDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDTKEELERRLAERDREVVALKEK  498

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-------------------  224
            + G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQK                   
Sbjct  499  VGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKAKNNNIPVISNCTSVYAVV  558

Query  223  --------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
                    ELHSTRG+L GERARAFQLQVEVFHLKQRLQS++ R+PT RKP
Sbjct  559  LTILPPKQELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRSPTQRKP  609



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  164
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  163  VEVFHLK  143
            V  +H +
Sbjct  669  VRPYHAR  675



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 27/125 (22%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            ++ EK+LA+  +E+  LKEK+ G+E A E+ N+ SN VH+DNVRLE +VAFLKAV+D+TQ
Sbjct  714  EELEKRLAERDREVVALKEKVGGLEQAHEDLNNASNTVHADNVRLEREVAFLKAVMDETQ  773

Query  226  K---------------------------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  128
            K                           E +STRG+L GERARAFQLQVEVFHLKQRLQS
Sbjct  774  KAKKIKIPVISHCTSVYAVALTILPPKQEFYSTRGVLAGERARAFQLQVEVFHLKQRLQS  833

Query  127  LENRA  113
            ++ R 
Sbjct  834  MDGRG  838



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+T L+R+N  LE QLAAAL S+E A+K+LS  + S++  EK+LA   KE +LLKEK
Sbjct  631  YNTKITDLIRRNAALEDQLAAALESKEQAEKNLSLVMSSREQLEKRLASRGKEAELLKEK  690

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  691  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  731

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  732  QVEVFHLKQRLQTAEGRSGTPRKP  755



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 19/144 (13%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y  K+T L+R+N  LE QLAAALAS+E A+K+LS  + S++  EK+LA   K+ +LLKEK
Sbjct  514  YNNKITDLIRRNAALEDQLAAALASKEQAEKNLSLVMSSREQLEKRLASRGKDAELLKEK  573

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  167
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  574  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  614

Query  166  QVEVFHLKQRLQSLENRAPTPRKP  95
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  615  QVEVFHLKQRLQTAEGRSVTPRKP  638



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -1

Query  532  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
            QS+E KL A +R+    EGQL   L  +E A+  L+SAL+++Q TE KLA A+ +   +K
Sbjct  863  QSFEIKLAAAVRRGEQAEGQLTTVLRGKEEAENRLASALQTRQQTESKLAVALTKQAEIK  922

Query  352  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
            E +AG E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ERA++ 
Sbjct  923  EAVAGAERAQEDSNNLCNLVHSENLRLEHDLAFLKAVLEDTQKELDSTREALATERAKSS  982

Query  172  QLQVEVFHLKQRL  134
            QLQ+EVF+L +RL
Sbjct  983  QLQMEVFNLNKRL  995



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -1

Query  532  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
            QS+E KL A +R+  L EGQL+ AL  +E A+KSL  ALK++Q  E KLA ++K    LK
Sbjct  481  QSFEMKLAAAVRRGELAEGQLSTALKGKEEAEKSLQLALKTRQHAEGKLAASLKGQMDLK  540

Query  352  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
            E++A  E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQ EL STR LL  ER R+F
Sbjct  541  ERVAAAERAQEDSNNLCNVVHSENLRLEHDLAFLKAVLEDTQMELQSTRELLATERTRSF  600

Query  172  QLQVEVFHLKQRLQSL  125
             LQV V HL   L +L
Sbjct  601  NLQVTVDHLPPLLHAL  616



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  532   QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  353
             QS+E KL A +R+    EGQ+  AL ++E     L+SALK +Q  E +LA A+     LK
Sbjct  915   QSFEMKLAAAVRRAEQAEGQVTTALRAKEEIANRLASALKMRQHAEGQLAAALTAQAELK  974

Query  352   EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  173
             E +A  E AQE++N+L ++VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ER+++F
Sbjct  975   ETVAAAERAQEDSNNLCSVVHSENLRLEHDLAFLKAVLEDTQKELDSTREGLVTERSKSF  1034

Query  172   QLQVEVFHLKQR-LQSLENRAPTP  104
             +LQ+E+F LK++ L SL     TP
Sbjct  1035  KLQMEIFDLKKKTLLSLSEEDATP  1058



>ref|XP_001761501.1| predicted protein [Physcomitrella patens]
 gb|EDQ73569.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -1

Query  391  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  212
            KLA ++K    L+E+ A  + AQE++N+L N++H +N+RLEHD+AF KAVL+DTQK+L S
Sbjct  141  KLAASLKGRMDLEERSAAAKRAQEDSNNLRNVIHLENLRLEHDLAFFKAVLEDTQKDLQS  200

Query  211  TRGLLGGERARAFQLQVEVFHLKQRLQSL  125
             R L+  +R R+F LQ+ V HL   L +L
Sbjct  201  NRELIATKRTRSFNLQLTVDHLPFLLPAL  229



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  526  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  347
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  545  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  604

Query  346  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  224
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  605  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQK  645



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  523  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  344
            + ++T L+R+N  LE QL+AALAS++ A+K+LS  + SK + EK+LA+  +E++ LKEK 
Sbjct  548  DTRITTLIRRNMALEEQLSAALASKDEAEKNLSLVIDSKDELEKRLAEKDREVEALKEKA  607

Query  343  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  224
             G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  608  TGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQK  647



>emb|CDY02611.1| BnaC02g08240D [Brassica napus]
 emb|CDY02612.1| BnaC02g08230D [Brassica napus]
Length=63

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  298  IVHSDNVRLEHDVAFLKAVLDDTQKE--LHSTRGLLGGERARAFQLQV  161
            +VH DNVRLEHDVA +K VLDD Q++  LHSTRG+L GERAR FQLQV
Sbjct  1    MVHFDNVRLEHDVALVKYVLDDKQRKMFLHSTRGVLAGERARMFQLQV  48



>gb|ABR25493.1| rangap1 interacting protein [Oryza sativa Indica Group]
Length=40

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  205  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            G+L GER+RAFQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  1    GVLAGERSRAFQLQVEVFHLKQRLQTMEGRSPTPRKP  37



>ref|XP_001765510.1| predicted protein [Physcomitrella patens]
 gb|EDQ69771.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 24/101 (24%)
 Frame = -1

Query  406  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  227
            Q  E K A ++K   + KE++A  E AQE++N+L N+VHS N+RLEHD AFLKAVL+DTQ
Sbjct  290  QHAEGKFAASLKA-QIEKERVAVAERAQEDSNNLCNVVHSGNLRLEHDFAFLKAVLEDTQ  348

Query  226  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  104
                                 +EVF LK++L       PTP
Sbjct  349  --------------------NMEVFDLKKKLLP---TIPTP  366



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -1

Query  223  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  95
            ELHSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  506  ELHSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940