BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016N02

Length=790
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790378.1|  PREDICTED: phosphoinositide phospholipase C 4      423   6e-142   Nicotiana sylvestris
emb|CAA72681.1|  1-phosphatidylinositol-4,5-bisphosphate phosphod...    422   1e-141   Nicotiana rustica [wild tobacco]
emb|CAA65127.1|  phosphoinositide-specific phospholipase C              421   6e-141   Nicotiana rustica [wild tobacco]
gb|KJB35244.1|  hypothetical protein B456_006G106400                    413   7e-141   Gossypium raimondii
ref|NP_001234181.1|  PI-phospholipase C PLC4                            419   2e-140   Solanum lycopersicum
ref|XP_009622729.1|  PREDICTED: phosphoinositide phospholipase C ...    418   6e-140   Nicotiana tomentosiformis
gb|KJB35243.1|  hypothetical protein B456_006G106400                    414   9e-140   Gossypium raimondii
ref|XP_006344048.1|  PREDICTED: phosphoinositide phospholipase C ...    417   2e-139   Solanum tuberosum [potatoes]
gb|KJB35242.1|  hypothetical protein B456_006G106400                    414   2e-138   Gossypium raimondii
ref|XP_007016097.1|  Phosphatidylinositol-speciwc phospholipase C4      414   2e-138   
gb|KHG04158.1|  Phosphoinositide phospholipase C 4 -like protein        411   5e-137   Gossypium arboreum [tree cotton]
ref|XP_006425071.1|  hypothetical protein CICLE_v10028080mg             408   5e-136   Citrus clementina [clementine]
emb|CBI15949.3|  unnamed protein product                                407   5e-136   Vitis vinifera
gb|AFO54605.1|  phospholipase C                                         407   9e-136   Populus tomentosa [Chinese white poplar]
ref|XP_002299806.2|  hypothetical protein POPTR_0001s25910g             407   1e-135   
ref|XP_002278527.1|  PREDICTED: phosphoinositide phospholipase C ...    406   2e-135   Vitis vinifera
emb|CDP09195.1|  unnamed protein product                                406   3e-135   Coffea canephora [robusta coffee]
ref|XP_008355042.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    405   7e-135   
ref|XP_009347256.1|  PREDICTED: phosphoinositide phospholipase C ...    405   7e-135   Pyrus x bretschneideri [bai li]
gb|KDO66894.1|  hypothetical protein CISIN_1g007887mg                   405   9e-135   Citrus sinensis [apfelsine]
ref|XP_006488531.1|  PREDICTED: phosphoinositide phospholipase C ...    405   1e-134   Citrus sinensis [apfelsine]
gb|EYU45716.1|  hypothetical protein MIMGU_mgv1a003401mg                404   1e-134   Erythranthe guttata [common monkey flower]
ref|XP_011043776.1|  PREDICTED: phosphoinositide phospholipase C ...    404   2e-134   Populus euphratica
ref|XP_002525651.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    403   4e-134   Ricinus communis
ref|XP_007206576.1|  hypothetical protein PRUPE_ppa020283mg             403   5e-134   Prunus persica
ref|XP_003615684.1|  Phosphoinositide phospholipase C                   397   6e-134   
gb|KCW85435.1|  hypothetical protein EUGRSUZ_B02250                     398   2e-133   Eucalyptus grandis [rose gum]
gb|KJB55732.1|  hypothetical protein B456_009G091900                    394   2e-133   Gossypium raimondii
ref|XP_004490600.1|  PREDICTED: phosphoinositide phospholipase C ...    400   8e-133   Cicer arietinum [garbanzo]
ref|XP_010043428.1|  PREDICTED: phosphoinositide phospholipase C ...    399   2e-132   Eucalyptus grandis [rose gum]
ref|XP_008220865.1|  PREDICTED: phosphoinositide phospholipase C ...    398   3e-132   Prunus mume [ume]
gb|KDP46490.1|  hypothetical protein JCGZ_08462                         398   3e-132   Jatropha curcas
ref|XP_011460953.1|  PREDICTED: phosphoinositide phospholipase C ...    396   2e-131   Fragaria vesca subsp. vesca
ref|XP_004294231.1|  PREDICTED: phosphoinositide phospholipase C ...    396   2e-131   Fragaria vesca subsp. vesca
gb|AES98642.2|  phosphatidylinositol-specific phospholipase C           396   2e-131   Medicago truncatula
gb|KHG10595.1|  Phosphoinositide phospholipase C 4                      395   7e-131   Gossypium arboreum [tree cotton]
gb|KJB55734.1|  hypothetical protein B456_009G091900                    394   2e-130   Gossypium raimondii
gb|AFN53674.1|  hypothetical protein                                    391   4e-130   Linum usitatissimum
ref|XP_009399994.1|  PREDICTED: phosphoinositide phospholipase C ...    392   1e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220858.1|  PREDICTED: phosphoinositide phospholipase C ...    390   4e-129   Prunus mume [ume]
ref|XP_008789095.1|  PREDICTED: phosphoinositide phospholipase C ...    385   4e-128   
ref|XP_010937845.1|  PREDICTED: phosphoinositide phospholipase C ...    387   1e-127   Elaeis guineensis
ref|XP_010937844.1|  PREDICTED: phosphoinositide phospholipase C ...    387   1e-127   Elaeis guineensis
ref|XP_007208015.1|  hypothetical protein PRUPE_ppa003249mg             386   2e-127   Prunus persica
ref|XP_010922549.1|  PREDICTED: phosphoinositide phospholipase C ...    385   3e-127   Elaeis guineensis
ref|XP_008789094.1|  PREDICTED: phosphoinositide phospholipase C ...    385   4e-127   Phoenix dactylifera
ref|XP_008789093.1|  PREDICTED: phosphoinositide phospholipase C ...    385   5e-127   Phoenix dactylifera
gb|EPS61000.1|  hypothetical protein M569_13801                         385   6e-127   Genlisea aurea
gb|ABU53666.1|  phospholipase C                                         384   1e-126   Torenia fournieri [bluewings]
ref|XP_009402378.1|  PREDICTED: phosphoinositide phospholipase C ...    384   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010106259.1|  Phosphoinositide phospholipase C 2                 384   2e-126   Morus notabilis
ref|XP_006843548.1|  hypothetical protein AMTR_s00007p00065880          382   1e-125   Amborella trichopoda
ref|XP_009120385.1|  PREDICTED: phosphoinositide phospholipase C 4      381   2e-125   Brassica rapa
ref|XP_010920866.1|  PREDICTED: phosphoinositide phospholipase C ...    381   3e-125   Elaeis guineensis
ref|XP_010253733.1|  PREDICTED: phosphoinositide phospholipase C ...    380   3e-125   Nelumbo nucifera [Indian lotus]
ref|XP_010253735.1|  PREDICTED: phosphoinositide phospholipase C ...    380   3e-125   Nelumbo nucifera [Indian lotus]
ref|XP_010920867.1|  PREDICTED: phosphoinositide phospholipase C ...    380   4e-125   Elaeis guineensis
ref|XP_009387536.1|  PREDICTED: phosphoinositide phospholipase C ...    380   7e-125   
ref|XP_009387528.1|  PREDICTED: phosphoinositide phospholipase C ...    379   8e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387519.1|  PREDICTED: phosphoinositide phospholipase C ...    379   9e-125   
emb|CDY52122.1|  BnaA10g29510D                                          379   1e-124   Brassica napus [oilseed rape]
ref|XP_009380683.1|  PREDICTED: phosphoinositide phospholipase C ...    379   2e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAW81961.1|  phosphatidylinositol-specific phospholipase C 1         377   2e-124   Lilium davidii
ref|XP_010443620.1|  PREDICTED: phosphoinositide phospholipase C ...    377   1e-123   Camelina sativa [gold-of-pleasure]
gb|KFK27410.1|  hypothetical protein AALP_AA8G379300                    376   2e-123   Arabis alpina [alpine rockcress]
gb|KFK27411.1|  hypothetical protein AALP_AA8G379300                    376   2e-123   Arabis alpina [alpine rockcress]
emb|CBI30388.3|  unnamed protein product                                375   3e-123   Vitis vinifera
ref|XP_011035945.1|  PREDICTED: phosphoinositide phospholipase C ...    375   3e-123   Populus euphratica
ref|XP_002533650.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    375   3e-123   Ricinus communis
ref|XP_008805482.1|  PREDICTED: phosphoinositide phospholipase C ...    375   6e-123   Phoenix dactylifera
gb|KHG10596.1|  Phosphoinositide phospholipase C 4                      375   9e-123   Gossypium arboreum [tree cotton]
ref|XP_010654153.1|  PREDICTED: phosphoinositide phospholipase C ...    376   1e-122   Vitis vinifera
ref|XP_002316212.1|  phosphoinositide-specific phospholipase C fa...    374   1e-122   Populus trichocarpa [western balsam poplar]
emb|CDY71544.1|  BnaUnng04440D                                          370   2e-122   Brassica napus [oilseed rape]
gb|ABM90640.1|  phospholipase C                                         374   2e-122   Torenia fournieri [bluewings]
ref|XP_011077556.1|  PREDICTED: phosphoinositide phospholipase C ...    373   2e-122   Sesamum indicum [beniseed]
ref|XP_010483471.1|  PREDICTED: phosphoinositide phospholipase C ...    373   3e-122   Camelina sativa [gold-of-pleasure]
gb|KDO68973.1|  hypothetical protein CISIN_1g007399mg                   365   3e-122   Citrus sinensis [apfelsine]
emb|CAM92313.1|  phospholipase C                                        373   3e-122   Vigna radiata [mung bean]
ref|XP_010534598.1|  PREDICTED: phosphoinositide phospholipase C 6      373   3e-122   Tarenaya hassleriana [spider flower]
emb|CAK32509.1|  phospholipase C                                        373   3e-122   Vigna radiata [mung bean]
emb|CAK32510.1|  phospholipase C                                        373   3e-122   Vigna radiata [mung bean]
gb|AAQ95730.1|  phospholipase C                                         373   4e-122   Vigna radiata [mung bean]
ref|XP_006279487.1|  hypothetical protein CARUB_v10026125mg             373   4e-122   Capsella rubella
ref|XP_002316213.2|  phosphoinositide-specific phospholipase C fa...    372   5e-122   
ref|XP_009772725.1|  PREDICTED: phosphoinositide phospholipase C ...    372   6e-122   Nicotiana sylvestris
ref|NP_001235310.1|  phosphoinositide-specific phospholipase C P13      372   6e-122   Glycine max [soybeans]
ref|XP_009772724.1|  PREDICTED: phosphoinositide phospholipase C ...    372   6e-122   Nicotiana sylvestris
ref|XP_009126743.1|  PREDICTED: phosphoinositide phospholipase C 4      372   7e-122   Brassica rapa
ref|XP_009133410.1|  PREDICTED: phosphoinositide phospholipase C ...    372   1e-121   Brassica rapa
gb|KDP44771.1|  hypothetical protein JCGZ_01271                         371   1e-121   Jatropha curcas
ref|XP_007016094.1|  Phosphatidylinositol-speciwc phospholipase C...    371   1e-121   
ref|XP_004490994.1|  PREDICTED: phosphoinositide phospholipase C ...    371   2e-121   Cicer arietinum [garbanzo]
ref|NP_001032097.1|  phosphoinositide phospholipase C 4                 367   2e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80341.1|  BnaC09g34010D                                          370   2e-121   
ref|XP_002311222.1|  phosphoinositide-specific phospholipase C fa...    370   2e-121   
emb|CAM92314.1|  phospholipase C                                        370   3e-121   Vigna radiata [mung bean]
ref|XP_010264635.1|  PREDICTED: phosphoinositide phospholipase C ...    370   3e-121   Nelumbo nucifera [Indian lotus]
ref|XP_003616636.1|  Phosphoinositide phospholipase C                   370   3e-121   Medicago truncatula
ref|XP_010264634.1|  PREDICTED: phosphoinositide phospholipase C ...    370   3e-121   Nelumbo nucifera [Indian lotus]
ref|XP_008233757.1|  PREDICTED: phosphoinositide phospholipase C ...    370   3e-121   Prunus mume [ume]
ref|XP_008233758.1|  PREDICTED: phosphoinositide phospholipase C ...    370   3e-121   Prunus mume [ume]
dbj|BAO02533.1|  predicted phospholipase C ortholog                     370   3e-121   Nicotiana alata [flowering tobacco]
gb|AAN75042.1|  phosphoinositide-specific phospholipase C 8             369   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520201.1|  PREDICTED: phosphoinositide phospholipase C 4      370   5e-121   Tarenaya hassleriana [spider flower]
gb|EYU20012.1|  hypothetical protein MIMGU_mgv1a003407mg                370   5e-121   Erythranthe guttata [common monkey flower]
ref|XP_008793309.1|  PREDICTED: phosphoinositide phospholipase C ...    370   5e-121   
ref|XP_007220553.1|  hypothetical protein PRUPE_ppa003223mg             369   6e-121   Prunus persica
ref|XP_011076692.1|  PREDICTED: phosphoinositide phospholipase C ...    369   6e-121   Sesamum indicum [beniseed]
emb|CBI15950.3|  unnamed protein product                                368   6e-121   Vitis vinifera
ref|XP_011045853.1|  PREDICTED: phosphoinositide phospholipase C ...    370   6e-121   Populus euphratica
ref|XP_006435740.1|  hypothetical protein CICLE_v10031029mg             369   8e-121   Citrus clementina [clementine]
ref|NP_001236167.1|  phosphatidylinositol-specific phospholipase C      369   8e-121   
ref|XP_010454132.1|  PREDICTED: phosphoinositide phospholipase C ...    369   9e-121   Camelina sativa [gold-of-pleasure]
ref|XP_007008968.1|  Phospholipase C 2                                  369   1e-120   
gb|KDP44772.1|  hypothetical protein JCGZ_01272                         361   1e-120   Jatropha curcas
gb|ABC50164.1|  phospholipase C                                         369   1e-120   Petunia integrifolia subsp. inflata
gb|KFK27404.1|  hypothetical protein AALP_AA8G378600                    369   1e-120   Arabis alpina [alpine rockcress]
ref|XP_002269949.1|  PREDICTED: phosphoinositide phospholipase C 2      369   2e-120   Vitis vinifera
ref|NP_850327.2|  phosphoinositide phospholipase C 6                    369   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200678.2|  phosphoinositide phospholipase C 4                    369   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920865.1|  PREDICTED: phosphoinositide phospholipase C ...    368   2e-120   Elaeis guineensis
gb|AAL23439.1|  phosphoinositide-specific phospholipase C4              368   2e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14022.1|  unnamed protein product                                368   2e-120   Coffea canephora [robusta coffee]
ref|XP_009605158.1|  PREDICTED: phosphoinositide phospholipase C ...    368   2e-120   Nicotiana tomentosiformis
gb|KFK36899.1|  hypothetical protein AALP_AA4G187200                    369   2e-120   Arabis alpina [alpine rockcress]
ref|XP_009605157.1|  PREDICTED: phosphoinositide phospholipase C ...    368   2e-120   Nicotiana tomentosiformis
ref|XP_002311223.1|  phosphoinositide-specific phospholipase C fa...    368   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_010454117.1|  PREDICTED: phosphoinositide phospholipase C ...    368   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006411261.1|  hypothetical protein EUTSA_v10016400mg             369   2e-120   
ref|XP_002879846.1|  phosphoinositide-specific phospholipase C fa...    369   3e-120   Arabidopsis lyrata subsp. lyrata
gb|ABJ99758.1|  phospholipase C                                         368   3e-120   Nicotiana tabacum [American tobacco]
ref|XP_009344939.1|  PREDICTED: phosphoinositide phospholipase C ...    368   3e-120   Pyrus x bretschneideri [bai li]
emb|CDY32691.1|  BnaA02g07530D                                          368   3e-120   Brassica napus [oilseed rape]
ref|XP_002278839.2|  PREDICTED: phosphoinositide phospholipase C ...    368   3e-120   Vitis vinifera
ref|XP_010689655.1|  PREDICTED: phosphoinositide phospholipase C 2      367   3e-120   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO68971.1|  hypothetical protein CISIN_1g007399mg                   367   3e-120   Citrus sinensis [apfelsine]
ref|NP_001275400.1|  phosphoinositide phospholipase C 2-like            367   3e-120   Solanum tuberosum [potatoes]
ref|XP_007141766.1|  hypothetical protein PHAVU_008G224000g             368   4e-120   Phaseolus vulgaris [French bean]
gb|KHN20845.1|  Phosphoinositide phospholipase C 2                      366   4e-120   Glycine soja [wild soybean]
ref|NP_001275075.1|  phosphoinositide phospholipase C 2-like            366   4e-120   Solanum tuberosum [potatoes]
ref|XP_006401052.1|  hypothetical protein EUTSA_v10013042mg             367   5e-120   Eutrema salsugineum [saltwater cress]
ref|XP_006338846.1|  PREDICTED: phosphoinositide phospholipase C ...    366   5e-120   
ref|NP_001235324.1|  phosphoinositide-specific phospholipase C P25      366   6e-120   Glycine max [soybeans]
ref|XP_007016095.1|  Phosphatidylinositol-speciwc phospholipase C...    367   1e-119   
gb|KHN48566.1|  Phosphoinositide phospholipase C 2                      367   1e-119   Glycine soja [wild soybean]
ref|XP_006295484.1|  hypothetical protein CARUB_v10024587mg             367   1e-119   Capsella rubella
ref|XP_002463446.1|  hypothetical protein SORBIDRAFT_02g044010          366   1e-119   Sorghum bicolor [broomcorn]
ref|XP_010517422.1|  PREDICTED: phosphoinositide phospholipase C 6      367   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_006658176.1|  PREDICTED: phosphoinositide phospholipase C ...    358   2e-119   
emb|CAA75546.2|  phospholipase C                                        365   3e-119   Pisum sativum [garden pea]
dbj|BAD95335.1|  phosphoinositide specific phospholipase C              354   3e-119   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14453.1|  Phosphoinositide phospholipase C 2                      362   3e-119   
ref|XP_010534599.1|  PREDICTED: phosphoinositide phospholipase C 2      365   3e-119   Tarenaya hassleriana [spider flower]
ref|XP_008343623.1|  PREDICTED: phosphoinositide phospholipase C ...    365   4e-119   
gb|KHG14938.1|  Phosphoinositide phospholipase C 2 -like protein        364   4e-119   Gossypium arboreum [tree cotton]
ref|XP_010508911.1|  PREDICTED: phosphoinositide phospholipase C ...    365   4e-119   Camelina sativa [gold-of-pleasure]
ref|NP_001234190.1|  PI-phospholipase C PLC3                            364   5e-119   
gb|AAW81960.1|  phosphatidylinositol-specific phospholipase C 2         363   5e-119   Lilium davidii
ref|XP_008463239.1|  PREDICTED: phosphoinositide phospholipase C ...    365   6e-119   Cucumis melo [Oriental melon]
ref|XP_010658272.1|  PREDICTED: phosphoinositide phospholipase C 6      364   6e-119   Vitis vinifera
ref|XP_004149233.1|  PREDICTED: phosphoinositide phospholipase C ...    364   7e-119   
ref|XP_002866286.1|  phosphoinositide-specific phospholipase C fa...    364   9e-119   Arabidopsis lyrata subsp. lyrata
ref|XP_008666992.1|  PREDICTED: phosphoinositide-specific phospho...    363   9e-119   
ref|XP_011046045.1|  PREDICTED: phosphoinositide phospholipase C ...    363   1e-118   Populus euphratica
ref|XP_003600904.1|  Phosphoinositide phospholipase C                   364   1e-118   Medicago truncatula
ref|XP_004958809.1|  PREDICTED: phosphoinositide phospholipase C ...    364   1e-118   Setaria italica
gb|AAM90315.1|  phospholipase C                                         363   1e-118   Pisum sativum [garden pea]
ref|XP_011042811.1|  PREDICTED: phosphoinositide phospholipase C ...    363   1e-118   Populus euphratica
ref|XP_010505719.1|  PREDICTED: phosphoinositide phospholipase C ...    364   2e-118   Camelina sativa [gold-of-pleasure]
dbj|BAK01542.1|  predicted protein                                      363   2e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAC81703.2|  phospholipase C                                        352   2e-118   Oryza sativa [red rice]
ref|XP_009385550.1|  PREDICTED: phosphoinositide phospholipase C ...    362   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEK84223.1|  phosphoinositide-specific phospholipase-like protein    363   2e-118   Cucurbita maxima [Boston marrow]
ref|XP_009143251.1|  PREDICTED: phosphoinositide phospholipase C 6      363   2e-118   Brassica rapa
gb|ADR00313.1|  phosphoinositide-specific phospholipase C1              360   3e-118   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010443621.1|  PREDICTED: phosphoinositide phospholipase C ...    362   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002525652.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    362   3e-118   
gb|EYU22354.1|  hypothetical protein MIMGU_mgv1a001900mg                367   3e-118   Erythranthe guttata [common monkey flower]
ref|XP_010685545.1|  PREDICTED: phosphoinositide phospholipase C ...    362   3e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010535594.1|  PREDICTED: phosphoinositide phospholipase C ...    358   6e-118   Tarenaya hassleriana [spider flower]
gb|ACF93733.1|  phospholipase C                                         362   6e-118   Spinacia oleracea
ref|XP_010937846.1|  PREDICTED: phosphoinositide phospholipase C ...    362   7e-118   
ref|XP_006338847.1|  PREDICTED: phosphoinositide phospholipase C ...    362   8e-118   
gb|AJA33385.1|  phosphatidylinositol phospholipase C 5                  362   8e-118   Solanum lycopersicum
gb|KDP46487.1|  hypothetical protein JCGZ_08459                         360   1e-117   Jatropha curcas
ref|XP_010483472.1|  PREDICTED: phosphoinositide phospholipase C ...    360   2e-117   Camelina sativa [gold-of-pleasure]
gb|KHN36373.1|  Phosphoinositide phospholipase C 2                      359   2e-117   Glycine soja [wild soybean]
ref|XP_007163546.1|  hypothetical protein PHAVU_001G243300g             360   2e-117   Phaseolus vulgaris [French bean]
ref|XP_003552353.1|  PREDICTED: phosphoinositide phospholipase C ...    360   3e-117   Glycine max [soybeans]
ref|XP_004500490.1|  PREDICTED: phosphoinositide phospholipase C ...    360   3e-117   Cicer arietinum [garbanzo]
ref|XP_004500491.1|  PREDICTED: phosphoinositide phospholipase C ...    360   4e-117   Cicer arietinum [garbanzo]
ref|XP_009586601.1|  PREDICTED: phosphoinositide phospholipase C ...    358   5e-117   Nicotiana tomentosiformis
ref|XP_009586600.1|  PREDICTED: phosphoinositide phospholipase C ...    358   5e-117   Nicotiana tomentosiformis
ref|NP_001234176.1|  PI-phospholipase C PLC5                            359   5e-117   
ref|XP_009783480.1|  PREDICTED: phosphoinositide phospholipase C ...    358   5e-117   Nicotiana sylvestris
ref|XP_010535516.1|  PREDICTED: phosphoinositide phospholipase C ...    359   5e-117   Tarenaya hassleriana [spider flower]
ref|XP_002533649.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    360   6e-117   Ricinus communis
ref|XP_009783481.1|  PREDICTED: phosphoinositide phospholipase C ...    358   6e-117   Nicotiana sylvestris
ref|XP_007008969.1|  Phosphoinositide-specific phospholipase C fa...    359   7e-117   
ref|XP_009783482.1|  PREDICTED: phosphoinositide phospholipase C ...    358   7e-117   Nicotiana sylvestris
emb|CDP06481.1|  unnamed protein product                                359   8e-117   Coffea canephora [robusta coffee]
ref|XP_008369255.1|  PREDICTED: phosphoinositide phospholipase C ...    359   9e-117   Malus domestica [apple tree]
ref|XP_008369254.1|  PREDICTED: phosphoinositide phospholipase C ...    359   9e-117   Malus domestica [apple tree]
ref|XP_003600780.1|  Phosphoinositide phospholipase C                   358   1e-116   Medicago truncatula
gb|ABF95389.1|  phosphoinositide-specific phospholipase C, putati...    355   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010031218.1|  PREDICTED: phosphoinositide phospholipase C ...    354   2e-116   Eucalyptus grandis [rose gum]
emb|CDP14020.1|  unnamed protein product                                358   2e-116   Coffea canephora [robusta coffee]
ref|XP_011084908.1|  PREDICTED: phosphoinositide phospholipase C 6      357   2e-116   Sesamum indicum [beniseed]
gb|KDO68972.1|  hypothetical protein CISIN_1g007399mg                   358   3e-116   Citrus sinensis [apfelsine]
dbj|BAJ91552.1|  predicted protein                                      357   3e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG08567.1|  Phosphoinositide phospholipase C 6 -like protein        357   3e-116   Gossypium arboreum [tree cotton]
ref|XP_009147001.1|  PREDICTED: phosphoinositide phospholipase C 2      357   3e-116   Brassica rapa
gb|KJB67581.1|  hypothetical protein B456_010G198000                    358   3e-116   Gossypium raimondii
gb|KJB67580.1|  hypothetical protein B456_010G198000                    357   3e-116   Gossypium raimondii
ref|XP_007218974.1|  hypothetical protein PRUPE_ppa003890mg             356   3e-116   
emb|CDY27998.1|  BnaC05g44000D                                          356   4e-116   Brassica napus [oilseed rape]
ref|XP_009612249.1|  PREDICTED: phosphoinositide phospholipase C ...    357   4e-116   Nicotiana tomentosiformis
emb|CDY20520.1|  BnaC04g05240D                                          358   4e-116   Brassica napus [oilseed rape]
gb|KFK38259.1|  phosphoinositide phospholipase c 2                      357   4e-116   Arabis alpina [alpine rockcress]
ref|NP_001275298.1|  phosphoinositide phospholipase C 2-like            357   4e-116   Solanum tuberosum [potatoes]
emb|CDY35983.1|  BnaA05g29670D                                          357   5e-116   Brassica napus [oilseed rape]
ref|XP_006664643.1|  PREDICTED: phosphoinositide phospholipase C ...    356   5e-116   
ref|NP_001234197.1|  PI-phospholipase C PLC2                            356   5e-116   Solanum lycopersicum
ref|XP_009385549.1|  PREDICTED: phosphoinositide phospholipase C ...    356   5e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU22355.1|  hypothetical protein MIMGU_mgv1a003318mg                357   5e-116   Erythranthe guttata [common monkey flower]
emb|CDY07623.1|  BnaA03g18880D                                          357   5e-116   Brassica napus [oilseed rape]
ref|XP_010322097.1|  PREDICTED: PI-phospholipase C PLC2 isoform X1      356   5e-116   
ref|XP_009766854.1|  PREDICTED: phosphoinositide phospholipase C ...    353   6e-116   Nicotiana sylvestris
gb|AIU41540.1|  phosphatidylinositol phospholipase C 7                  357   6e-116   Solanum lycopersicum
ref|XP_009369166.1|  PREDICTED: phosphoinositide phospholipase C ...    357   7e-116   Pyrus x bretschneideri [bai li]
ref|XP_009369167.1|  PREDICTED: phosphoinositide phospholipase C ...    357   7e-116   Pyrus x bretschneideri [bai li]
emb|CDY60344.1|  BnaC03g72360D                                          357   7e-116   Brassica napus [oilseed rape]
ref|XP_009586599.1|  PREDICTED: phosphoinositide phospholipase C ...    356   8e-116   Nicotiana tomentosiformis
dbj|BAE71237.1|  putative phosphoinositide specific phospholipase C     357   8e-116   Trifolium pratense [peavine clover]
gb|AIG51130.1|  phospholipase C                                         356   9e-116   Gossypium hirsutum [American cotton]
ref|NP_187464.1|  phosphoinositide phospholipase C 2                    356   9e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123935.1|  PREDICTED: phosphoinositide phospholipase C 2      355   1e-115   Brassica rapa
emb|CDY22153.1|  BnaC01g39480D                                          355   1e-115   Brassica napus [oilseed rape]
ref|XP_010106260.1|  Phosphoinositide phospholipase C 6                 356   2e-115   Morus notabilis
ref|NP_001234203.1|  PI-phospholipase C PLC1                            355   2e-115   Solanum lycopersicum
ref|XP_004138421.1|  PREDICTED: phosphoinositide phospholipase C ...    355   2e-115   Cucumis sativus [cucumbers]
gb|AAF33823.1|AF223351_1  phospholipase C1                              355   3e-115   Nicotiana tabacum [American tobacco]
ref|NP_001049792.2|  Os03g0289300                                       355   3e-115   
gb|AAD26119.1|AF108123_1  phosphoinositide-specific phospholipase C     354   3e-115   Brassica napus [oilseed rape]
ref|XP_010233537.1|  PREDICTED: phosphoinositide phospholipase C ...    355   3e-115   Brachypodium distachyon [annual false brome]
ref|XP_003562396.1|  PREDICTED: phosphoinositide phospholipase C ...    355   3e-115   Brachypodium distachyon [annual false brome]
ref|XP_006435739.1|  hypothetical protein CICLE_v10031019mg             355   4e-115   Citrus clementina [clementine]
ref|XP_003579061.1|  PREDICTED: phosphoinositide phospholipase C ...    354   4e-115   Brachypodium distachyon [annual false brome]
gb|EAY83519.1|  hypothetical protein OsI_38731                          354   4e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_002884682.1|  predicted protein                                  353   4e-115   
emb|CDY61706.1|  BnaC04g56690D                                          355   4e-115   Brassica napus [oilseed rape]
ref|XP_010031216.1|  PREDICTED: phosphoinositide phospholipase C ...    355   5e-115   Eucalyptus grandis [rose gum]
gb|ABA98951.2|  phospholipase C, putative, expressed                    354   5e-115   Oryza sativa Japonica Group [Japonica rice]
gb|KJB67579.1|  hypothetical protein B456_010G197900                    354   5e-115   Gossypium raimondii
ref|XP_006297293.1|  hypothetical protein CARUB_v10013310mg             354   5e-115   Capsella rubella
ref|XP_010031217.1|  PREDICTED: phosphoinositide phospholipase C ...    354   5e-115   Eucalyptus grandis [rose gum]
gb|AAF33824.1|AF223573_1  phospholipase C2                              354   6e-115   Nicotiana tabacum [American tobacco]
ref|XP_006407765.1|  hypothetical protein EUTSA_v10020359mg             354   6e-115   Eutrema salsugineum [saltwater cress]
ref|XP_010685546.1|  PREDICTED: phosphoinositide phospholipase C ...    353   7e-115   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG13942.1|  Phosphoinositide phospholipase C 2 -like protein        353   8e-115   Gossypium arboreum [tree cotton]
gb|EEE58849.1|  hypothetical protein OsJ_10440                          355   1e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75018.1|  hypothetical protein OsI_11098                          355   1e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_010689668.1|  PREDICTED: phosphoinositide phospholipase C 6      353   1e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002526337.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    352   1e-114   
ref|XP_010464460.1|  PREDICTED: phosphoinositide phospholipase C ...    353   1e-114   Camelina sativa [gold-of-pleasure]
gb|AES99591.2|  phosphoinositide-specific phospholipase C family ...    353   1e-114   Medicago truncatula
ref|XP_002442641.1|  hypothetical protein SORBIDRAFT_08g000360          353   1e-114   
ref|XP_010461812.1|  PREDICTED: phosphoinositide phospholipase C 2      353   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010067519.1|  PREDICTED: phosphoinositide phospholipase C ...    353   2e-114   Eucalyptus grandis [rose gum]
gb|AAW22879.1|  putative phospholipase C                                352   3e-114   Solanum lycopersicum
ref|XP_010486390.1|  PREDICTED: phosphoinositide phospholipase C ...    352   3e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010486391.1|  PREDICTED: phosphoinositide phospholipase C ...    352   3e-114   Camelina sativa [gold-of-pleasure]
gb|AAW22878.1|  putative phospholipase C                                352   4e-114   Solanum lycopersicum
emb|CDY07057.1|  BnaA04g22580D                                          352   4e-114   
ref|XP_004978423.1|  PREDICTED: phosphoinositide phospholipase C ...    352   5e-114   
ref|XP_009794867.1|  PREDICTED: phosphoinositide phospholipase C ...    352   5e-114   Nicotiana sylvestris
gb|KJB55726.1|  hypothetical protein B456_009G091700                    352   5e-114   Gossypium raimondii
ref|XP_006356459.1|  PREDICTED: phosphoinositide phospholipase C ...    360   5e-114   Solanum tuberosum [potatoes]
gb|EYU26667.1|  hypothetical protein MIMGU_mgv1a003464mg                351   7e-114   
gb|KCW50478.1|  hypothetical protein EUGRSUZ_J00208                     351   8e-114   
ref|XP_006649906.1|  PREDICTED: phosphoinositide phospholipase C ...    351   8e-114   
ref|XP_010318244.1|  PREDICTED: phosphoinositide phospholipase C ...    359   8e-114   
ref|XP_008666225.1|  PREDICTED: phosphoinositide phospholipase C ...    347   9e-114   
ref|XP_010031215.1|  PREDICTED: phosphoinositide phospholipase C ...    348   9e-114   
ref|NP_001235296.1|  phosphoinositide-specific phospholipase C P12      349   2e-113   
gb|EEC82741.1|  hypothetical protein OsI_27447                          350   2e-113   
gb|EYU20013.1|  hypothetical protein MIMGU_mgv1a0236392mg               344   3e-113   
ref|XP_008441466.1|  PREDICTED: phosphoinositide phospholipase C 6      350   3e-113   
emb|CAC13988.1|  phosphoinositide-specific phospholipase C              350   4e-113   
emb|CDX74806.1|  BnaA05g05520D                                          349   5e-113   
gb|AAK01711.1|AF332874_1  phosphoinositide-specific phospholipase C     349   5e-113   
gb|KHN20846.1|  Phosphoinositide phospholipase C 6                      349   5e-113   
ref|XP_011469919.1|  PREDICTED: phosphoinositide phospholipase C ...    349   5e-113   
ref|XP_011469918.1|  PREDICTED: phosphoinositide phospholipase C ...    349   6e-113   
ref|XP_004977637.1|  PREDICTED: phosphoinositide phospholipase C ...    349   6e-113   
ref|NP_001060735.1|  Os07g0694000                                       349   7e-113   
ref|XP_009783759.1|  PREDICTED: phosphoinositide phospholipase C ...    357   8e-113   
gb|ACG25330.1|  phospholipase C                                         348   1e-112   
ref|XP_008645133.1|  PREDICTED: phosphoinositide phospholipase C ...    348   1e-112   
ref|XP_010031214.1|  PREDICTED: phosphoinositide phospholipase C ...    348   1e-112   
gb|AFW69669.1|  phospholipase                                           348   2e-112   
ref|XP_004170339.1|  PREDICTED: phosphoinositide phospholipase C ...    344   2e-112   
gb|ACF87551.1|  unknown                                                 346   2e-112   
ref|XP_003558159.2|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    350   3e-112   
ref|XP_008369253.1|  PREDICTED: phosphoinositide phospholipase C ...    346   5e-112   
ref|XP_009369165.1|  PREDICTED: phosphoinositide phospholipase C ...    346   5e-112   
ref|XP_010922548.1|  PREDICTED: phosphoinositide phospholipase C ...    346   6e-112   
ref|XP_008457370.1|  PREDICTED: phosphoinositide phospholipase C ...    345   8e-112   
tpg|DAA44847.1|  TPA: hypothetical protein ZEAMMB73_367335              346   9e-112   
ref|XP_010031224.1|  PREDICTED: phosphoinositide phospholipase C 6      346   9e-112   
ref|XP_008457371.1|  PREDICTED: phosphoinositide phospholipase C ...    345   1e-111   
gb|KCW50476.1|  hypothetical protein EUGRSUZ_J00207                     345   2e-111   
ref|XP_010253909.1|  PREDICTED: phosphoinositide phospholipase C ...    344   2e-111   
gb|EMS61451.1|  Phosphoinositide phospholipase C 2                      346   2e-111   
ref|XP_010253908.1|  PREDICTED: phosphoinositide phospholipase C ...    344   2e-111   
gb|KGN65808.1|  hypothetical protein Csa_1G531180                       344   3e-111   
ref|XP_004153207.1|  PREDICTED: phosphoinositide phospholipase C ...    344   3e-111   
ref|NP_001105254.1|  phospholipase C                                    344   3e-111   
gb|EMT28639.1|  Phosphoinositide phospholipase C 4                      345   5e-111   
ref|XP_009380684.1|  PREDICTED: phosphoinositide phospholipase C ...    342   6e-111   
gb|AAQ95731.1|  phospholipase C                                         339   7e-111   
gb|ABR16641.1|  unknown                                                 343   8e-111   
ref|XP_006575538.1|  PREDICTED: phosphoinositide phospholipase C ...    343   1e-110   
gb|ABR16299.1|  unknown                                                 343   1e-110   
ref|XP_002468043.1|  hypothetical protein SORBIDRAFT_01g038540          343   1e-110   
gb|KHN48565.1|  Phosphoinositide phospholipase C 6                      343   2e-110   
ref|XP_008805492.1|  PREDICTED: phosphoinositide phospholipase C ...    338   2e-110   
emb|CBI22792.3|  unnamed protein product                                340   4e-110   
ref|XP_010653296.1|  PREDICTED: phosphoinositide phospholipase C ...    340   5e-110   
ref|XP_011076690.1|  PREDICTED: phosphoinositide phospholipase C ...    341   5e-110   
ref|XP_004490993.1|  PREDICTED: phosphoinositide phospholipase C ...    341   9e-110   
ref|XP_003616633.1|  Phosphoinositide phospholipase C                   340   3e-109   
ref|XP_009344925.1|  PREDICTED: phosphoinositide phospholipase C ...    338   5e-109   
ref|XP_006403400.1|  hypothetical protein EUTSA_v10010330mg             334   1e-108   
ref|XP_010535381.1|  PREDICTED: phosphoinositide phospholipase C ...    335   1e-108   
ref|XP_006488532.1|  PREDICTED: phosphoinositide phospholipase C ...    338   1e-108   
gb|KHN36374.1|  Phosphoinositide phospholipase C 6                      337   1e-108   
ref|XP_006601952.1|  PREDICTED: phosphoinositide phospholipase C ...    337   1e-108   
ref|XP_003552358.1|  PREDICTED: phosphoinositide phospholipase C ...    337   1e-108   
ref|XP_006425074.1|  hypothetical protein CICLE_v10028054mg             338   2e-108   
gb|KHN34718.1|  Phosphoinositide phospholipase C 6                      336   2e-108   
ref|XP_002876343.1|  hypothetical protein ARALYDRAFT_486035             337   2e-108   
gb|KFK34832.1|  hypothetical protein AALP_AA5G198900                    337   2e-108   
ref|XP_009142132.1|  PREDICTED: phosphoinositide phospholipase C ...    337   2e-108   
emb|CDX72188.1|  BnaC08g26860D                                          337   2e-108   
gb|AAB41107.1|  phosphoinositide-specific phospholipase C               335   3e-108   
gb|KDO66896.1|  hypothetical protein CISIN_1g007473mg                   337   4e-108   
ref|XP_004145255.1|  PREDICTED: phosphoinositide phospholipase C ...    336   4e-108   
emb|CDY01144.1|  BnaA04g06750D                                          333   4e-108   
ref|XP_003538468.2|  PREDICTED: phosphoinositide phospholipase C ...    337   5e-108   
ref|XP_006290813.1|  hypothetical protein CARUB_v10016918mg             336   7e-108   
ref|XP_010535374.1|  PREDICTED: phosphoinositide phospholipase C ...    335   7e-108   
ref|NP_191153.1|  phosphoinositide phospholipase C 7                    335   8e-108   
emb|CDY70294.1|  BnaCnng67650D                                          334   1e-107   
ref|XP_007205014.1|  hypothetical protein PRUPE_ppa003685mg             334   1e-107   
ref|XP_007163544.1|  hypothetical protein PHAVU_001G243200g             334   1e-107   
ref|XP_007163545.1|  hypothetical protein PHAVU_001G243200g             333   2e-107   
ref|XP_008220880.1|  PREDICTED: phosphoinositide phospholipase C ...    334   2e-107   
ref|XP_008220872.1|  PREDICTED: phosphoinositide phospholipase C ...    334   2e-107   
ref|XP_009347255.1|  PREDICTED: phosphoinositide phospholipase C ...    334   2e-107   
ref|XP_009139611.1|  PREDICTED: phosphoinositide phospholipase C ...    334   2e-107   
ref|XP_010650898.1|  PREDICTED: phosphoinositide phospholipase C 2      335   3e-107   
gb|KCW52484.1|  hypothetical protein EUGRSUZ_J01884                     330   4e-107   
emb|CDY47356.1|  BnaCnng14930D                                          333   6e-107   
ref|XP_009120384.1|  PREDICTED: phosphoinositide phospholipase C 5      333   8e-107   
ref|XP_009116286.1|  PREDICTED: phosphoinositide phospholipase C 7      333   8e-107   
emb|CDY27254.1|  BnaA09g35480D                                          333   8e-107   
ref|XP_006401053.1|  hypothetical protein EUTSA_v10013061mg             333   1e-106   
emb|CDY52121.1|  BnaA10g29500D                                          332   1e-106   
ref|XP_010427395.1|  PREDICTED: phosphoinositide phospholipase C 7      332   2e-106   
tpg|DAA44843.1|  TPA: rhodanese-like family protein                     336   6e-106   
emb|CDX80342.1|  BnaC09g34000D                                          331   7e-106   
ref|XP_010516186.1|  PREDICTED: phosphoinositide phospholipase C ...    330   8e-106   
ref|XP_010516185.1|  PREDICTED: phosphoinositide phospholipase C ...    330   8e-106   
ref|XP_010032978.1|  PREDICTED: phosphoinositide phospholipase C ...    329   1e-105   
ref|NP_200677.2|  phosphoinositide phospholipase C 5                    329   2e-105   
emb|CBI15948.3|  unnamed protein product                                332   2e-105   
ref|XP_011043779.1|  PREDICTED: phosphoinositide phospholipase C ...    328   3e-105   
ref|XP_011043778.1|  PREDICTED: phosphoinositide phospholipase C ...    328   4e-105   
ref|XP_011043777.1|  PREDICTED: phosphoinositide phospholipase C ...    328   4e-105   
gb|KJB74323.1|  hypothetical protein B456_011G288000                    327   6e-105   
gb|EPS71356.1|  hypothetical protein M569_03403                         328   7e-105   
ref|XP_011460955.1|  PREDICTED: phosphoinositide phospholipase C 2      327   7e-105   
ref|XP_010454096.1|  PREDICTED: phosphoinositide phospholipase C ...    327   1e-104   
ref|XP_008384797.1|  PREDICTED: phosphoinositide phospholipase C ...    326   2e-104   
ref|XP_010454105.1|  PREDICTED: phosphoinositide phospholipase C ...    327   2e-104   
ref|XP_010483470.1|  PREDICTED: phosphoinositide phospholipase C ...    327   2e-104   
ref|XP_006280227.1|  hypothetical protein CARUB_v10026144mg             327   2e-104   
gb|EPS72762.1|  hypothetical protein M569_01992                         326   3e-104   
gb|KDP44118.1|  hypothetical protein JCGZ_05585                         325   4e-104   
ref|XP_010443613.1|  PREDICTED: phosphoinositide phospholipase C ...    325   7e-104   
gb|AFY98823.1|  phospholipase C                                         324   1e-103   
ref|XP_010032979.1|  PREDICTED: phosphoinositide phospholipase C 2      325   1e-103   
ref|XP_002299804.2|  hypothetical protein POPTR_0001s25930g             325   2e-103   
ref|XP_007141767.1|  hypothetical protein PHAVU_008G224100g             324   2e-103   
gb|EMT03430.1|  Phosphoinositide phospholipase C 6                      337   6e-103   
ref|XP_010685543.1|  PREDICTED: phosphoinositide phospholipase C ...    322   6e-103   
ref|XP_007016093.1|  Phospholipase C 2, putative                        323   7e-103   
gb|EMS57551.1|  Phosphoinositide phospholipase C 6                      333   1e-102   
gb|KDP46488.1|  hypothetical protein JCGZ_08460                         321   3e-102   
ref|XP_004307643.1|  PREDICTED: phosphoinositide phospholipase C 6      322   6e-102   
gb|KHG10597.1|  Phosphoinositide phospholipase C 2 -like protein        319   9e-102   
ref|XP_003544293.1|  PREDICTED: phosphoinositide phospholipase C ...    320   9e-102   
gb|KCW52486.1|  hypothetical protein EUGRSUZ_J01885                     319   2e-101   
ref|XP_010032977.1|  PREDICTED: phosphoinositide phospholipase C ...    318   2e-101   
ref|XP_003569051.1|  PREDICTED: phosphoinositide phospholipase C ...    319   4e-101   
ref|XP_003616632.1|  Phosphoinositide phospholipase C                   319   5e-101   
ref|XP_002866285.1|  predicted protein                                  317   5e-101   
ref|NP_001067028.1|  Os12g0562400                                       303   1e-100   
gb|KJB55725.1|  hypothetical protein B456_009G091600                    316   2e-100   
gb|ADR00312.1|  phosphoinositide-specific phospholipase C2              317   2e-100   
gb|EEC78444.1|  hypothetical protein OsI_18294                          317   2e-100   
gb|EMT14267.1|  Phosphoinositide phospholipase C 2                      316   4e-100   
dbj|BAK03802.1|  predicted protein                                      315   7e-100   
dbj|BAJ96221.1|  predicted protein                                      314   1e-99    
ref|NP_001054531.1|  Os05g0127200                                       314   2e-99    
ref|XP_010685544.1|  PREDICTED: phosphoinositide phospholipase C ...    312   4e-99    
ref|XP_003600903.1|  Phosphoinositide phospholipase C                   311   3e-98    
ref|XP_010541457.1|  PREDICTED: phosphoinositide phospholipase C ...    311   3e-98    
ref|XP_004960369.1|  PREDICTED: phosphoinositide phospholipase C ...    311   4e-98    
ref|XP_010541455.1|  PREDICTED: phosphoinositide phospholipase C ...    311   4e-98    
gb|KEH34793.1|  phosphoinositide-specific phospholipase C family ...    305   4e-98    
ref|XP_010541456.1|  PREDICTED: phosphoinositide phospholipase C ...    310   4e-98    
gb|KFK27408.1|  hypothetical protein AALP_AA8G379100                    310   5e-98    
ref|XP_004490990.1|  PREDICTED: phosphoinositide phospholipase C ...    310   7e-98    
gb|AAM61037.1|  unknown                                                 295   2e-97    
ref|XP_004500489.1|  PREDICTED: phosphoinositide phospholipase C ...    308   3e-97    
ref|XP_010505720.1|  PREDICTED: phosphoinositide phospholipase C ...    294   7e-97    
ref|XP_006425075.1|  hypothetical protein CICLE_v10028087mg             307   8e-97    
ref|NP_001130835.1|  uncharacterized protein LOC100191939               298   8e-97    
emb|CDY61028.1|  BnaAnng17370D                                          308   9e-97    
ref|XP_006654000.1|  PREDICTED: phosphoinositide phospholipase C ...    306   1e-96    
ref|XP_009132032.1|  PREDICTED: phosphoinositide phospholipase C ...    306   1e-96    
ref|NP_001108119.1|  phosphoinositide-specific phospholipase C          306   1e-96    
ref|XP_006488536.1|  PREDICTED: phosphoinositide phospholipase C ...    306   1e-96    
ref|NP_568881.1|  phosphoinositide phospholipase C 1                    306   1e-96    
ref|XP_006488535.1|  PREDICTED: phosphoinositide phospholipase C ...    306   1e-96    
gb|AAC05023.1|  phosphoinositol-specific phospholipase C delta          306   1e-96    
emb|CDX71156.1|  BnaC03g12400D                                          307   1e-96    
ref|XP_003600894.1|  Phosphoinositide phospholipase C                   306   2e-96    
ref|XP_006843549.1|  hypothetical protein AMTR_s00007p00067740          306   3e-96    
ref|XP_006401054.1|  hypothetical protein EUTSA_v10013134mg             305   3e-96    
ref|XP_010454072.1|  PREDICTED: phosphoinositide phospholipase C ...    305   3e-96    
ref|XP_002866283.1|  ATPLC1                                             305   3e-96    
emb|CAN62452.1|  hypothetical protein VITISV_032539                     305   5e-96    
ref|XP_006280254.1|  hypothetical protein CARUB_v10026170mg             304   6e-96    
ref|XP_010483467.1|  PREDICTED: phosphoinositide phospholipase C 1      303   1e-95    
gb|KHG11557.1|  Phosphoinositide phospholipase C 2 -like protein        303   1e-95    
ref|XP_003518307.2|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    301   2e-95    
ref|XP_009120383.1|  PREDICTED: phosphoinositide phospholipase C 1      303   2e-95    
ref|XP_004490601.1|  PREDICTED: phosphoinositide phospholipase C ...    303   2e-95    
dbj|BAA97337.1|  phosphoinositide-specific phospholipase C-line         311   2e-95    
gb|EMS52842.1|  Phosphoinositide phospholipase C 7                      302   3e-95    
ref|XP_010443612.1|  PREDICTED: phosphoinositide phospholipase C ...    302   3e-95    
gb|AFW88328.1|  hypothetical protein ZEAMMB73_233763                    301   4e-94    
ref|XP_008658028.1|  PREDICTED: uncharacterized protein LOC100191...    300   5e-94    
ref|XP_006350841.1|  PREDICTED: phosphoinositide phospholipase C ...    299   7e-94    
ref|XP_008658027.1|  PREDICTED: uncharacterized protein LOC100191...    301   8e-94    
gb|ACL53796.1|  unknown                                                 301   9e-94    
ref|XP_009610392.1|  PREDICTED: phosphoinositide phospholipase C ...    298   1e-93    
gb|KDO68970.1|  hypothetical protein CISIN_1g007399mg                   298   1e-93    
ref|XP_002525653.1|  1-phosphatidylinositol-4,5-bisphosphate phos...    298   2e-93    
ref|XP_002439212.1|  hypothetical protein SORBIDRAFT_09g002320          298   5e-93    
ref|XP_010323007.1|  PREDICTED: PI-phospholipase C PLC6 isoform X3      296   5e-93    
tpg|DAA46574.1|  TPA: hypothetical protein ZEAMMB73_610036              283   1e-92    
ref|XP_006437477.1|  hypothetical protein CICLE_v10030935mg             298   1e-92    
ref|XP_007163543.1|  hypothetical protein PHAVU_001G243100g             298   1e-92    
ref|XP_006484628.1|  PREDICTED: phosphoinositide phospholipase C ...    298   1e-92    
ref|NP_001234284.1|  PI-phospholipase C PLC6                            295   2e-92    
ref|XP_010323005.1|  PREDICTED: PI-phospholipase C PLC6 isoform X1      295   2e-92    
gb|KHN34719.1|  Phosphoinositide phospholipase C 6                      296   2e-92    
ref|XP_010323006.1|  PREDICTED: PI-phospholipase C PLC6 isoform X2      295   2e-92    
ref|XP_006601953.1|  PREDICTED: phosphoinositide phospholipase C ...    296   4e-92    
ref|XP_007142207.1|  hypothetical protein PHAVU_008G261100g             295   9e-92    
ref|XP_003615686.1|  Phosphoinositide phospholipase C                   294   9e-92    
ref|XP_009610393.1|  PREDICTED: phosphoinositide phospholipase C ...    291   3e-91    
ref|XP_009610391.1|  PREDICTED: phosphoinositide phospholipase C ...    291   4e-91    
ref|XP_009385551.1|  PREDICTED: phosphoinositide phospholipase C ...    290   6e-91    
gb|KDP46489.1|  hypothetical protein JCGZ_08461                         290   8e-91    
emb|CDY65008.1|  BnaA06g40830D                                          284   8e-91    
emb|CDX80344.1|  BnaC09g33980D                                          291   8e-91    
emb|CBI25477.3|  unnamed protein product                                289   1e-90    
ref|XP_009768994.1|  PREDICTED: phosphoinositide phospholipase C ...    289   1e-90    
ref|NP_001154596.1|  phosphoinositide phospholipase C 2                 290   2e-90    
emb|CDY52120.1|  BnaA10g29490D                                          290   2e-90    
ref|XP_009768988.1|  PREDICTED: phosphoinositide phospholipase C ...    289   3e-90    
gb|KHN20848.1|  Phosphoinositide phospholipase C 6                      284   1e-89    
ref|XP_008457368.1|  PREDICTED: phosphoinositide phospholipase C ...    287   2e-89    
ref|XP_004490991.1|  PREDICTED: phosphoinositide phospholipase C ...    288   3e-89    
gb|KFK30454.1|  hypothetical protein AALP_AA7G263300                    286   5e-89    
gb|AFN53699.1|  hypothetical protein                                    292   5e-89    
ref|XP_010446364.1|  PREDICTED: phosphoinositide phospholipase C ...    286   6e-89    
ref|XP_010431796.1|  PREDICTED: phosphoinositide phospholipase C ...    284   9e-89    
emb|CAB37509.1|  phosphoinositide-specific phospholipase C              285   1e-88    
ref|XP_002866805.1|  ATPLC1                                             286   1e-88    
ref|XP_002314099.2|  hypothetical protein POPTR_0009s05130g             286   1e-88    
ref|XP_009101938.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    285   1e-88    
ref|XP_002983412.1|  hypothetical protein SELMODRAFT_180165             286   1e-88    
ref|NP_195565.2|  putative phosphoinositide phospholipase C 3           285   3e-88    



>ref|XP_009790378.1| PREDICTED: phosphoinositide phospholipase C 4 [Nicotiana sylvestris]
Length=588

 Score =   423 bits (1088),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFRSN
Sbjct  368  TEIVRFTQRNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFRSN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+NVGPN EVF+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFLLNVGPNNEVFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADELMKKTKAKEDKWTPVWDEEFTFPLTVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTC+PV+EL+PGI AVPLCDRKGEKY+S RLLMRFEFV
Sbjct  548  FAGQTCIPVSELKPGIHAVPLCDRKGEKYSSARLLMRFEFV  588



>emb|CAA72681.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Nicotiana 
rustica]
Length=588

 Score =   422 bits (1085),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFRSN
Sbjct  368  TEIVRFTQRNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFRSN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+NVGPN EVF+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFLLNVGPNNEVFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED WTPVW E F FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADEIMKKTKTKEDKWTPVWDEAFTFPLTVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTC+P++EL+PGI AVPLCDRKGEKY+SVRLLMRFEFV
Sbjct  548  FAGQTCIPISELKPGIHAVPLCDRKGEKYSSVRLLMRFEFV  588



>emb|CAA65127.1| phosphoinositide-specific phospholipase C [Nicotiana rustica]
Length=588

 Score =   421 bits (1081),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMF SN
Sbjct  368  TEIVRFTQRNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFSSN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+NVGPN EVF+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFLLNVGPNNEVFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADEIMKKTKTKEDKWTPVWDEEFTFPLTVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTC+PV+EL+PGI AVPLCDRKGEKY+S RLLMRFEF+
Sbjct  548  FAGQTCIPVSELKPGIHAVPLCDRKGEKYSSARLLMRFEFI  588



>gb|KJB35244.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=375

 Score =   413 bits (1061),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR LWLM GMFRSN
Sbjct  155  TDVVRFTQKNILRIYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRYLWLMHGMFRSN  214

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV PN  VFNPK  L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  215  GGCGYVKKPDFLMNVNPNGSVFNPKADLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  274

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF+FPL VPELALLR+EVHE+D+SE+DD
Sbjct  275  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWDEEFVFPLRVPELALLRVEVHEYDMSERDD  334

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL +RKGEK+NSVRLLMRFEF+
Sbjct  335  FAGQTCLPVSELKPGIRAVPLFNRKGEKFNSVRLLMRFEFI  375



>ref|NP_001234181.1| PI-phospholipase C PLC4 [Solanum lycopersicum]
 gb|ABW81000.1| PI-phospholipase C PLC4 [Solanum lycopersicum]
Length=587

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFR+N
Sbjct  367  TDIVRFTQRNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFRAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+++GPN EVF+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  427  GGCGYVKKPDFLLSIGPNNEVFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADEVMKKTK KED WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADEVMKKTKTKEDKWTPVWDEEFTFPLTVPELALLRIEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTC+PV+EL+PGI AVPLC+RKGE YNS RLLMRFEF+
Sbjct  547  FAGQTCIPVSELKPGIHAVPLCNRKGEIYNSARLLMRFEFI  587



>ref|XP_009622729.1| PREDICTED: phosphoinositide phospholipase C 4-like [Nicotiana 
tomentosiformis]
 gb|ABP57375.1| phosphoinositide-specific phospholipase C [Nicotiana tabacum]
Length=588

 Score =   418 bits (1074),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFRSN
Sbjct  368  TEIVRFTQRNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFRSN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+NVGPN EVF+PK +L VK TLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFLLNVGPNNEVFDPKAKLPVKITLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED WTPVW EEF FPLTVPELALLRIE HE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADEIMKKTKTKEDKWTPVWDEEFTFPLTVPELALLRIEAHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTC+P++EL+PGI AVPLCDRKGEK++S RLLMRFEFV
Sbjct  548  FAGQTCIPISELKPGIHAVPLCDRKGEKFSSARLLMRFEFV  588



>gb|KJB35243.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=482

 Score =   414 bits (1064),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR LWLM GMFRSN
Sbjct  262  TDVVRFTQKNILRIYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRYLWLMHGMFRSN  321

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV PN  VFNPK  L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  322  GGCGYVKKPDFLMNVNPNGSVFNPKADLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  381

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF+FPL VPELALLR+EVHE+D+SE+DD
Sbjct  382  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWDEEFVFPLRVPELALLRVEVHEYDMSERDD  441

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL +RKGEK+NSVRLLMRFEF+
Sbjct  442  FAGQTCLPVSELKPGIRAVPLFNRKGEKFNSVRLLMRFEFI  482



>ref|XP_006344048.1| PREDICTED: phosphoinositide phospholipase C 4-like [Solanum tuberosum]
Length=587

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMF++N
Sbjct  367  TEIVRFTQRNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFKAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L++VGPN EVF+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  427  GGCGYVKKPDFLLSVGPNNEVFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADEIMKKTKTKEDIWTPVWDEEFTFPLTVPELALLRIEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTC+PV+EL+PGI  VPLC+RKGEKYNS RLLMRFEFV
Sbjct  547  FAGQTCIPVSELKPGIHTVPLCNRKGEKYNSARLLMRFEFV  587



>gb|KJB35242.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=591

 Score =   414 bits (1064),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGR LWLM GMFRSN
Sbjct  371  TDVVRFTQKNILRIYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRYLWLMHGMFRSN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV PN  VFNPK  L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  431  GGCGYVKKPDFLMNVNPNGSVFNPKADLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF+FPL VPELALLR+EVHE+D+SE+DD
Sbjct  491  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWDEEFVFPLRVPELALLRVEVHEYDMSERDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL +RKGEK+NSVRLLMRFEF+
Sbjct  551  FAGQTCLPVSELKPGIRAVPLFNRKGEKFNSVRLLMRFEFI  591



>ref|XP_007016097.1| Phosphatidylinositol-speciwc phospholipase C4 [Theobroma cacao]
 gb|EOY33716.1| Phosphatidylinositol-speciwc phospholipase C4 [Theobroma cacao]
Length=591

 Score =   414 bits (1064),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ N LR+YPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLM GMFRSN
Sbjct  371  TDVVRFTQKNFLRIYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRSN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ LMNV P+ +VF+PK +L VKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD
Sbjct  431  GGCGYVKKPEFLMNVDPDGQVFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVP DE+MKKTK KED+WTPVW EEF  PLTVPELALLR+EVHE+D+SEKDD
Sbjct  491  FYTRVGIAGVPDDEIMKKTKKKEDDWTPVWDEEFALPLTVPELALLRVEVHEYDMSEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL DRKGEK NSVRLLMRFEFV
Sbjct  551  FAGQTCLPVSELKPGIRAVPLFDRKGEKLNSVRLLMRFEFV  591



>gb|KHG04158.1| Phosphoinositide phospholipase C 4 -like protein [Gossypium arboreum]
Length=591

 Score =   411 bits (1056),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTRFNSSNYKPLIGWM GAQMVAFNMQGYGR LWLM GMFRSN
Sbjct  371  TDVVRFTQKNILRIYPKGTRFNSSNYKPLIGWMLGAQMVAFNMQGYGRYLWLMHGMFRSN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV PN  VFNPK  L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  431  GGCGYVKKPDFLMNVNPNGSVFNPKADLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF FPL VPELALLR+EVHE+D+SEKDD
Sbjct  491  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWDEEFAFPLRVPELALLRVEVHEYDMSEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL +RKGEK+NSVRLLMRFEF+
Sbjct  551  FAGQTCLPVSELKPGIRAVPLFNRKGEKFNSVRLLMRFEFI  591



>ref|XP_006425071.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 ref|XP_006425072.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 gb|ESR38311.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 gb|ESR38312.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
Length=586

 Score =   408 bits (1049),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILR+YPKGTRF SSNYKPL+GWMHG QMVAFNMQGYGR++WLM GMFRSN
Sbjct  366  TDLVRFTQKNILRIYPKGTRFTSSNYKPLVGWMHGTQMVAFNMQGYGRAMWLMHGMFRSN  425

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPDLLMNVGP+ +VFNPK  L VKKTLK+KVYMGDGWHLDFKQTHFD YSPPD
Sbjct  426  GGCGYVKKPDLLMNVGPDGQVFNPKETLPVKKTLKIKVYMGDGWHLDFKQTHFDLYSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAGVPAD++MKKTK KEDNWTPVW +EF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  486  FYCKVGIAGVPADQIMKKTKPKEDNWTPVWEQEFTFPLTVPELALLRIEVHEYDMSEKDD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL DRKGE  NSVRLLMRF+FV
Sbjct  546  FAGQTCLPVSELKPGIRAVPLSDRKGEMLNSVRLLMRFDFV  586



>emb|CBI15949.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   407 bits (1045),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ N LR+YPKGTRFNSSNYKPLIGW HGAQMVAFNMQGYGR LWLM GMFR+N
Sbjct  330  TDVVRFTQKNFLRIYPKGTRFNSSNYKPLIGWTHGAQMVAFNMQGYGRYLWLMHGMFRAN  389

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN +VFNP+ +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  390  GGCGYVKKPDFLMNVGPNNQVFNPRVKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  449

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVP DEVMKKTK KED WTPVW EEF FPLTVPELALLR+EVHE+DLSEKDD
Sbjct  450  FYARVGIAGVPGDEVMKKTKTKEDKWTPVWNEEFQFPLTVPELALLRVEVHEYDLSEKDD  509

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLP++EL+PGIRAVPL +RKGE + S RLLMRFEFV
Sbjct  510  FAGQTCLPISELKPGIRAVPLFNRKGEMFCSARLLMRFEFV  550



>gb|AFO54605.1| phospholipase C [Populus tomentosa]
Length=586

 Score =   407 bits (1047),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N+LRVYPKGTRFNSSNYKPLIGW HGAQMVAFNMQGYGR LWLM GMFRSN
Sbjct  364  TDVIRFTQKNVLRVYPKGTRFNSSNYKPLIGWTHGAQMVAFNMQGYGRYLWLMNGMFRSN  423

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCG+VKKPD LM  GP+ EVFNPKT+  VKK+LKVKVYMGDGWHLDFKQTHFDSYSPPD
Sbjct  424  GGCGFVKKPDFLMKEGPHGEVFNPKTKFPVKKSLKVKVYMGDGWHLDFKQTHFDSYSPPD  483

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVP D +MKKTKIKEDNWTPVW EEF+F LTVPELALLRIEVHE+D+SEKDD
Sbjct  484  FYTRVGIAGVPGDAIMKKTKIKEDNWTPVWDEEFIFLLTVPELALLRIEVHEYDMSEKDD  543

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+ELR GIRAVPL DRKGEK NS RLLMRFEFV
Sbjct  544  FAGQTCLPVSELRSGIRAVPLFDRKGEKLNSSRLLMRFEFV  584



>ref|XP_002299806.2| hypothetical protein POPTR_0001s25910g [Populus trichocarpa]
 gb|EEE84611.2| hypothetical protein POPTR_0001s25910g [Populus trichocarpa]
Length=586

 Score =   407 bits (1046),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N+LRVYPKGTRFNSSNYKPLIGW HGAQMVAFNMQGYGR LWLM GMFRSN
Sbjct  364  TDVIRFTQKNVLRVYPKGTRFNSSNYKPLIGWTHGAQMVAFNMQGYGRYLWLMNGMFRSN  423

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCG+VKKPD LM  GP+ EVFNPKT+  VKK+LKVKVYMGDGWHLDFK THFDSYSPPD
Sbjct  424  GGCGFVKKPDFLMKGGPHGEVFNPKTKFPVKKSLKVKVYMGDGWHLDFKPTHFDSYSPPD  483

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVP D +MKKTKIKEDNWTPVW EEF+F LTVPELALLR+EVHE+D+SEKDD
Sbjct  484  FYTRVGIAGVPGDAIMKKTKIKEDNWTPVWDEEFIFQLTVPELALLRVEVHEYDMSEKDD  543

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+ELRPGIRAVPL DRKGEK NS RLLMRFEFV
Sbjct  544  FAGQTCLPVSELRPGIRAVPLFDRKGEKLNSSRLLMRFEFV  584



>ref|XP_002278527.1| PREDICTED: phosphoinositide phospholipase C 4-like [Vitis vinifera]
Length=588

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ N LR+YPKGTRFNSSNYKPLIGW HGAQMVAFNMQGYGR LWLM GMFR+N
Sbjct  368  TDVVRFTQKNFLRIYPKGTRFNSSNYKPLIGWTHGAQMVAFNMQGYGRYLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN +VFNP+ +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFLMNVGPNNQVFNPRVKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVP DEVMKKTK KED WTPVW EEF FPLTVPELALLR+EVHE+DLSEKDD
Sbjct  488  FYARVGIAGVPGDEVMKKTKTKEDKWTPVWNEEFQFPLTVPELALLRVEVHEYDLSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLP++EL+PGIRAVPL +RKGE + S RLLMRFEFV
Sbjct  548  FAGQTCLPISELKPGIRAVPLFNRKGEMFCSARLLMRFEFV  588



>emb|CDP09195.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   406 bits (1044),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/222 (85%), Positives = 200/222 (90%), Gaps = 0/222 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ NILRVYPKG R  SSNYKPL+ WMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  374  DVVRFTQKNILRVYPKGMRVTSSNYKPLLSWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  433

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD LM +GPN +VF PK +  VK TLKVKVYMGDGWHLDFKQTHFD YSPPDF
Sbjct  434  GCGYVKKPDFLMKIGPNGQVFYPKEKQPVKTTLKVKVYMGDGWHLDFKQTHFDMYSPPDF  493

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGVPAD VMKKTK KEDNWTP+W EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  494  YTRVGIAGVPADVVMKKTKKKEDNWTPIWEEEFTFPLTVPELALLRIEVHEYDMSEKDDF  553

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV*C  120
            AGQTCLPV+EL+PGI A+PLCD KGEKYNSVRLLMRFEFV C
Sbjct  554  AGQTCLPVSELKPGIHAIPLCDHKGEKYNSVRLLMRFEFVEC  595



>ref|XP_008355042.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phospholipase 
C 4-like [Malus domestica]
Length=588

 Score =   405 bits (1041),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTRFNSSNYKPL+GWMHGAQMVAFNMQGYGRSLWLM GMFR+N
Sbjct  368  TDIVRFTQKNILRVYPKGTRFNSSNYKPLVGWMHGAQMVAFNMQGYGRSLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +M    + +VF+PK  L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFIMKADSDNQVFDPKANLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWEEEFTFPLTVPELALLRVEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL DRKG KYNSVRLLMRFEFV
Sbjct  548  FGGQTCLPVSELRQGIRAVPLFDRKGVKYNSVRLLMRFEFV  588



>ref|XP_009347256.1| PREDICTED: phosphoinositide phospholipase C 4-like [Pyrus x bretschneideri]
Length=588

 Score =   405 bits (1041),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTRFNSSNYKPL+GWMHGAQMVAFNMQGYGRSLWLM GMFR+N
Sbjct  368  TDIVRFTQKNILRVYPKGTRFNSSNYKPLVGWMHGAQMVAFNMQGYGRSLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +M    + +VF+PK  L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFIMKADSDYQVFDPKATLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWEEEFTFPLTVPELALLRVEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL DRKG KYNSVRLLMRFEFV
Sbjct  548  FGGQTCLPVSELRQGIRAVPLFDRKGVKYNSVRLLMRFEFV  588



>gb|KDO66894.1| hypothetical protein CISIN_1g007887mg [Citrus sinensis]
Length=586

 Score =   405 bits (1040),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 186/221 (84%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILR+YPKGTRF SSNYKPL+GWMHG QMVAFNMQGYGR++WLM GMFRSN
Sbjct  366  TDLVRFTQKNILRIYPKGTRFTSSNYKPLVGWMHGTQMVAFNMQGYGRAMWLMHGMFRSN  425

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPDL MNVGP+ +VFNPK  L VKKTLK+KVYMGDGWHLDFKQTHFD YSPPD
Sbjct  426  GGCGYVKKPDLQMNVGPDGQVFNPKEILPVKKTLKIKVYMGDGWHLDFKQTHFDLYSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAGVPAD++MKKTK KEDNWTPVW +EF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  486  FYCKVGIAGVPADQIMKKTKPKEDNWTPVWEQEFTFPLTVPELALLRIEVHEYDMSEKDD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL DRKGE  NSVRLLMRF+FV
Sbjct  546  FAGQTCLPVSELKPGIRAVPLSDRKGEMLNSVRLLMRFDFV  586



>ref|XP_006488531.1| PREDICTED: phosphoinositide phospholipase C 4-like [Citrus sinensis]
Length=586

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/221 (84%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILR+YPKGTRF SSNYKPL+GWMHG QMVAFNMQGYGR++WLM GMFRSN
Sbjct  366  TDLVRFTQKNILRIYPKGTRFTSSNYKPLVGWMHGTQMVAFNMQGYGRAMWLMHGMFRSN  425

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPDL MNVGP+ +VFNPK  L VKKTLK+KVYMGDGWHLDFKQTHFD YSPPD
Sbjct  426  GGCGYVKKPDLQMNVGPDGQVFNPKEILPVKKTLKIKVYMGDGWHLDFKQTHFDLYSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAGVPAD++MKKTK KEDNWTPVW +EF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  486  FYCKVGIAGVPADQIMKKTKPKEDNWTPVWEQEFTFPLTVPELALLRIEVHEYDMSEKDD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+PGIRAVPL DRKGE  NSVRLLMRF+FV
Sbjct  546  FAGQTCLPVSELKPGIRAVPLSDRKGEMLNSVRLLMRFDFV  586



>gb|EYU45716.1| hypothetical protein MIMGU_mgv1a003401mg [Erythranthe guttata]
Length=587

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T +V FTQ NILRVYPKGTRFNSSNYKP +GW+HGAQMVAFNMQGYGR LWLMQGMFRSN
Sbjct  367  THIVRFTQKNILRVYPKGTRFNSSNYKPQVGWLHGAQMVAFNMQGYGRYLWLMQGMFRSN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMN+  N +VF+PKT+  VKKTLKVKVYMGDGWH+ FKQTHFDSYSPPD
Sbjct  427  GGCGYVKKPDFLMNIDSNNKVFDPKTKSLVKKTLKVKVYMGDGWHMAFKQTHFDSYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAG PADE+MKKTK KED+WTPVWGEEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  487  FYTRVGIAGAPADEIMKKTKKKEDDWTPVWGEEFTFPLTVPELALLRIEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+ GIRAVPL DRKGEK NSVRLLMRFE +
Sbjct  547  FAGQTCLPVSELKSGIRAVPLFDRKGEKLNSVRLLMRFEIL  587



>ref|XP_011043776.1| PREDICTED: phosphoinositide phospholipase C 4-like [Populus euphratica]
Length=586

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DV+ FTQ NILRVYPKGTRFNSSNYKPLIGW HGAQMVAFNMQGYGR LWLM GMFRSNG
Sbjct  365  DVIRFTQKNILRVYPKGTRFNSSNYKPLIGWTHGAQMVAFNMQGYGRYLWLMNGMFRSNG  424

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD LM  GP+ EVFNPKT+  VKK+LKVKVYMGDGWHLDFK THFDSYSPPDF
Sbjct  425  GCGFVKKPDFLMKGGPHGEVFNPKTKFPVKKSLKVKVYMGDGWHLDFKPTHFDSYSPPDF  484

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGVP D +MK+TKIKEDNWTPVW EEF+F LTVPELALLR+EVHE+D+SEKDDF
Sbjct  485  YTRVGIAGVPDDAIMKRTKIKEDNWTPVWDEEFIFQLTVPELALLRVEVHEYDMSEKDDF  544

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELRPGIRAVPL DRKGEK NS RLLMRFEFV
Sbjct  545  AGQTCLPVSELRPGIRAVPLFDRKGEKLNSSRLLMRFEFV  584



>ref|XP_002525651.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF36769.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=578

 Score =   403 bits (1035),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/220 (85%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DV+ FTQ NILRVYPKGTRF SSNYKPLI WMHGAQMVAFNMQGYGR+LWLM GMFR+NG
Sbjct  359  DVIRFTQKNILRVYPKGTRFTSSNYKPLIAWMHGAQMVAFNMQGYGRALWLMHGMFRANG  418

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
             CGYVKKPD+LMNVGP+ EVFNPK +L +KKTLKVKVYMGDGWHLDFK THFD YSPPDF
Sbjct  419  SCGYVKKPDILMNVGPHGEVFNPKAKLPIKKTLKVKVYMGDGWHLDFKPTHFDLYSPPDF  478

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGVPAD  M+KTKIKEDNWTPVW EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  479  YTRVGIAGVPADVKMEKTKIKEDNWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDDF  538

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQ C PV+ELRPGIRAVPL DRKG+K NS RLLMRFEFV
Sbjct  539  AGQICFPVSELRPGIRAVPLFDRKGKKLNSSRLLMRFEFV  578



>ref|XP_007206576.1| hypothetical protein PRUPE_ppa020283mg [Prunus persica]
 gb|EMJ07775.1| hypothetical protein PRUPE_ppa020283mg [Prunus persica]
Length=587

 Score =   403 bits (1035),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 202/221 (91%), Gaps = 1/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+N
Sbjct  368  TDVVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +MN   N ++F+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFIMNESDN-QIFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF FPL VPELALLR+EVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWEEEFTFPLRVPELALLRVEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL DRKG KYNSVRLLM+FEF+
Sbjct  547  FGGQTCLPVSELRQGIRAVPLFDRKGTKYNSVRLLMQFEFI  587



>ref|XP_003615684.1| Phosphoinositide phospholipase C [Medicago truncatula]
Length=424

 Score =   397 bits (1020),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD++ FTQ N LR+YPKGTR  SSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFRSN
Sbjct  204  TDLIRFTQKNFLRIYPKGTRVTSSNYKPLIGWMHGAQMVAFNMQGYGRNLWLMHGMFRSN  263

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYVKKPD LMNVGPN EVFNPK +L VKKTLKVK+Y+GDGW +DFKQTHFDSYSPPD
Sbjct  264  GECGYVKKPDFLMNVGPNNEVFNPKDKLEVKKTLKVKIYVGDGWSMDFKQTHFDSYSPPD  323

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD  MKKTK  EDNW P W EEF FPLTVPELALLR+EVHE+D+SE DD
Sbjct  324  FYARVGIAGVPADVTMKKTKTIEDNWIPTWEEEFTFPLTVPELALLRVEVHEYDMSETDD  383

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLP+ EL+ GIRAVPL DRKGEKYNSVRLLM+F+F+
Sbjct  384  FAGQTCLPITELKQGIRAVPLYDRKGEKYNSVRLLMKFDFI  424



>gb|KCW85435.1| hypothetical protein EUGRSUZ_B02250 [Eucalyptus grandis]
Length=479

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRVYPKGTRFNSSNYKPL+GWMHGAQMVAFNMQGYGR LWLM GMFR+N
Sbjct  259  TDVVRFTQKNILRVYPKGTRFNSSNYKPLVGWMHGAQMVAFNMQGYGRFLWLMHGMFRAN  318

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM++GP  EVF+PK +L VKKTL V VYMGDGWHLDFKQTHFD YSPPD
Sbjct  319  GGCGYVKKPDFLMSLGPKNEVFDPKAKLDVKKTLTVTVYMGDGWHLDFKQTHFDLYSPPD  378

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW +EF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  379  FYTRVGIAGVPADTVMKKTKKIEDDWTPVWNQEFSFPLTVPELALLRIEVHEYDMSEKDD  438

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            FAGQTCLPV+EL+ GIRA+PL DRKGEK +S RLLMRF+F
Sbjct  439  FAGQTCLPVSELKSGIRAIPLYDRKGEKLSSARLLMRFDF  478



>gb|KJB55732.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
 gb|KJB55733.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=367

 Score =   394 bits (1011),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 198/221 (90%), Gaps = 4/221 (2%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N LR+YPKGTRFNSSNYKP IGWMHGAQM+AFNMQGYGRSLWLMQGMFR+N
Sbjct  151  TDLVRFTQKNFLRIYPKGTRFNSSNYKPQIGWMHGAQMIAFNMQGYGRSLWLMQGMFRAN  210

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV  N E    + +L VKK L+VKVYMGDGWHLDFK THFD+YSPPD
Sbjct  211  GGCGYVKKPDFLMNVDANSE----RAKLPVKKRLRVKVYMGDGWHLDFKHTHFDTYSPPD  266

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVP DE+MKKTKIKEDNWTPVW EEF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  267  FYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEFTFPLTVPELALLRVEVHEYDMSEKDD  326

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+ GIRAVPL DRKGEK NS RLLMRF+FV
Sbjct  327  FAGQTCLPVSELKQGIRAVPLFDRKGEKLNSTRLLMRFDFV  367



>ref|XP_004490600.1| PREDICTED: phosphoinositide phospholipase C 4-like [Cicer arietinum]
Length=593

 Score =   400 bits (1028),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD++ FTQ N LRVYPKGTR  SSNYKPL+GWMHGAQMVAFNMQGYG++LWLM GMFRSN
Sbjct  373  TDLIRFTQKNFLRVYPKGTRVTSSNYKPLVGWMHGAQMVAFNMQGYGKNLWLMNGMFRSN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN EVFNPK +L VKKTLKVK+Y+GDGW +DFKQTHFDSYSPPD
Sbjct  433  GGCGYVKKPDFLMNVGPNNEVFNPKDKLQVKKTLKVKIYVGDGWRMDFKQTHFDSYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVP D  MKKTKI EDNW P W EEF FPLTVPELALLR+EVHE+D+SE DD
Sbjct  493  FYARVGIAGVPDDVTMKKTKIIEDNWIPAWDEEFTFPLTVPELALLRVEVHEYDMSETDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLP+AEL+ GIRAVPL DRKGEKYNSVRLLMRF+F+
Sbjct  553  FAGQTCLPIAELKQGIRAVPLFDRKGEKYNSVRLLMRFDFI  593



>ref|XP_010043428.1| PREDICTED: phosphoinositide phospholipase C 4-like [Eucalyptus 
grandis]
 gb|KCW85434.1| hypothetical protein EUGRSUZ_B02250 [Eucalyptus grandis]
Length=588

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRVYPKGTRFNSSNYKPL+GWMHGAQMVAFNMQGYGR LWLM GMFR+N
Sbjct  368  TDVVRFTQKNILRVYPKGTRFNSSNYKPLVGWMHGAQMVAFNMQGYGRFLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM++GP  EVF+PK +L VKKTL V VYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFLMSLGPKNEVFDPKAKLDVKKTLTVTVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW +EF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADTVMKKTKKIEDDWTPVWNQEFSFPLTVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            FAGQTCLPV+EL+ GIRA+PL DRKGEK +S RLLMRF+F
Sbjct  548  FAGQTCLPVSELKSGIRAIPLYDRKGEKLSSARLLMRFDF  587



>ref|XP_008220865.1| PREDICTED: phosphoinositide phospholipase C 4-like [Prunus mume]
Length=587

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 201/221 (91%), Gaps = 1/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+N
Sbjct  368  TDVVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +MN   N ++F+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFIMNESDN-QIFDPKAKLPVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MKKTK KED+WTPVW EEF FPL VPELALLR+EVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADEIMKKTKKKEDDWTPVWEEEFTFPLRVPELALLRVEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GI AVPL DRKG KYNSVRLLM+FEF+
Sbjct  547  FGGQTCLPVSELRQGICAVPLFDRKGTKYNSVRLLMQFEFI  587



>gb|KDP46490.1| hypothetical protein JCGZ_08462 [Jatropha curcas]
Length=588

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N+LRVYPKGTRFNSSNYKPL+ WMHGAQMVAFNMQGYGR+LWLM GMFR+N
Sbjct  368  TDVIRFTQKNVLRVYPKGTRFNSSNYKPLMAWMHGAQMVAFNMQGYGRALWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGP+ EVFNPK  L VKKTLKVKVYMGDGWHLDFK THFD YSPPD
Sbjct  428  GGCGYVKKPDFLMNVGPHGEVFNPKANLPVKKTLKVKVYMGDGWHLDFKPTHFDMYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  ++KTKIKEDNWTP+WGEEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADVKVEKTKIKEDNWTPIWGEEFTFPLTVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQ C PV+ELR GIRA+PL DRKG+K  S RLL RF+FV
Sbjct  548  FAGQACFPVSELRQGIRAIPLFDRKGKKLPSARLLFRFDFV  588



>ref|XP_011460953.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=585

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 201/221 (91%), Gaps = 3/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYG+SLWLM GMFR+N
Sbjct  368  TDVVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGKSLWLMHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +MN   + ++F+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  428  GGCGYVKKPDFVMN---DEQIFDPKAKLTVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  484

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADEVMKKTK KED+WTPVW EEF FPL VPELALLRIEVHE+D+SEKDD
Sbjct  485  FYTRVGIAGVPADEVMKKTKKKEDDWTPVWEEEFTFPLRVPELALLRIEVHEYDMSEKDD  544

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLP++EL+ GI A+PL +RKGEKYNSVRLLMRFEF 
Sbjct  545  FGGQTCLPISELKQGIHALPLFNRKGEKYNSVRLLMRFEFT  585



>ref|XP_004294231.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=588

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 201/221 (91%), Gaps = 3/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYG+SLWLM GMFR+N
Sbjct  371  TDVVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGKSLWLMHGMFRAN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +MN   + ++F+PK +L VKKTLKVKVYMGDGWHLDFKQTHFD YSPPD
Sbjct  431  GGCGYVKKPDFVMN---DEQIFDPKAKLTVKKTLKVKVYMGDGWHLDFKQTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADEVMKKTK KED+WTPVW EEF FPL VPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADEVMKKTKKKEDDWTPVWEEEFTFPLRVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLP++EL+ GI A+PL +RKGEKYNSVRLLMRFEF 
Sbjct  548  FGGQTCLPISELKQGIHALPLFNRKGEKYNSVRLLMRFEFT  588



>gb|AES98642.2| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=594

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD++ FTQ N LR+YPKGTR  SSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFRSN
Sbjct  374  TDLIRFTQKNFLRIYPKGTRVTSSNYKPLIGWMHGAQMVAFNMQGYGRNLWLMHGMFRSN  433

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYVKKPD LMNVGPN EVFNPK +L VKKTLKVK+Y+GDGW +DFKQTHFDSYSPPD
Sbjct  434  GECGYVKKPDFLMNVGPNNEVFNPKDKLEVKKTLKVKIYVGDGWSMDFKQTHFDSYSPPD  493

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD  MKKTK  EDNW P W EEF FPLTVPELALLR+EVHE+D+SE DD
Sbjct  494  FYARVGIAGVPADVTMKKTKTIEDNWIPTWEEEFTFPLTVPELALLRVEVHEYDMSETDD  553

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLP+ EL+ GIRAVPL DRKGEKYNSVRLLM+F+F+
Sbjct  554  FAGQTCLPITELKQGIRAVPLYDRKGEKYNSVRLLMKFDFI  594



>gb|KHG10595.1| Phosphoinositide phospholipase C 4 [Gossypium arboreum]
Length=583

 Score =   395 bits (1014),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 199/221 (90%), Gaps = 4/221 (2%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N LR+YPKGTRFNSSNYKP IGWMHGAQM+AFNMQGYGRSLWLMQGMFR+N
Sbjct  367  TDLVRFTQKNFLRIYPKGTRFNSSNYKPQIGWMHGAQMIAFNMQGYGRSLWLMQGMFRAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVG N E    + +L VKK L+VKVYMGDGWHLDFK THFD+YSPPD
Sbjct  427  GGCGYVKKPDFLMNVGANGE----RAKLPVKKRLRVKVYMGDGWHLDFKHTHFDTYSPPD  482

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVP DE+MKKTKIKEDNWTPVW EEF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  483  FYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEFTFPLTVPELALLRVEVHEYDMSEKDD  542

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+ GIRAVPL DRKGEK NS RLLMRF+FV
Sbjct  543  FAGQTCLPVSELKQGIRAVPLFDRKGEKLNSTRLLMRFDFV  583



>gb|KJB55734.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=583

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 198/221 (90%), Gaps = 4/221 (2%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N LR+YPKGTRFNSSNYKP IGWMHGAQM+AFNMQGYGRSLWLMQGMFR+N
Sbjct  367  TDLVRFTQKNFLRIYPKGTRFNSSNYKPQIGWMHGAQMIAFNMQGYGRSLWLMQGMFRAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV  N E    + +L VKK L+VKVYMGDGWHLDFK THFD+YSPPD
Sbjct  427  GGCGYVKKPDFLMNVDANSE----RAKLPVKKRLRVKVYMGDGWHLDFKHTHFDTYSPPD  482

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVP DE+MKKTKIKEDNWTPVW EEF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  483  FYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEFTFPLTVPELALLRVEVHEYDMSEKDD  542

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+EL+ GIRAVPL DRKGEK NS RLLMRF+FV
Sbjct  543  FAGQTCLPVSELKQGIRAVPLFDRKGEKLNSTRLLMRFDFV  583



>gb|AFN53674.1| hypothetical protein [Linum usitatissimum]
Length=530

 Score =   391 bits (1004),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 202/220 (92%), Gaps = 3/220 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +V+ FTQ NILRV+PKGTR  SSNYKPLIGWMHGAQMVAFNMQGYGR+LWLM GMFRSNG
Sbjct  314  EVIRFTQKNILRVFPKGTRVTSSNYKPLIGWMHGAQMVAFNMQGYGRALWLMHGMFRSNG  373

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+LMN  P+ ++FNPK++L VKKTLKVKVY GDGWHLDFKQTHFD YSPPDF
Sbjct  374  GCGYVKKPDILMN--PD-KLFNPKSQLPVKKTLKVKVYSGDGWHLDFKQTHFDKYSPPDF  430

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGVP D VMKKT++KED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  431  YTRVGIAGVPDDVVMKKTEVKEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDDF  490

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELRPGIRAVPL  RKGEKYNSV+LLMRFEFV
Sbjct  491  GGQTCLPVSELRPGIRAVPLFSRKGEKYNSVKLLMRFEFV  530



>ref|XP_009399994.1| PREDICTED: phosphoinositide phospholipase C 6-like [Musa acuminata 
subsp. malaccensis]
Length=592

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTRFNSSNY PL+GWMHGAQMVAFNMQGYGRSLWLMQG+FR+NG
Sbjct  373  DIVRFTQKNILRVYPKGTRFNSSNYNPLLGWMHGAQMVAFNMQGYGRSLWLMQGLFRANG  432

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+V+KPD LM VGP+ EVF+P+  L VK TLKVKVYMGDGW +DF QTHFD+YSPPDF
Sbjct  433  GCGFVRKPDFLMKVGPHGEVFDPEASLPVKITLKVKVYMGDGWRMDFSQTHFDAYSPPDF  492

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+VGIAGVPAD  MKKTKI EDNWTPVW EEF FPLTVPELALLR+EVHE+D+S+KDDF
Sbjct  493  YTKVGIAGVPADTKMKKTKIIEDNWTPVWEEEFSFPLTVPELALLRVEVHEYDMSDKDDF  552

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELRPGIRAVPL DRKG KY SVRLLMRF+FV
Sbjct  553  GGQTCLPVWELRPGIRAVPLHDRKGNKYKSVRLLMRFQFV  592



>ref|XP_008220858.1| PREDICTED: phosphoinositide phospholipase C 4-like [Prunus mume]
Length=589

 Score =   390 bits (1002),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 196/221 (89%), Gaps = 1/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFR+N
Sbjct  370  TDIVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRAN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +M    N +VF+PK  L VKKTLKVKVYMGDGWHLDFK THFD YSPPD
Sbjct  430  GGCGYVKKPDFVMKNLDN-QVFDPKANLPVKKTLKVKVYMGDGWHLDFKHTHFDLYSPPD  488

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MK+T+ KED WTP W EEF F LTVPELALLR+EVHEHDLSEKDD
Sbjct  489  FYTRVGIAGVPADEIMKRTQKKEDIWTPSWEEEFTFQLTVPELALLRVEVHEHDLSEKDD  548

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTC P++EL  GIRAVPL DRKG KYNS+RLLMRF+F+
Sbjct  549  FGGQTCFPISELEQGIRAVPLFDRKGNKYNSIRLLMRFQFI  589



>ref|XP_008789095.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Phoenix dactylifera]
Length=491

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P IGWMHGAQMVAFNMQG+GRSLWLM G +++N
Sbjct  271  ADLVRFTQKNLLRIYPKGTRFNSSNYNPFIGWMHGAQMVAFNMQGHGRSLWLMHGFYKAN  330

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+P   L VKKTLKVKVYMGDGW  DF QTHFD+YSPPD
Sbjct  331  GGCGYVKKPDFLLKTGPNREVFHPTANLPVKKTLKVKVYMGDGWRKDFSQTHFDAYSPPD  390

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  391  FYTRVGIAGVPADAVMKKTKAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  450

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIRAVPL DRKG K+ SV+LL+RFEFV
Sbjct  451  FGGQTCLPVSELRPGIRAVPLFDRKGMKFKSVKLLVRFEFV  491



>ref|XP_010937845.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Elaeis guineensis]
Length=598

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P IGWMHGAQMVAFNMQGYGRSLWLM G +++N
Sbjct  374  ADLVRFTQKNLLRIYPKGTRFNSSNYNPFIGWMHGAQMVAFNMQGYGRSLWLMHGFYKAN  433

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GP+ EVF P   + VKKTLKVKVYMGDGW +DFKQTHFD+YSPPD
Sbjct  434  GGCGYVKKPDFLLKTGPDGEVFYPTANVAVKKTLKVKVYMGDGWRMDFKQTHFDAYSPPD  493

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  494  FYTRVGIAGVPADTVMKKTKAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  553

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV*C  120
            F GQTCLPV+ELRPGIR VPL DRKG K+ SV+LLM+FEFV C
Sbjct  554  FGGQTCLPVSELRPGIRTVPLFDRKGMKFKSVKLLMQFEFVGC  596



>ref|XP_010937844.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Elaeis guineensis]
Length=599

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P IGWMHGAQMVAFNMQGYGRSLWLM G +++N
Sbjct  375  ADLVRFTQKNLLRIYPKGTRFNSSNYNPFIGWMHGAQMVAFNMQGYGRSLWLMHGFYKAN  434

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GP+ EVF P   + VKKTLKVKVYMGDGW +DFKQTHFD+YSPPD
Sbjct  435  GGCGYVKKPDFLLKTGPDGEVFYPTANVAVKKTLKVKVYMGDGWRMDFKQTHFDAYSPPD  494

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  495  FYTRVGIAGVPADTVMKKTKAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  554

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV*C  120
            F GQTCLPV+ELRPGIR VPL DRKG K+ SV+LLM+FEFV C
Sbjct  555  FGGQTCLPVSELRPGIRTVPLFDRKGMKFKSVKLLMQFEFVGC  597



>ref|XP_007208015.1| hypothetical protein PRUPE_ppa003249mg [Prunus persica]
 gb|EMJ09214.1| hypothetical protein PRUPE_ppa003249mg [Prunus persica]
Length=589

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 194/221 (88%), Gaps = 1/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFR+N
Sbjct  370  TDIVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRAN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD +M    N +VF PK  L VKKTLKVKVYMGDGWHLDFK THFD YSPPD
Sbjct  430  GGCGYVKKPDFVMKNLDN-QVFYPKANLPVKKTLKVKVYMGDGWHLDFKHTHFDLYSPPD  488

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPADE+MK+TK KED WTP W EEF F L VPELALLR+EVHEHDLSEKDD
Sbjct  489  FYTRVGIAGVPADEIMKQTKKKEDIWTPSWEEEFTFQLKVPELALLRVEVHEHDLSEKDD  548

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTC P++EL+ GIRAVPL DRKG KYN++RLLMRF F+
Sbjct  549  FGGQTCFPISELKQGIRAVPLFDRKGNKYNTIRLLMRFHFI  589



>ref|XP_010922549.1| PREDICTED: phosphoinositide phospholipase C 6-like [Elaeis guineensis]
Length=587

 Score =   385 bits (990),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ N+LR+YPKGTRF SSNYKPL+GWMHGAQMVAFNMQGYGRSLWLM G FR+N
Sbjct  367  TDVVRFTQQNLLRIYPKGTRFTSSNYKPLVGWMHGAQMVAFNMQGYGRSLWLMHGFFRAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD L+  GP+ ++F+PK    VK TLKVKVYMGDGW +DFKQTHFD+YSPPD
Sbjct  427  GGCGYIKKPDFLLKAGPDGQLFDPKKSFPVKTTLKVKVYMGDGWRMDFKQTHFDAYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVPAD VMKKT+  ED+WTPVW EEF FPLTVPELA+LRIEV E+D+SEKDD
Sbjct  487  FYTKVGIAGVPADTVMKKTRTIEDDWTPVWDEEFSFPLTVPELAVLRIEVCEYDISEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLP +ELR GIRAVPLCDRKG K+ SVRLLMRFEFV
Sbjct  547  FGGQTCLPASELRSGIRAVPLCDRKGMKFKSVRLLMRFEFV  587



>ref|XP_008789094.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Phoenix dactylifera]
Length=601

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P IGWMHGAQMVAFNMQG+GRSLWLM G +++N
Sbjct  381  ADLVRFTQKNLLRIYPKGTRFNSSNYNPFIGWMHGAQMVAFNMQGHGRSLWLMHGFYKAN  440

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+P   L VKKTLKVKVYMGDGW  DF QTHFD+YSPPD
Sbjct  441  GGCGYVKKPDFLLKTGPNREVFHPTANLPVKKTLKVKVYMGDGWRKDFSQTHFDAYSPPD  500

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  501  FYTRVGIAGVPADAVMKKTKAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  560

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIRAVPL DRKG K+ SV+LL+RFEFV
Sbjct  561  FGGQTCLPVSELRPGIRAVPLFDRKGMKFKSVKLLVRFEFV  601



>ref|XP_008789093.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Phoenix dactylifera]
Length=602

 Score =   385 bits (990),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P IGWMHGAQMVAFNMQG+GRSLWLM G +++N
Sbjct  382  ADLVRFTQKNLLRIYPKGTRFNSSNYNPFIGWMHGAQMVAFNMQGHGRSLWLMHGFYKAN  441

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+P   L VKKTLKVKVYMGDGW  DF QTHFD+YSPPD
Sbjct  442  GGCGYVKKPDFLLKTGPNREVFHPTANLPVKKTLKVKVYMGDGWRKDFSQTHFDAYSPPD  501

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  502  FYTRVGIAGVPADAVMKKTKAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  561

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIRAVPL DRKG K+ SV+LL+RFEFV
Sbjct  562  FGGQTCLPVSELRPGIRAVPLFDRKGMKFKSVKLLVRFEFV  602



>gb|EPS61000.1| hypothetical protein M569_13801, partial [Genlisea aurea]
Length=587

 Score =   385 bits (988),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 195/220 (89%), Gaps = 3/220 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYP+GTRFNSSN+KP IGW+HGAQMVAFNMQGYGRSLWLMQGMFR N
Sbjct  371  TDIVRFTQKNILRVYPRGTRFNSSNFKPQIGWLHGAQMVAFNMQGYGRSLWLMQGMFRGN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCG+VKKPD LMN     +VF+PK +LHVK+TLKVKVYMGDGWH+DFK THFD YSPPD
Sbjct  431  GGCGFVKKPDFLMNAS---DVFDPKAKLHVKRTLKVKVYMGDGWHMDFKPTHFDLYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT VGIAG P DE MKKTK KEDNWTPVW EEF FPL+VPE+ALLRIEVHE+D++EKDD
Sbjct  488  FYTVVGIAGAPGDEAMKKTKKKEDNWTPVWDEEFAFPLSVPEVALLRIEVHEYDMTEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            FAGQ CLPV+ELR GIRAVPLCDRKGE+  SVRLL+RF+ 
Sbjct  548  FAGQICLPVSELRSGIRAVPLCDRKGERLKSVRLLVRFDI  587



>gb|ABU53666.1| phospholipase C [Torenia fournieri]
Length=583

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 199/221 (90%), Gaps = 3/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V  TQ NILRVYPKGTRFNSSNYKP +GW+HGAQMVAFNMQGYGRSLWLMQGMF++N
Sbjct  366  ADIVRSTQRNILRVYPKGTRFNSSNYKPQVGWLHGAQMVAFNMQGYGRSLWLMQGMFKAN  425

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD+ M+     ++F+PK    VKKTLKVKVYMGDGWH+DFKQTHFD+YSPPD
Sbjct  426  GGCGYVKKPDIFMDSN---QLFDPKAEYSVKKTLKVKVYMGDGWHMDFKQTHFDAYSPPD  482

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTR+GIAG PADE+MKKTK KEDNW PVW EEF FPLTV E+A+LRIEVHE+D+SEKDD
Sbjct  483  FYTRIGIAGAPADEMMKKTKKKEDNWAPVWNEEFEFPLTVSEIAILRIEVHEYDMSEKDD  542

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+E +PGIRAVP+CDRKGEKYNSVRLLMRFEFV
Sbjct  543  FAGQTCLPVSESKPGIRAVPICDRKGEKYNSVRLLMRFEFV  583



>ref|XP_009402378.1| PREDICTED: phosphoinositide phospholipase C 6-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D++ FTQ N+LR+YPKGTRFNSSNY P IGW+HGAQMVAFNMQGYGRSLWLM G +++N
Sbjct  371  ADLLRFTQKNLLRIYPKGTRFNSSNYNPFIGWIHGAQMVAFNMQGYGRSLWLMHGFYKAN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD L+  GPN EVF+PK  L VKKTLKVK+YMGDGW +DF QTHFD+YSPPD
Sbjct  431  GGCGYIKKPDFLVKAGPNNEVFDPKAVLPVKKTLKVKIYMGDGWRMDFSQTHFDAYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  EDNWTPVW EEF F LTVPELALLRIEVHE+D+SEKDD
Sbjct  491  FYTRVGIAGVPADTVMKKTKTIEDNWTPVWDEEFTFTLTVPELALLRIEVHEYDMSEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTC+PV+ELRPGIRAVPL D KG K+NSV+LLMRF FV
Sbjct  551  FGGQTCIPVSELRPGIRAVPLFDHKGNKFNSVKLLMRFVFV  591



>ref|XP_010106259.1| Phosphoinositide phospholipase C 2 [Morus notabilis]
 gb|EXC09416.1| Phosphoinositide phospholipase C 2 [Morus notabilis]
Length=591

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTRF+SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMF SNG
Sbjct  372  DIVRFTQRNILRVYPKGTRFDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFTSNG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ L+  GP+ EVF+PK +L VK TLKV VYMG+GW+ DF+ THFD+YSPPDF
Sbjct  432  GCGYVKKPEFLLKTGPHNEVFDPKAKLPVKTTLKVTVYMGEGWYYDFRHTHFDAYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTR+GIAGVPAD VMKKTK  EDNW P W EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  492  YTRIGIAGVPADTVMKKTKTLEDNWIPAWNEEFEFPLTVPELALLRIEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQ CLPV+ELR GIRA+PL DRKGEKY SV+LLMRF+FV
Sbjct  552  GGQACLPVSELRKGIRAIPLHDRKGEKYRSVKLLMRFDFV  591



>ref|XP_006843548.1| hypothetical protein AMTR_s00007p00065880 [Amborella trichopoda]
 gb|ERN05223.1| hypothetical protein AMTR_s00007p00065880 [Amborella trichopoda]
Length=593

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DVV FTQ NILR+YPKG+R +SSNY PLIGW HGAQMVAFNMQGYGRSLWLMQG FR+N
Sbjct  373  ADVVRFTQRNILRIYPKGSRVDSSNYNPLIGWTHGAQMVAFNMQGYGRSLWLMQGFFRAN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L++ GP+  VFNPK +  VKKTLK+KVYMGDGW LDF QTHFD+YSPPD
Sbjct  433  GGCGYVKKPDFLLSNGPDDNVFNPKQKHPVKKTLKIKVYMGDGWRLDFDQTHFDTYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVPAD +MKKTK  ED+W+PVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  493  FYTKVGIAGVPADNIMKKTKAIEDDWSPVWNEEFSFPLTVPELALLRIEVHEYDMSEKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQ CLPV+ELRPGIRAVPL D+KGEK  SV+LLM+FEFV
Sbjct  553  FGGQNCLPVSELRPGIRAVPLFDKKGEKLKSVKLLMQFEFV  593



>ref|XP_009120385.1| PREDICTED: phosphoinositide phospholipase C 4 [Brassica rapa]
Length=589

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLMQGMFR+N
Sbjct  369  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMQGMFRAN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN EVF+P    H KKTLKVKV MGDGWHLDFK+THFD YSPPD
Sbjct  429  GGCGYVKKPDFLMNVGPNGEVFDPNENSHPKKTLKVKVLMGDGWHLDFKKTHFDRYSPPD  488

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAG PAD+ M+KT++K + WTP+W EEF F LTVPELALLR+EVHE+D +EKDD
Sbjct  489  FYVRVGIAGAPADKAMEKTEVKYNTWTPIWNEEFTFQLTVPELALLRVEVHEYDNNEKDD  548

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KYNS RLLMRFEFV
Sbjct  549  FGGQTCLPVSELRQGIRAVPLFNRKGVKYNSTRLLMRFEFV  589



>ref|XP_010920866.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Elaeis guineensis]
Length=593

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P +GWMHGAQMVAFNMQG GRSLWLM G +++N
Sbjct  373  ADIVRFTQKNLLRIYPKGTRFNSSNYNPFVGWMHGAQMVAFNMQGNGRSLWLMHGFYKAN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GP  EVF+ K  L VK+TLKVKVYMGDGW +DF QTHFD+YSPPD
Sbjct  433  GGCGYVKKPDFLLKTGPKNEVFDHKANLRVKRTLKVKVYMGDGWRMDFSQTHFDTYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVP D VMKKT+  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  493  FYTRVGIAGVPRDSVMKKTRAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIRAVPL DRKG K+ SV+LLMRFEFV
Sbjct  553  FGGQTCLPVSELRPGIRAVPLFDRKGMKFKSVKLLMRFEFV  593



>ref|XP_010253733.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nelumbo nucifera]
Length=587

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 197/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             +V+ FTQ N+LRVYPKG R +SSNY PL+GWM+GAQMVA NMQGYGRSLWLM GMFR+N
Sbjct  367  AEVIRFTQRNLLRVYPKGIRVDSSNYNPLLGWMYGAQMVALNMQGYGRSLWLMHGMFRAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+N GP+ +VF+PK +   KKTLKV+VYMG+GW+ DFK+THFD+YSPPD
Sbjct  427  GGCGYVKKPDFLLNAGPHNKVFDPKAKSQTKKTLKVRVYMGEGWNYDFKRTHFDAYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTKI EDNWTPVW EEF FPLTVPE+ALLRIEVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADSVMKKTKIIEDNWTPVWDEEFTFPLTVPEMALLRIEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKGE+Y SV+LLMRF+F+
Sbjct  547  FGGQTCLPVSELRTGIRAVPLHNRKGEQYKSVKLLMRFDFI  587



>ref|XP_010253735.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nelumbo nucifera]
Length=586

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 197/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             +V+ FTQ N+LRVYPKG R +SSNY PL+GWM+GAQMVA NMQGYGRSLWLM GMFR+N
Sbjct  366  AEVIRFTQRNLLRVYPKGIRVDSSNYNPLLGWMYGAQMVALNMQGYGRSLWLMHGMFRAN  425

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+N GP+ +VF+PK +   KKTLKV+VYMG+GW+ DFK+THFD+YSPPD
Sbjct  426  GGCGYVKKPDFLLNAGPHNKVFDPKAKSQTKKTLKVRVYMGEGWNYDFKRTHFDAYSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTKI EDNWTPVW EEF FPLTVPE+ALLRIEVHE+D+SEKDD
Sbjct  486  FYTRVGIAGVPADSVMKKTKIIEDNWTPVWDEEFTFPLTVPEMALLRIEVHEYDMSEKDD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKGE+Y SV+LLMRF+F+
Sbjct  546  FGGQTCLPVSELRTGIRAVPLHNRKGEQYKSVKLLMRFDFI  586



>ref|XP_010920867.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Elaeis guineensis]
Length=592

 Score =   380 bits (976),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKGTRFNSSNY P +GWMHGAQMVAFNMQG GRSLWLM G +++N
Sbjct  372  ADIVRFTQKNLLRIYPKGTRFNSSNYNPFVGWMHGAQMVAFNMQGNGRSLWLMHGFYKAN  431

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GP  EVF+ K  L VK+TLKVKVYMGDGW +DF QTHFD+YSPPD
Sbjct  432  GGCGYVKKPDFLLKTGPKNEVFDHKANLRVKRTLKVKVYMGDGWRMDFSQTHFDTYSPPD  491

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVP D VMKKT+  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  492  FYTRVGIAGVPRDSVMKKTRAIEDDWTPVWNEEFTFPLTVPELALLRIEVHEYDMSEKDD  551

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIRAVPL DRKG K+ SV+LLMRFEFV
Sbjct  552  FGGQTCLPVSELRPGIRAVPLFDRKGMKFKSVKLLMRFEFV  592



>ref|XP_009387536.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=592

 Score =   380 bits (975),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +D+V FTQ N+LR+YPKGTR NSSNY P IGW+HGAQMVAFNMQGYGRSLWLM G ++ N
Sbjct  372  SDLVRFTQKNLLRIYPKGTRVNSSNYNPFIGWIHGAQMVAFNMQGYGRSLWLMHGFYKGN  431

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  G + +VF+PK  L VKKTLKVKVYMGDGWH DFKQTHFDSYSPPD
Sbjct  432  GGCGYVKKPDFLLEHGSDNDVFDPKADLPVKKTLKVKVYMGDGWHADFKQTHFDSYSPPD  491

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  MKKTK  EDNWTPVW EEF+FPLTVPELALLRIEVHEHD S KDD
Sbjct  492  FYTRVGIAGVPADTTMKKTKAVEDNWTPVWDEEFIFPLTVPELALLRIEVHEHDKSGKDD  551

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQ CLP++ELR G RAVPL DRKG K+ SVR+LMRFEFV
Sbjct  552  FAGQICLPISELRRGFRAVPLFDRKGMKFKSVRVLMRFEFV  592



>ref|XP_009387528.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=590

 Score =   379 bits (974),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +D+V FTQ N+LR+YPKGTR NSSNY P IGW+HGAQMVAFNMQGYGRSLWLM G ++ N
Sbjct  370  SDLVRFTQKNLLRIYPKGTRVNSSNYNPFIGWIHGAQMVAFNMQGYGRSLWLMHGFYKGN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  G + +VF+PK  L VKKTLKVKVYMGDGWH DFKQTHFDSYSPPD
Sbjct  430  GGCGYVKKPDFLLEHGSDNDVFDPKADLPVKKTLKVKVYMGDGWHADFKQTHFDSYSPPD  489

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  MKKTK  EDNWTPVW EEF+FPLTVPELALLRIEVHEHD S KDD
Sbjct  490  FYTRVGIAGVPADTTMKKTKAVEDNWTPVWDEEFIFPLTVPELALLRIEVHEHDKSGKDD  549

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQ CLP++ELR G RAVPL DRKG K+ SVR+LMRFEFV
Sbjct  550  FAGQICLPISELRRGFRAVPLFDRKGMKFKSVRVLMRFEFV  590



>ref|XP_009387519.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=593

 Score =   379 bits (974),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +D+V FTQ N+LR+YPKGTR NSSNY P IGW+HGAQMVAFNMQGYGRSLWLM G ++ N
Sbjct  373  SDLVRFTQKNLLRIYPKGTRVNSSNYNPFIGWIHGAQMVAFNMQGYGRSLWLMHGFYKGN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  G + +VF+PK  L VKKTLKVKVYMGDGWH DFKQTHFDSYSPPD
Sbjct  433  GGCGYVKKPDFLLEHGSDNDVFDPKADLPVKKTLKVKVYMGDGWHADFKQTHFDSYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  MKKTK  EDNWTPVW EEF+FPLTVPELALLRIEVHEHD S KDD
Sbjct  493  FYTRVGIAGVPADTTMKKTKAVEDNWTPVWDEEFIFPLTVPELALLRIEVHEHDKSGKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQ CLP++ELR G RAVPL DRKG K+ SVR+LMRFEFV
Sbjct  553  FAGQICLPISELRRGFRAVPLFDRKGMKFKSVRVLMRFEFV  593



>emb|CDY52122.1| BnaA10g29510D [Brassica napus]
Length=589

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLMQGMFR+N
Sbjct  369  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMQGMFRAN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN EVF+P    H KKTLKVKV MGDGWHLDFK+THFD YSPPD
Sbjct  429  GGCGYVKKPDFLMNVGPNGEVFDPNENSHPKKTLKVKVLMGDGWHLDFKKTHFDRYSPPD  488

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAG PAD+ M+KT++K + WTP+W EEF F LTVPELALLR+EVHE+D +EKDD
Sbjct  489  FYVRVGIAGAPADKAMEKTEVKYNTWTPIWNEEFTFQLTVPELALLRVEVHEYDNNEKDD  548

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  549  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  589



>ref|XP_009380683.1| PREDICTED: phosphoinositide phospholipase C 2-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D++ FTQ N+LR+YPKGTRF SSNY P +GW+HGAQMVAFNMQGYGRSLWLM G +++N
Sbjct  373  ADLIRFTQRNLLRIYPKGTRFTSSNYNPFVGWIHGAQMVAFNMQGYGRSLWLMHGFYKAN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L++ G N EVF+PK  L VKKTLKVKVYMGDGW +DFK+THFD YSPPD
Sbjct  433  GGCGYVKKPDFLLSTGSNNEVFDPKAILPVKKTLKVKVYMGDGWSMDFKKTHFDPYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  MKKTK  EDNW PVW EEF+FPLTVPELA+LRIEVHE+D+SEKDD
Sbjct  493  FYTRVGIAGVPADATMKKTKAIEDNWIPVWDEEFVFPLTVPELAVLRIEVHEYDMSEKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQ CLPV+EL+PGIRAVPL DRKG K+ SV+LLMRFEF 
Sbjct  553  FAGQNCLPVSELKPGIRAVPLLDRKGMKFKSVKLLMRFEFA  593



>gb|AAW81961.1| phosphatidylinositol-specific phospholipase C 1 [Lilium davidii]
Length=547

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +D+V FTQ N+LR+YPKGTRF SSNY P +GW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  327  SDLVRFTQKNLLRIYPKGTRFTSSNYNPFVGWLHGAQMVAFNMQGYGRALWLMHGFYQAN  386

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+N G + E F+PK  L VKKTLKVKVYMGDGW +DFKQT+FD+YSPPD
Sbjct  387  GGCGYVKKPDFLLNTGSHGETFHPKVPLPVKKTLKVKVYMGDGWRMDFKQTYFDAYSPPD  446

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTR+GIAGVPAD VMK+TK  ED+WTPVW EEF+FPLTVPE+ALLRIEVHE+D+SEKDD
Sbjct  447  FYTRIGIAGVPADXVMKRTKAIEDDWTPVWNEEFVFPLTVPEIALLRIEVHEYDMSEKDD  506

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLP++ELRPG R+VPL DRKG K+ SV+LLMRFEF+
Sbjct  507  FGGQTCLPISELRPGFRSVPLFDRKGMKFKSVKLLMRFEFI  547



>ref|XP_010443620.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Camelina sativa]
Length=598

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  378  TDVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  437

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN + F PK  L  KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  438  GGCGYVKKPDFLMNVGPNGQGFYPKDNLSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  497

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDD
Sbjct  498  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDKNEKDD  557

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  558  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  598



>gb|KFK27410.1| hypothetical protein AALP_AA8G379300 [Arabis alpina]
Length=593

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N+LR+YPKGTR NSSNYKP IGW+ GAQM+AFN+QGYGR+LWLMQGMFR+N
Sbjct  373  TDVIRFTQKNLLRIYPKGTRLNSSNYKPQIGWLSGAQMMAFNIQGYGRALWLMQGMFRAN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN +VF+PK  L  KKTLKVKV  GDGW+LDF +THFD YSPPD
Sbjct  433  GGCGYVKKPDFLMNVGPNGQVFDPKENLPPKKTLKVKVCKGDGWNLDFNKTHFDLYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAG PADEVM+KTK++ED W PVW EEF FPLT+PELALLR+EV++ D  EKDD
Sbjct  493  FYVKVGIAGAPADEVMQKTKVEEDTWKPVWNEEFTFPLTIPELALLRVEVYDFDNGEKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL D+KGEKYNS RLLMRFEFV
Sbjct  553  FGGQTCLPVSELRQGIRAVPLFDQKGEKYNSTRLLMRFEFV  593



>gb|KFK27411.1| hypothetical protein AALP_AA8G379300 [Arabis alpina]
Length=591

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N+LR+YPKGTR NSSNYKP IGW+ GAQM+AFN+QGYGR+LWLMQGMFR+N
Sbjct  371  TDVIRFTQKNLLRIYPKGTRLNSSNYKPQIGWLSGAQMMAFNIQGYGRALWLMQGMFRAN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN +VF+PK  L  KKTLKVKV  GDGW+LDF +THFD YSPPD
Sbjct  431  GGCGYVKKPDFLMNVGPNGQVFDPKENLPPKKTLKVKVCKGDGWNLDFNKTHFDLYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAG PADEVM+KTK++ED W PVW EEF FPLT+PELALLR+EV++ D  EKDD
Sbjct  491  FYVKVGIAGAPADEVMQKTKVEEDTWKPVWNEEFTFPLTIPELALLRVEVYDFDNGEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL D+KGEKYNS RLLMRFEFV
Sbjct  551  FGGQTCLPVSELRQGIRAVPLFDQKGEKYNSTRLLMRFEFV  591



>emb|CBI30388.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D++ FTQ N+LRV+PK  R +SSNY PLIGWMHGAQMVAFNMQGY R LWLMQGMFR+NG
Sbjct  362  DIIRFTQRNLLRVFPKVMRVDSSNYNPLIGWMHGAQMVAFNMQGYDRPLWLMQGMFRANG  421

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+ VGP+ +VF+PK  L VK TLKVKVYMG+GWHLDF  THFD YSPPDF
Sbjct  422  GCGYVKKPDLLLKVGPHDKVFDPKANLPVKTTLKVKVYMGEGWHLDFHHTHFDIYSPPDF  481

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+VGIAGVPAD +MKKTK  ED+WTP W EEF FPLT PELALLRIEVHE+D+SEKDDF
Sbjct  482  YTKVGIAGVPADSLMKKTKAVEDDWTPTWNEEFEFPLTAPELALLRIEVHEYDMSEKDDF  541

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL ++KGEKYNSV+LLMRFEFV
Sbjct  542  GGQTCLPVSELRTGIRAVPLHNQKGEKYNSVKLLMRFEFV  581



>ref|XP_011035945.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=588

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R NSSNY PLIGWMHGAQMVAFNMQG+GRSLW+MQGMFR+NG
Sbjct  369  EIVRFTQRNILRVYPKGIRVNSSNYNPLIGWMHGAQMVAFNMQGHGRSLWMMQGMFRANG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD L+  GP+ EVF+PK +L V+KTLKVK+YMG+GW+ DF  THFD+YSPPDF
Sbjct  429  GCGFVKKPDFLLKSGPDGEVFDPKAKLPVQKTLKVKIYMGEGWYYDFHHTHFDAYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD  MKKT+  EDNW PVW EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  489  YVRVGIAGVPADTGMKKTRTLEDNWIPVWDEEFEFPLTVPELALLRIEVHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRA+PL DRKGEKYNSV+LL+R EFV
Sbjct  549  GGQTCLPVRELREGIRALPLHDRKGEKYNSVKLLVRLEFV  588



>ref|XP_002533650.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF28738.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=594

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY PLIGWMHGAQMVAFNMQG+GRSLWLMQGMFR+NG
Sbjct  375  EIVRFTQRNILRVYPKGIRVDSSNYNPLIGWMHGAQMVAFNMQGHGRSLWLMQGMFRANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+P+ +L VK TLKVKVYMG+GW+ DF +THFD+YSPPDF
Sbjct  435  GCGYVKKPDFLLKSGPHGEVFDPRAKLPVKTTLKVKVYMGEGWYYDFDRTHFDAYSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD +MKKTK  EDNW PVW EEF FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  495  YARVGIAGVPADTIMKKTKTLEDNWIPVWNEEFEFPLTVPELALLRVEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQ+CLPV+ELR GIRA+PL DRKG KYNSV+LL+RF+FV
Sbjct  555  GGQSCLPVSELRKGIRAIPLHDRKGVKYNSVKLLVRFDFV  594



>ref|XP_008805482.1| PREDICTED: phosphoinositide phospholipase C 6-like [Phoenix dactylifera]
Length=597

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N+LR+YPKGTRF SSNYKPL+GWMHGAQMVAFNMQGYGRSLWLM G FR+N
Sbjct  377  TDIVRFTQQNLLRIYPKGTRFTSSNYKPLVGWMHGAQMVAFNMQGYGRSLWLMHGFFRAN  436

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KK D L+  G + + F+PK    VKKTLKVKVYMGDGW +DFKQTHFD+YSPPD
Sbjct  437  GGCGYIKKADFLLKAGLDGQAFDPKKTFPVKKTLKVKVYMGDGWRMDFKQTHFDAYSPPD  496

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVPAD V KKT+  ED+WTPVW EEF FPLTVPELALLR+EVHE+D SEKDD
Sbjct  497  FYTKVGIAGVPADTVTKKTRTIEDDWTPVWDEEFSFPLTVPELALLRVEVHEYDFSEKDD  556

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL DRKG K+ SV+LLMRFE V
Sbjct  557  FGGQTCLPVSELRSGIRAVPLYDRKGMKFKSVKLLMRFESV  597



>gb|KHG10596.1| Phosphoinositide phospholipase C 4 [Gossypium arboreum]
Length=630

 Score =   375 bits (964),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 195/231 (84%), Gaps = 8/231 (3%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N LR+YPKGTRFNSSNYKP IGWMHGAQM+AFNMQGYGRSLWLMQGMFR+N
Sbjct  367  TDLVRFTQKNFLRIYPKGTRFNSSNYKPQIGWMHGAQMIAFNMQGYGRSLWLMQGMFRAN  426

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVG N E    + +L VKK L+VKVYMGDGWHLDFK THFD+YSPPD
Sbjct  427  GGCGYVKKPDFLMNVGANGE----RAKLPVKKRLRVKVYMGDGWHLDFKHTHFDTYSPPD  482

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+VGIAGVP DE+MKKTKIKEDNWTPVW EEF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  483  FYTKVGIAGVPDDEIMKKTKIKEDNWTPVWDEEFTFPLTVPELALLRVEVHEYDMSEKDD  542

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYN----SVRLLMRFEFV*CTVSF  108
            FAGQTCLPV+EL+ GIRAVPL DRKGEK      SV       F  C +SF
Sbjct  543  FAGQTCLPVSELKQGIRAVPLFDRKGEKTTYFAPSVVEATSASFSPCLLSF  593



>ref|XP_010654153.1| PREDICTED: phosphoinositide phospholipase C 2-like [Vitis vinifera]
Length=666

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D++ FTQ N+LRV+PK  R +SSNY PLIGWMHGAQMVAFNMQGY R LWLMQGMFR+NG
Sbjct  447  DIIRFTQRNLLRVFPKVMRVDSSNYNPLIGWMHGAQMVAFNMQGYDRPLWLMQGMFRANG  506

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+ VGP+ +VF+PK  L VK TLKVKVYMG+GWHLDF  THFD YSPPDF
Sbjct  507  GCGYVKKPDLLLKVGPHDKVFDPKANLPVKTTLKVKVYMGEGWHLDFHHTHFDIYSPPDF  566

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+VGIAGVPAD +MKKTK  ED+WTP W EEF FPLT PELALLRIEVHE+D+SEKDDF
Sbjct  567  YTKVGIAGVPADSLMKKTKAVEDDWTPTWNEEFEFPLTAPELALLRIEVHEYDMSEKDDF  626

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL ++KGEKYNSV+LLMRFEFV
Sbjct  627  GGQTCLPVSELRTGIRAVPLHNQKGEKYNSVKLLMRFEFV  666



>ref|XP_002316212.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEF02383.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=587

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R NSSNY PLIGWMHGAQMVAFNMQGYGRSLW+MQGMFR+NG
Sbjct  368  EIVRFTQRNILRVYPKGIRVNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWMMQGMFRANG  427

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD L+  GP+ EVF+PK +L V+KTLKVK+YMG+GW+ DF  THFD+YSPPDF
Sbjct  428  GCGFVKKPDFLLKSGPHGEVFDPKAKLPVQKTLKVKIYMGEGWYYDFHHTHFDAYSPPDF  487

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD  MKKT+  EDNW PVW E F FPLTVP+LALLRIEVHE+D+SEKDDF
Sbjct  488  YVRVGIAGVPADTGMKKTRTLEDNWIPVWDEGFEFPLTVPDLALLRIEVHEYDMSEKDDF  547

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL DRKGEKYNSV+LL+R EFV
Sbjct  548  GGQTCLPVRELREGIRAVPLHDRKGEKYNSVKLLVRLEFV  587



>emb|CDY71544.1| BnaUnng04440D, partial [Brassica napus]
Length=487

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP +GWM GAQM+AFNMQGYGR+LWLMQGMFR+N
Sbjct  267  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQVGWMSGAQMIAFNMQGYGRALWLMQGMFRAN  326

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+VGPN +VF+P      KKTLKVKV MGDGWHLDFK+THFD YSPPD
Sbjct  327  GGCGYVKKPDFLMSVGPNGQVFDPNENSSPKKTLKVKVLMGDGWHLDFKKTHFDLYSPPD  386

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAG PADE M+KT++K D WTP+W +EF F LTVPELALLR+EVHE+D +EKDD
Sbjct  387  FYVRVGIAGAPADETMEKTEVKYDTWTPIWNQEFTFKLTVPELALLRVEVHEYDANEKDD  446

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+  RLLMRF+FV
Sbjct  447  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSCTRLLMRFDFV  487



>gb|ABM90640.1| phospholipase C [Torenia fournieri]
Length=601

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N++RVYPKGTR +SSN+ P+IGW+HGAQMVAFNMQ +GRSLWLMQG+FR+N
Sbjct  381  TDIVRFTQKNLMRVYPKGTRIDSSNFNPMIGWVHGAQMVAFNMQTHGRSLWLMQGIFRAN  440

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+ VGP+ EVF+PK  L VKKTLKVKV+MG+GW+LDF +THFD YSPPD
Sbjct  441  GGCGYVKKPDFLLRVGPHNEVFDPKAHLPVKKTLKVKVHMGEGWNLDFSRTHFDLYSPPD  500

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY ++GIAGVP+D VMKKTK+ EDNW PVW EEF FPLTVPELALLRIEVHE D+S+KDD
Sbjct  501  FYVKIGIAGVPSDTVMKKTKVVEDNWAPVWNEEFEFPLTVPELALLRIEVHESDMSDKDD  560

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIR+VPL D KGEKY SV+LLMRF F 
Sbjct  561  FGGQTCLPVSELRKGIRSVPLYDHKGEKYKSVKLLMRFHFT  601



>ref|XP_011077556.1| PREDICTED: phosphoinositide phospholipase C 2-like [Sesamum indicum]
Length=593

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N++RVYPKGTR +SSNY PLIGWMHGAQMVAFNMQG+GRSLWLMQGMFR+N
Sbjct  373  TEIVRFTQRNLMRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNMQGHGRSLWLMQGMFRAN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+N+GP+ EVF+PK RL V+KTLKVKVYMG+GW+LDF  THFD YSPPD
Sbjct  433  GGCGYVKKPDFLLNLGPDDEVFDPKRRLPVRKTLKVKVYMGEGWNLDFHHTHFDLYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY ++GIAGVP D  MK+TK  EDNW P W EEF FPLTVPELALLRIEVHE D+S+KDD
Sbjct  493  FYVKIGIAGVPYDSAMKRTKTIEDNWLPAWNEEFEFPLTVPELALLRIEVHEFDMSDKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL D KG+KY SV+LL+RF+FV
Sbjct  553  FGGQTCLPVSELKTGIRAVPLHDYKGDKYKSVKLLLRFDFV  593



>ref|XP_010483471.1| PREDICTED: phosphoinositide phospholipase C 4 isoform X1 [Camelina 
sativa]
Length=598

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  378  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  437

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  438  GGCGYVKKPDFLMNVGPNGQGFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  497

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDD
Sbjct  498  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDKNEKDD  557

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  558  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  598



>gb|KDO68973.1| hypothetical protein CISIN_1g007399mg [Citrus sinensis]
Length=374

 Score =   365 bits (938),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKG R +SSNY PLIGW HGAQMVAFNMQG+GRSLWLM GMFR+N
Sbjct  154  NDIVRFTQRNLLRIYPKGIRVDSSNYNPLIGWSHGAQMVAFNMQGHGRSLWLMHGMFRAN  213

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ L+  GP+ EVF+PK +L  KKTLKV VYMG+GW+ DF  THFD+YSPPD
Sbjct  214  GGCGYVKKPNFLLQTGPHNEVFDPKVKLPAKKTLKVTVYMGEGWYYDFPHTHFDAYSPPD  273

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKTK  EDNW P W EEF FPL+VPELALLRIEVHE+D+SEKDD
Sbjct  274  FYARVGIAGVPADTVMKKTKTLEDNWIPSWNEEFEFPLSVPELALLRIEVHEYDMSEKDD  333

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL DRKGE+Y SV+LLM FEF+
Sbjct  334  FGGQTCLPVSELKQGIRAVPLHDRKGERYKSVKLLMHFEFI  374



>emb|CAM92313.1| phospholipase C [Vigna radiata]
Length=591

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  372  EIIRFTQRNILRVYPKGTRIASTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G N EVF+PK RL VKKTLKV +YMG+GW  DFK THFD YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGLNNEVFDPKARLPVKKTLKVTIYMGEGWFHDFKHTHFDQYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  EDNW+P W EEF FPL+VPELALLR+EVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPYDTVMKKTKSVEDNWSPSWNEEFKFPLSVPELALLRVEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKGEKY++V+LLMRFEF+
Sbjct  552  GGQTCLPVWELRSGIRAVPLYSRKGEKYHNVKLLMRFEFI  591



>ref|XP_010534598.1| PREDICTED: phosphoinositide phospholipase C 6 [Tarenaya hassleriana]
Length=604

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 189/218 (87%), Gaps = 0/218 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ N+LR+YPKGTRFNSSNYKPL+GW HGAQM+AFNMQGYG+SLWLM GMFR+N
Sbjct  384  TDVVRFTQRNLLRIYPKGTRFNSSNYKPLVGWTHGAQMIAFNMQGYGKSLWLMHGMFRAN  443

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+  P  EVF+PK +L VK+TLKVKVYMGDGW LDF  THFD+YSPPD
Sbjct  444  GGCGYVKKPDFLMDQDPKEEVFDPKKKLPVKQTLKVKVYMGDGWRLDFSHTHFDTYSPPD  503

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPAD   KKT+I EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  504  FYTKLYIVGVPADNASKKTRIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDD  563

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRF  135
            F GQTCLPVAELR GIRAVPL D+KGEK  SVRLLMRF
Sbjct  564  FGGQTCLPVAELRQGIRAVPLYDKKGEKLKSVRLLMRF  601



>emb|CAK32509.1| phospholipase C [Vigna radiata]
 emb|CAL59449.1| phospholipase C [Vigna radiata]
Length=591

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  372  EIIRFTQRNILRVYPKGTRIASTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G N EVF+PK RL VKKTLKV +YMG+GW  DFK THFD YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGLNNEVFDPKARLPVKKTLKVTIYMGEGWFHDFKHTHFDQYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  EDNW+P W EEF FPL+VPELALLR+EVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPYDTVMKKTKSVEDNWSPSWNEEFKFPLSVPELALLRVEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKGEKY++V+LLMRFEF+
Sbjct  552  GGQTCLPVWELRSGIRAVPLYSRKGEKYHNVKLLMRFEFI  591



>emb|CAK32510.1| phospholipase C [Vigna radiata]
 gb|AIM62180.1| phospholipase C [Vigna radiata]
Length=591

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  372  EIIRFTQRNILRVYPKGTRIASTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G N EVF+PK RL VKKTLKV +YMG+GW  DFK THFD YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGLNNEVFDPKARLPVKKTLKVTIYMGEGWFHDFKHTHFDQYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  EDNW+P W EEF FPL+VPELALLR+EVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPYDTVMKKTKSVEDNWSPSWNEEFKFPLSVPELALLRVEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKGEKY++V+LLMRFEF+
Sbjct  552  GGQTCLPVWELRSGIRAVPLYSRKGEKYHNVKLLMRFEFI  591



>gb|AAQ95730.1| phospholipase C [Vigna radiata]
Length=591

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  372  EIIRFTQRNILRVYPKGTRIASTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G N EVF+PK RL VKKTLKV +YMG+GW  DFK THFD YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGLNNEVFDPKARLPVKKTLKVTIYMGEGWFHDFKHTHFDQYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  EDNW+P W EEF FPL+VPELALLR+EVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPYDTVMKKTKSVEDNWSPSWNEEFKFPLSVPELALLRVEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKGEKY++V+LLMRFEF+
Sbjct  552  GGQTCLPVWELRSGIRAVPLYSRKGEKYHNVKLLMRFEFI  591



>ref|XP_006279487.1| hypothetical protein CARUB_v10026125mg [Capsella rubella]
 gb|EOA12385.1| hypothetical protein CARUB_v10026125mg [Capsella rubella]
Length=596

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  376  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  435

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN + + PK  L  KKTLKVKV+MGDGW LDFK+THFD YSPPD
Sbjct  436  GGCGYVKKPDFLMNVGPNGKGYYPKDNLSPKKTLKVKVFMGDGWLLDFKKTHFDLYSPPD  495

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDD
Sbjct  496  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDANEKDD  555

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  556  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  596



>ref|XP_002316213.2| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEF02384.2| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=595

 Score =   372 bits (956),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTR  SSNYKPL+GWMHGAQM+AFNMQGYG+SLWLM GMFR+N
Sbjct  375  TDVVRFTQNNILRIYPKGTRITSSNYKPLVGWMHGAQMIAFNMQGYGKSLWLMHGMFRAN  434

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD LM  GPN EVF+PK +L V KTLKVKVY+GDGW LDF  THFDSYSPPD
Sbjct  435  GGCGYLKKPDFLMEKGPNNEVFDPKIKLAVTKTLKVKVYLGDGWRLDFSHTHFDSYSPPD  494

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I G PAD   KKTKI EDNW+P W +EF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  495  FYTKVYIVGAPADAAKKKTKIIEDNWSPAWNQEFTFPLTVPELALLRIEVREYDMSEKDD  554

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV++LRPGIR+VPL D+KGEK  +VRLL+ F+FV
Sbjct  555  FGGQTCLPVSDLRPGIRSVPLHDKKGEKLKNVRLLVGFQFV  595



>ref|XP_009772725.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana sylvestris]
Length=588

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFRSNG
Sbjct  369  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRSNG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN ++F+P+  L VK TLKV V+MG+GW+ DFK THFD+YSPPDF
Sbjct  429  GCGYVKKPDILLKAGPNNQIFDPEANLPVKTTLKVTVFMGEGWYYDFKHTHFDAYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKTK  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  489  YAKIGIAGVPADNVMKKTKTLEDNWIPTWDEKFEFPLTVPELALLRVEVHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFEFV
Sbjct  549  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEFV  588



>ref|NP_001235310.1| phosphoinositide-specific phospholipase C P13 [Glycine max]
 gb|AAB03258.1| phosphoinositide-specific phospholipase C P13 [Glycine max]
Length=600

 Score =   372 bits (956),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKGTR +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+NGG
Sbjct  380  IVRFTQRNILRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRANGG  439

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKP+ L+  GP+ EVFNPK +L VK TLKV VYMG+GW+ DFK THFD YSPPDFY
Sbjct  440  CGYVKKPNFLLETGPDDEVFNPKAKLPVKTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFY  499

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVP D +MK+TK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  500  TRVGIAGVPNDTIMKRTKAIEDNWLPTWNEAFEFPLTVPELALLRIEVHEYDMSEKDDFG  559

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLP+ ELR GIRA+PL  +KG+KYN+V+LLMRFEF+
Sbjct  560  GQTCLPIWELRSGIRAIPLHSQKGDKYNTVKLLMRFEFI  598



>ref|XP_009772724.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana sylvestris]
Length=589

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFRSNG
Sbjct  370  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRSNG  429

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN ++F+P+  L VK TLKV V+MG+GW+ DFK THFD+YSPPDF
Sbjct  430  GCGYVKKPDILLKAGPNNQIFDPEANLPVKTTLKVTVFMGEGWYYDFKHTHFDAYSPPDF  489

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKTK  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  490  YAKIGIAGVPADNVMKKTKTLEDNWIPTWDEKFEFPLTVPELALLRVEVHEYDMSEKDDF  549

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFEFV
Sbjct  550  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEFV  589



>ref|XP_009126743.1| PREDICTED: phosphoinositide phospholipase C 4 [Brassica rapa]
Length=594

 Score =   372 bits (955),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP +GWM GAQM+AFNMQGYGR+LWLMQGMFR+N
Sbjct  374  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQVGWMSGAQMIAFNMQGYGRALWLMQGMFRAN  433

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN +VF+P      KKTLKVKV MGDGWHLDFK+THFD YSPPD
Sbjct  434  GGCGYVKKPDFLMNVGPNGQVFDPNENSSPKKTLKVKVLMGDGWHLDFKKTHFDLYSPPD  493

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGI+G PADE M+KT++K D WTP+W +EF F LTVPELALLR+EVHE+D +EKDD
Sbjct  494  FYVRVGISGAPADETMEKTEVKYDTWTPIWNQEFTFKLTVPELALLRVEVHEYDANEKDD  553

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+  RLLMRF+FV
Sbjct  554  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSCTRLLMRFDFV  594



>ref|XP_009133410.1| PREDICTED: phosphoinositide phospholipase C 6-like [Brassica 
rapa]
Length=612

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYGRSLWLM GMFR+NG
Sbjct  393  DVVRFTQKNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGRSLWLMHGMFRANG  452

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+PK +LHVK+TLKVKVYMGDGW LDF  THFD+YSPPDF
Sbjct  453  GCGYVKKPNFLMKKGFHDEVFDPKKKLHVKETLKVKVYMGDGWRLDFSHTHFDTYSPPDF  512

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+V I GVPAD   +KT++ EDNW P+W EEF FPLTVPELALLRIEV E+D+S+KDDF
Sbjct  513  YTKVFIVGVPADNAKRKTRVIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSDKDDF  572

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  573  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  611



>gb|KDP44771.1| hypothetical protein JCGZ_01271 [Jatropha curcas]
Length=591

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMF++NG
Sbjct  372  EIVRFTQRNILRVYPKGIRVDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+    N EVF+P+ +L VK TLKVKVYMG+GW+ DFK+THFD+YSPPDF
Sbjct  432  GCGYVKKPDFLLKPNSNGEVFDPRAKLPVKTTLKVKVYMGEGWYYDFKRTHFDAYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD +MKKTK  EDNW PVW EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPADTIMKKTKTLEDNWIPVWNEEFEFPLTVPELALLRIEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+E+  GIRA+PL D+KG KYNSV+LLMRF+FV
Sbjct  552  GGQTCLPVSEISRGIRAIPLHDQKGVKYNSVKLLMRFDFV  591



>ref|XP_007016094.1| Phosphatidylinositol-speciwc phospholipase C4 isoform 1 [Theobroma 
cacao]
 gb|EOY33713.1| Phosphatidylinositol-speciwc phospholipase C4 isoform 1 [Theobroma 
cacao]
Length=596

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T+VV FTQ NILR+YP+GTR NSSNY PLIGWMHGAQMVA NMQGYG+SLWLM GMFRSN
Sbjct  372  TEVVRFTQRNILRIYPRGTRVNSSNYNPLIGWMHGAQMVALNMQGYGKSLWLMHGMFRSN  431

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ LMNVGPN +VF+PK +L VKK LKVKVYMGDGWHLDFKQ H + +SPP+
Sbjct  432  GGCGYVKKPEFLMNVGPNDQVFDPKAKLPVKKILKVKVYMGDGWHLDFKQRHLNHWSPPE  491

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGI GVPAD+ M+KTK +  NWT VW EEF++PLTVPE+ALLR+EVHE+++SEKD 
Sbjct  492  FYTRVGIEGVPADKTMRKTKKRNGNWTLVWDEEFIYPLTVPEIALLRVEVHEYNMSEKDY  551

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV+ELRPGIRAVPL +RKGEK+ S+ LLMRFEFV
Sbjct  552  FAGQTCLPVSELRPGIRAVPLFNRKGEKFTSLGLLMRFEFV  592



>ref|XP_004490994.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cicer arietinum]
Length=588

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRV+PKGTR +SSNY PLIGW HGAQMVAFNMQGYGRSLWLMQGMFR+NG
Sbjct  369  EIVRFTQRNILRVFPKGTRIDSSNYNPLIGWSHGAQMVAFNMQGYGRSLWLMQGMFRANG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK++L VK TLKV VYMG+GW+ DFK THFD YSPPDF
Sbjct  429  GCGYVKKPDFLLETGPDNEVFDPKSKLPVKTTLKVTVYMGEGWYYDFKHTHFDQYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D +M+KTK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  489  YARVGIAGVPNDSIMRKTKAIEDNWLPTWNEVFEFPLTVPELALLRIEVHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELR GIR+V L  +KGEKYNSV+LLMRFEF
Sbjct  549  GGQTCLPVSELRSGIRSVSLHSQKGEKYNSVKLLMRFEF  587



>ref|NP_001032097.1| phosphoinositide phospholipase C 4 [Arabidopsis thaliana]
 dbj|BAH19832.1| AT5G58700 [Arabidopsis thaliana]
 gb|AED97087.1| phosphoinositide phospholipase C 4 [Arabidopsis thaliana]
Length=489

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  269  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  328

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+  PN + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  329  GGCGYVKKPDFLMDASPNGQDFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  388

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD++EKDD
Sbjct  389  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDVNEKDD  448

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+E+R GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  449  FGGQTCLPVSEIRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  489



>emb|CDX80341.1| BnaC09g34010D [Brassica napus]
Length=590

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLMQGMFR+N
Sbjct  370  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMQGMFRAN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN +VF+P      KKTLKVKV MGDGWHLDFK+THFD YSPPD
Sbjct  430  GGCGYVKKPDFLMNVGPNGQVFDPNENSSPKKTLKVKVLMGDGWHLDFKKTHFDRYSPPD  489

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAG PAD+ M+KT++K + WTP+W EEF F L VPELALLR+EVHE+D +EKDD
Sbjct  490  FYVKVGIAGAPADKSMEKTEVKYNTWTPIWNEEFTFQLIVPELALLRVEVHEYDNNEKDD  549

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  550  FGGQTCLPVSELRQGIRAVPLYNRKGVKYSSTRLLMRFEFV  590



>ref|XP_002311222.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEE88589.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=590

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTR  SSNYKPL+GWMHGAQM+AFNMQGYG+SLWLM GMFR+N
Sbjct  370  TDVVRFTQNNILRIYPKGTRITSSNYKPLVGWMHGAQMIAFNMQGYGKSLWLMHGMFRAN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD L+  GPN EVF+PKT+L V KTL VKVY+GDGW LDF  THFDSYSPPD
Sbjct  430  GGCGYLKKPDFLLEKGPNNEVFDPKTKLPVTKTLNVKVYLGDGWRLDFSHTHFDSYSPPD  489

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I GVPAD   +KTKI EDNW+P W EEF FPLTVPELALLR+EV E+D+S+KDD
Sbjct  490  FYTKVYIVGVPADAAKRKTKIIEDNWSPAWNEEFTFPLTVPELALLRVEVQEYDMSDKDD  549

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV +LRPGIR+VPL D+KGEK  +VRLLM F+FV
Sbjct  550  FGGQTCLPVLDLRPGIRSVPLHDKKGEKLKNVRLLMGFQFV  590



>emb|CAM92314.1| phospholipase C [Vigna radiata]
Length=591

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  372  EIIRFTQRNILRVYPKGTRIASTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G N EVF+PK RL VKKTLKV +YMG+GW  DFK THFD YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGLNNEVFDPKARLPVKKTLKVTIYMGEGWFQDFKHTHFDQYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  EDNW+P W EEF FPL+VPELALLR+EVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPYDTVMKKTKSVEDNWSPSWNEEFKFPLSVPELALLRVEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKGEKY++V+L MRFEF+
Sbjct  552  GGQTCLPVWELRSGIRAVPLYSRKGEKYHNVKLQMRFEFI  591



>ref|XP_010264635.1| PREDICTED: phosphoinositide phospholipase C 2 isoform X2 [Nelumbo 
nucifera]
Length=586

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 194/221 (88%), Gaps = 3/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             +++ FTQ N+LR+YPKG RF+SSNY PL+GWM+GAQMVA NMQGYGRSLWLM GMFR+N
Sbjct  369  AEIIRFTQQNLLRIYPKGIRFDSSNYNPLLGWMYGAQMVALNMQGYGRSLWLMHGMFRTN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+N     + F+PK  L VKKTLK++VYMG+GW+ DFK+THFD+YSPPD
Sbjct  429  GGCGYVKKPDFLLNAN---KAFDPKATLPVKKTLKMRVYMGEGWNFDFKRTHFDNYSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  486  FYTRVGIAGVPADSVMKKTKTIEDDWTPVWDEEFEFPLTVPELALLRIEVHEYDMSEKDD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL  RKGEKY+SV+LLMRF+FV
Sbjct  546  FGGQTCLPVSELRTGIRAVPLHSRKGEKYSSVKLLMRFQFV  586



>ref|XP_003616636.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AES99594.1| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=589

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +VV FTQ NILRV+PKGTR +SSNY PLIGW+HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  370  EVVRFTQKNILRVFPKGTRIDSSNYNPLIGWIHGAQMVAFNMQGYGRSLWLMHGMFRANG  429

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK +L VK TLKV VYMG+GW+ DFK THFD YSPPDF
Sbjct  430  GCGYVKKPDFLLTTGPDNEVFDPKAKLPVKTTLKVTVYMGEGWYYDFKHTHFDQYSPPDF  489

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP+D +MKKT+  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  490  YARVGIAGVPSDSIMKKTRAIEDNWLPTWNEVFEFPLTVPELALLRIEVHEYDMSEKDDF  549

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELR G+RAV L  +KG+KYNSV+LLMRFEF
Sbjct  550  GGQTCLPVSELRSGVRAVSLHSQKGDKYNSVKLLMRFEF  588



>ref|XP_010264634.1| PREDICTED: phosphoinositide phospholipase C 2 isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 194/221 (88%), Gaps = 3/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             +++ FTQ N+LR+YPKG RF+SSNY PL+GWM+GAQMVA NMQGYGRSLWLM GMFR+N
Sbjct  370  AEIIRFTQQNLLRIYPKGIRFDSSNYNPLLGWMYGAQMVALNMQGYGRSLWLMHGMFRTN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+N     + F+PK  L VKKTLK++VYMG+GW+ DFK+THFD+YSPPD
Sbjct  430  GGCGYVKKPDFLLNAN---KAFDPKATLPVKKTLKMRVYMGEGWNFDFKRTHFDNYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  ED+WTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADSVMKKTKTIEDDWTPVWDEEFEFPLTVPELALLRIEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL  RKGEKY+SV+LLMRF+FV
Sbjct  547  FGGQTCLPVSELRTGIRAVPLHSRKGEKYSSVKLLMRFQFV  587



>ref|XP_008233757.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Prunus mume]
Length=592

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW HGAQMVAFNMQGYGRSLW+MQGMFR+NG
Sbjct  373  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNMQGYGRSLWVMQGMFRANG  432

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK +L VK TLKVKVY+G+GW+ DFK THFD+YSPPDF
Sbjct  433  GCGYVKKPDFLLKTGPHNEVFDPKYKLPVKTTLKVKVYVGEGWYYDFKHTHFDAYSPPDF  492

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  ED+W P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  493  YARVGIAGVAADSVMKKTKTLEDDWIPAWDEEFEFPLTVPELAVLRIEVHEYDMSEKDDF  552

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RKGEKY SV+LLM FEFV
Sbjct  553  GGQTCLPVSELRKGIRAVPLHSRKGEKYKSVKLLMHFEFV  592



>ref|XP_008233758.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Prunus mume]
Length=591

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW HGAQMVAFNMQGYGRSLW+MQGMFR+NG
Sbjct  372  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNMQGYGRSLWVMQGMFRANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK +L VK TLKVKVY+G+GW+ DFK THFD+YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGPHNEVFDPKYKLPVKTTLKVKVYVGEGWYYDFKHTHFDAYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  ED+W P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  492  YARVGIAGVAADSVMKKTKTLEDDWIPAWDEEFEFPLTVPELAVLRIEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RKGEKY SV+LLM FEFV
Sbjct  552  GGQTCLPVSELRKGIRAVPLHSRKGEKYKSVKLLMHFEFV  591



>dbj|BAO02533.1| predicted phospholipase C ortholog [Nicotiana alata]
Length=588

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFRSNG
Sbjct  369  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRSNG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GP+ ++F+P+  L VK TLKV V+MG+GW+ DFK THFD+YSPPDF
Sbjct  429  GCGYVKKPDILLKAGPDNQIFDPEANLPVKTTLKVTVFMGEGWYYDFKHTHFDAYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKTK  EDNW P W E+F FPLTVPELALLR+E+HE+D+SEKDDF
Sbjct  489  YAKIGIAGVPADNVMKKTKTLEDNWIPTWNEKFEFPLTVPELALLRVEIHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFEFV
Sbjct  549  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEFV  588



>gb|AAN75042.1| phosphoinositide-specific phospholipase C 8 [Arabidopsis thaliana]
Length=544

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  325  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  384

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  385  GCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  444

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   KKTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  445  YTKMFIVGVPADNAKKKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  504

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPVAELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  505  GGQTCLPVAELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  543



>ref|XP_010520201.1| PREDICTED: phosphoinositide phospholipase C 4 [Tarenaya hassleriana]
Length=586

 Score =   370 bits (949),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 189/221 (86%), Gaps = 4/221 (2%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV  FTQ N LR+YPKGTRFNSSNYKP IGWMHGAQM+AFNMQGYGR+LWLM GMFR+N
Sbjct  370  TDVNRFTQKNFLRIYPKGTRFNSSNYKPQIGWMHGAQMIAFNMQGYGRALWLMHGMFRAN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM  GP+ EVF+      VKKTLKVKV MGDGW +DFK THFD YSPPD
Sbjct  430  GGCGYVKKPDFLMKAGPSGEVFDST----VKKTLKVKVCMGDGWQVDFKLTHFDLYSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAG PADEVM KTKIK +NWTPVW EEF FPLT PELALLR+EVHE+D SEKDD
Sbjct  486  FYVKVGIAGAPADEVMAKTKIKFNNWTPVWNEEFTFPLTAPELALLRVEVHEYDTSEKDD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR G+RAVPL D+KGEKY+S RLL+RFEFV
Sbjct  546  FGGQTCLPVSELRQGLRAVPLFDQKGEKYSSTRLLLRFEFV  586



>gb|EYU20012.1| hypothetical protein MIMGU_mgv1a003407mg [Erythranthe guttata]
Length=587

 Score =   370 bits (949),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ N+LRVYPKG RF+SSNY PLIGWMHGAQMVAFNMQGYGRSLW+M GMF++NG
Sbjct  368  DIVRFTQRNLLRVYPKGIRFDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWVMHGMFKANG  427

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+      EVF+P+  L VK TL+V VYMG+GW+ DF+ THFD+YSPPDF
Sbjct  428  GCGYVKKPDFLLKADSYGEVFDPRATLPVKTTLRVTVYMGEGWYFDFRHTHFDAYSPPDF  487

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD +MKKTK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  488  YARVGIAGVPADTIMKKTKTLEDNWIPNWDEVFEFPLTVPELALLRIEVHEYDMSEKDDF  547

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL  RKGEKYNSV+LLMRFEFV
Sbjct  548  AGQTCLPVNELRKGIRAVPLSSRKGEKYNSVKLLMRFEFV  587



>ref|XP_008793309.1| PREDICTED: phosphoinositide phospholipase C 2-like [Phoenix dactylifera]
Length=597

 Score =   370 bits (949),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY PL+GWM+GAQMVA NMQGYGR+LWL+ GMFR+N
Sbjct  368  TEIVRFTQNNLLRIYPKGTRVTSSNYSPLLGWMYGAQMVALNMQGYGRALWLVHGMFRAN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L++  P+  VF+PK  L VKK LKV+VYMGDGW  DF  THFD+YSPPD
Sbjct  428  GGCGYVKKPDFLLDNDPD-HVFDPKGTLPVKKILKVRVYMGDGWRFDFHHTHFDTYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMK+TK  EDNWTPVW E+F+FPLTVPELALLRIEVHE+D+S+ DD
Sbjct  487  FYTRVGIAGVPADTVMKRTKAIEDNWTPVWDEDFIFPLTVPELALLRIEVHEYDMSDTDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            FAGQTCLPV+ELRPGIR+VPLCDRKGE   SV+LLMRFEF
Sbjct  547  FAGQTCLPVSELRPGIRSVPLCDRKGETLKSVKLLMRFEF  586



>ref|XP_007220553.1| hypothetical protein PRUPE_ppa003223mg [Prunus persica]
 gb|EMJ21752.1| hypothetical protein PRUPE_ppa003223mg [Prunus persica]
Length=591

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW HGAQMVAFNMQGYGRSLW+MQGMFR+N 
Sbjct  372  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNMQGYGRSLWVMQGMFRANS  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK +L VK TLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  432  GCGYVKKPDFLLKTGPHNEVFDPKYKLPVKTTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  ED+W P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  492  YARVGIAGVAADSVMKKTKTLEDDWIPAWDEEFEFPLTVPELAVLRIEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RKGEKY SV+LLM FEFV
Sbjct  552  GGQTCLPVSELRKGIRAVPLHSRKGEKYKSVKLLMHFEFV  591



>ref|XP_011076692.1| PREDICTED: phosphoinositide phospholipase C 2-like [Sesamum indicum]
Length=587

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ N+LRVYPKG RF+SSNY PLIGW HGAQMVAFNMQGYGRSLWLM GMF++NG
Sbjct  368  DIVRFTQRNLLRVYPKGIRFDSSNYNPLIGWSHGAQMVAFNMQGYGRSLWLMHGMFKANG  427

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ L+    N  VF+PK  L VK TL+V VYMG+GW+ DFK THFD+YSPPDF
Sbjct  428  GCGYVKKPEFLLQADSNGNVFDPKAILPVKTTLRVTVYMGEGWYYDFKHTHFDAYSPPDF  487

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  488  YARVGIAGVPADTVMKKTKTLEDNWIPTWDEVFEFPLTVPELALLRIEVHEYDMSEKDDF  547

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL  RKGEKYNSV+LLMRFEFV
Sbjct  548  AGQTCLPVRELRQGIRAVPLHSRKGEKYNSVKLLMRFEFV  587



>emb|CBI15950.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   368 bits (945),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LRVYPK TRFNSSNYKPLIGWMHG Q++AFNMQG+GRSLWLM GMFR+NG
Sbjct  333  DVVRFTQKNLLRVYPKATRFNSSNYKPLIGWMHGVQLLAFNMQGHGRSLWLMHGMFRANG  392

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+NV P+ +VF+PK +L VKKTLKV+VY+GDGW+ DFK+THFD YSPPDF
Sbjct  393  GCGYVKKPDFLLNVSPHNQVFDPKAKLPVKKTLKVRVYLGDGWNFDFKKTHFDFYSPPDF  452

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAG  AD+ MK+TK K++NW PVW EEF FPLTVPELALLRIEV+E+++ EKD F
Sbjct  453  YTRVGIAGAAADKTMKETKKKQNNWKPVWNEEFTFPLTVPELALLRIEVYEYNMPEKDMF  512

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL +RKGE Y+SVRLLM F+FV
Sbjct  513  AGQTCLPVWELRQGIRAVPLFNRKGEMYSSVRLLMSFQFV  552



>ref|XP_011045853.1| PREDICTED: phosphoinositide phospholipase C 6 isoform X1 [Populus 
euphratica]
 ref|XP_011042809.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Populus euphratica]
Length=614

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTR  SSNYKP++GWMHGAQM+AFNMQGYG+SLWLM GMFR+N
Sbjct  394  TDVVRFTQNNILRIYPKGTRITSSNYKPIVGWMHGAQMIAFNMQGYGKSLWLMHGMFRAN  453

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD L+  GPN EVF+PKT+L V KTL VKVY+GDGW LDF  THFDSYSPPD
Sbjct  454  GGCGYLKKPDFLLEKGPNNEVFDPKTKLPVTKTLNVKVYLGDGWRLDFSHTHFDSYSPPD  513

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I GVPAD   +KTKI EDNW+P W EEF FPLTVPELALLR+EV E+D+S+KDD
Sbjct  514  FYTKVYIVGVPADAAKRKTKIIEDNWSPAWNEEFTFPLTVPELALLRVEVQEYDMSDKDD  573

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV +LRPGIR+VPL D+KGEK  +VRLLM F+FV
Sbjct  574  FGGQTCLPVLDLRPGIRSVPLHDKKGEKLKNVRLLMGFQFV  614



>ref|XP_006435740.1| hypothetical protein CICLE_v10031029mg [Citrus clementina]
 ref|XP_006486316.1| PREDICTED: phosphoinositide phospholipase C 2-like [Citrus sinensis]
 gb|ESR48980.1| hypothetical protein CICLE_v10031029mg [Citrus clementina]
Length=591

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKG R +SSNY PLIGW HGAQMVAFNMQGYGRSLWLM GMFR+N
Sbjct  371  NDIVRFTQRNLLRIYPKGIRVDSSNYNPLIGWSHGAQMVAFNMQGYGRSLWLMHGMFRAN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ L+  GP+ EVF+PK +L  KKTLKV VYMG+GW+ DF  THFD+YSPPD
Sbjct  431  GGCGYVKKPNFLLQTGPHNEVFDPKVKLPAKKTLKVTVYMGEGWYYDFPHTHFDAYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKTK  EDNW P W EEF FPL+VPELALLRIEVHE+D+SEKDD
Sbjct  491  FYARVGIAGVPADTVMKKTKTLEDNWIPSWNEEFEFPLSVPELALLRIEVHEYDMSEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL D KGE+Y SV+LLMRFEF+
Sbjct  551  FGGQTCLPVSELKQGIRAVPLHDHKGERYKSVKLLMRFEFI  591



>ref|NP_001236167.1| phosphatidylinositol-specific phospholipase C [Glycine max]
 gb|AAA74441.1| phosphatidylinositol-specific phospholipase C [Glycine max]
Length=600

 Score =   369 bits (948),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKGTR +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+NGG
Sbjct  380  IVRFTQRNILRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRANGG  439

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKP+ L+  GP+ EVFNPK +L VK TLKV VYMG+GW+ DFK THFD YSPPDFY
Sbjct  440  CGYVKKPNFLLETGPDDEVFNPKAKLPVKTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFY  499

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVP D +MK+TK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  500  TRVGIAGVPNDTIMKRTKAIEDNWLPTWNEVFEFPLTVPELALLRIEVHEYDMSEKDDFG  559

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQ CLP+ ELR GIRA+PL  +KG+KYN+V+LLMRFEF+
Sbjct  560  GQACLPIWELRSGIRAIPLHSQKGDKYNTVKLLMRFEFI  598



>ref|XP_010454132.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Camelina sativa]
Length=580

 Score =   369 bits (946),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQG+GR+LWLM+GMFR+N
Sbjct  360  TDVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGHGRALWLMEGMFRAN  419

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV P  + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  420  GGCGYVKKPDFLMNVDPTGQSFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  479

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDD
Sbjct  480  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDNNEKDD  539

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  540  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  580



>ref|XP_007008968.1| Phospholipase C 2 [Theobroma cacao]
 gb|EOY17778.1| Phospholipase C 2 [Theobroma cacao]
Length=586

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKG R +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMF++NGG
Sbjct  364  IVRFTQRNILRVYPKGIRVDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFKANGG  423

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD L+  GP+ +VF+P  RL VK  LKV VYMG+GW+ DF  THFD+YSPPDFY
Sbjct  424  CGYVKKPDFLLKSGPHDDVFDPSVRLPVKTVLKVTVYMGEGWYHDFHHTHFDAYSPPDFY  483

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
             RVGIAGVPAD VMKKTK  EDNW P W EEF FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  484  ARVGIAGVPADNVMKKTKTLEDNWVPSWNEEFEFPLTVPELALLRIEVHEYDMSEKDDFG  543

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            GQTCLPV+ELR GIRAVPL  RKG+KYNSV+LLMRFE 
Sbjct  544  GQTCLPVSELRSGIRAVPLNSRKGDKYNSVKLLMRFEL  581



>gb|KDP44772.1| hypothetical protein JCGZ_01272 [Jatropha curcas]
Length=361

 Score =   361 bits (926),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 188/220 (85%), Gaps = 2/220 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTR  SSNYKP+IGWMHGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  144  DLVRFTQENILRVYPKGTRITSSNYKPIIGWMHGAQMIAFNMQGYGKSLWLMHGMFRANG  203

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGY+KKPD LM+ GP  +VF+PK  L V KTLKVKVY+GDGW LDF  THFD+YSPPDF
Sbjct  204  GCGYLKKPDFLMHKGP--DVFDPKRALSVIKTLKVKVYLGDGWRLDFSHTHFDAYSPPDF  261

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   KKTKI  DNW P W EEF FPLTVPELALLRIE+ E+D+SEKDDF
Sbjct  262  YTKLYIVGVPADAAKKKTKIICDNWVPAWNEEFTFPLTVPELALLRIEIREYDMSEKDDF  321

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELRPGIR+VPL DRKGE++N+ RLLM+FEFV
Sbjct  322  GGQTCLPVPELRPGIRSVPLHDRKGERFNNTRLLMKFEFV  361



>gb|ABC50164.1| phospholipase C [Petunia integrifolia subsp. inflata]
Length=588

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  369  EIVRFTQRNMLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN EVF+P+  L VK TLKV V+MG+GW+ DF  THFD+YSPPDF
Sbjct  429  GCGYVKKPDILLKAGPNNEVFDPEANLPVKTTLKVTVFMGEGWYYDFDHTHFDAYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  489  YAKIGIAGVPADNVMKKTKTLEDNWIPNWDETFEFPLTVPELALLRVEVHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPVAELR GIRAV L +RKGEKYNSV+LLMRFEF+
Sbjct  549  AGQTCLPVAELRQGIRAVALHNRKGEKYNSVKLLMRFEFI  588



>gb|KFK27404.1| hypothetical protein AALP_AA8G378600 [Arabis alpina]
Length=593

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQG+GR+LWLMQGMFR+N
Sbjct  373  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGHGRALWLMQGMFRAN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGPN EVF+       KKTLKVKV MGDGW LDF +THFD+YSPPD
Sbjct  433  GGCGYVKKPDFLMNVGPNGEVFDLNENSSPKKTLKVKVCMGDGWQLDFNKTHFDNYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAG PADE M+KTKIK D WTP+W EEF F LTVPELALLR+EVHE+D +EKDD
Sbjct  493  FYVRVGIAGAPADEAMEKTKIKYDTWTPIWNEEFTFQLTVPELALLRVEVHEYDKNEKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAV L +RKGEKY+  RLLMRFEFV
Sbjct  553  FGGQTCLPVSELRQGIRAVLLFNRKGEKYSFTRLLMRFEFV  593



>ref|XP_002269949.1| PREDICTED: phosphoinositide phospholipase C 2 [Vitis vinifera]
 emb|CAN64084.1| hypothetical protein VITISV_006935 [Vitis vinifera]
Length=593

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ N+LRVYPKG RF+SSNY P+IGWMHGAQMVAFNMQGYGRSLW+M GMF++NG
Sbjct  374  EIVRFTQRNLLRVYPKGIRFDSSNYNPVIGWMHGAQMVAFNMQGYGRSLWIMHGMFKANG  433

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+N G +  VF+PK +L VK TLKV VYMG+GW+ DF+ THFD+YSPPDF
Sbjct  434  GCGYVKKPDFLLNNGSHDGVFDPKAKLPVKTTLKVTVYMGEGWYFDFRHTHFDAYSPPDF  493

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD +MKKTK  EDNWTP W E F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  494  YARVGIAGVPADTIMKKTKTLEDNWTPNWDEHFEFPLTVPELALLRVEVHEYDMSEKDDF  553

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RKG+KY SV+LLMRFEFV
Sbjct  554  GGQTCLPVSELRRGIRAVPLFSRKGDKYPSVKLLMRFEFV  593



>ref|NP_850327.2| phosphoinositide phospholipase C 6 [Arabidopsis thaliana]
 sp|Q8GV43.2|PLCD6_ARATH RecName: Full=Phosphoinositide phospholipase C 6; AltName: Full=Phosphoinositide 
phospholipase PLC6; Short=AtPLC6; Short=AtPLC8; 
Short=PI-PLC6 [Arabidopsis thaliana]
 gb|AEC09783.1| phosphoinositide phospholipase C 6 [Arabidopsis thaliana]
Length=613

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  394  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  453

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  454  GCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  513

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   KKTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  514  YTKMFIVGVPADNAKKKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  573

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPVAELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  574  GGQTCLPVAELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  612



>ref|NP_200678.2| phosphoinositide phospholipase C 4 [Arabidopsis thaliana]
 sp|Q944C1.2|PLCD4_ARATH RecName: Full=Phosphoinositide phospholipase C 4; AltName: Full=Phosphoinositide 
phospholipase PLC4; Short=AtPLC4; Short=PI-PLC4 
[Arabidopsis thaliana]
 gb|AAL30749.2|AF434168_1 phosphoinositide-specific phospholipase C [Arabidopsis thaliana]
 dbj|BAA97338.1| phosphoinositide-specific phospholipase C [Arabidopsis thaliana]
 gb|AAM13216.1| phosphoinositide-specific phospholipase-like protein [Arabidopsis 
thaliana]
 gb|AAP37717.1| At5g58700 [Arabidopsis thaliana]
 gb|AED97086.1| phosphoinositide phospholipase C 4 [Arabidopsis thaliana]
Length=597

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  377  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  436

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+  PN + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  437  GGCGYVKKPDFLMDASPNGQDFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  496

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD++EKDD
Sbjct  497  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDVNEKDD  556

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+E+R GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  557  FGGQTCLPVSEIRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  597



>ref|XP_010920865.1| PREDICTED: phosphoinositide phospholipase C 2-like [Elaeis guineensis]
Length=588

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 190/221 (86%), Gaps = 1/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY P++ WM+GAQMVA NMQGYGR+LWL+ GMFR+N
Sbjct  369  TEIVRFTQKNLLRIYPKGTRITSSNYSPMLCWMYGAQMVALNMQGYGRALWLVHGMFRAN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L++  P+  VFNPK  L VKKTLKV+VYMGDGW  DF  THFD+YSPPD
Sbjct  429  GGCGYVKKPDFLLDNDPD-NVFNPKVTLPVKKTLKVRVYMGDGWRFDFHLTHFDTYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  MK+TK  EDNWTPVW EEF FPLTVPELALLRIEVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADTTMKRTKAIEDNWTPVWDEEFEFPLTVPELALLRIEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV ELRPGIR+VPLCDRKGE   SV+LLM FEF+
Sbjct  548  FAGQTCLPVWELRPGIRSVPLCDRKGETLKSVKLLMHFEFI  588



>gb|AAL23439.1| phosphoinositide-specific phospholipase C4 [Arabidopsis thaliana]
Length=591

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  371  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+  PN + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  431  GGCGYVKKPDFLMDASPNGQDFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD++EKDD
Sbjct  491  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDVNEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+E+R GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  551  FGGQTCLPVSEIRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  591



>emb|CDP14022.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRV+PKGTR  SSN+ PL+GW HGAQM+AFNMQGYG+SLWLM G+FRSN
Sbjct  364  TDVVRFTQKNILRVFPKGTRVTSSNFYPLVGWTHGAQMLAFNMQGYGKSLWLMHGLFRSN  423

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM  GP  E+F+PK +L VKKTLKV VY+GDGW LDF  THFDSYSPPD
Sbjct  424  GGCGYVKKPDFLMKRGPRNELFDPKVKLPVKKTLKVSVYLGDGWRLDFSHTHFDSYSPPD  483

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V + GVPADE  KKT+I ED+W P+W E+F FPLTVPELALLRIE+ EHD+SEKDD
Sbjct  484  FYTKVQMVGVPADEAKKKTRIIEDDWGPIWDEDFTFPLTVPELALLRIEIREHDMSEKDD  543

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIRAVP+ D+KGEK  SVRLLMRF+F+
Sbjct  544  FGGQTCLPVSELRPGIRAVPIYDKKGEKLRSVRLLMRFQFI  584



>ref|XP_009605158.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=588

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFRSNG
Sbjct  369  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRSNG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN ++F+P+  L VK TLKV V+MG+GW+ DF  THFD+YSPPDF
Sbjct  429  GCGYVKKPDILLKAGPNNQIFDPEANLPVKTTLKVTVFMGEGWYYDFNHTHFDAYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKT+  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  489  YAKIGIAGVPADNVMKKTRTLEDNWIPTWDEKFEFPLTVPELALLRVEVHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFE+V
Sbjct  549  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEYV  588



>gb|KFK36899.1| hypothetical protein AALP_AA4G187200 [Arabis alpina]
Length=622

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ NILR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  403  DVVRFTQRNILRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  462

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP  LM  G + EVF+PK ++ VK+TLKVKVYMGDGW LDF  THFDSYSPPDF
Sbjct  463  GCGYVKKPSFLMKKGFHDEVFDPKKKVPVKETLKVKVYMGDGWRLDFSHTHFDSYSPPDF  522

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   +KT+I EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  523  YTKMFIVGVPADNAKRKTRIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  582

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPVAELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  583  GGQTCLPVAELRPGIRSVPLYDKKGEKMKSVRLLMRFVF  621



>ref|XP_009605157.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=589

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFRSNG
Sbjct  370  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRSNG  429

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN ++F+P+  L VK TLKV V+MG+GW+ DF  THFD+YSPPDF
Sbjct  430  GCGYVKKPDILLKAGPNNQIFDPEANLPVKTTLKVTVFMGEGWYYDFNHTHFDAYSPPDF  489

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKT+  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  490  YAKIGIAGVPADNVMKKTRTLEDNWIPTWDEKFEFPLTVPELALLRVEVHEYDMSEKDDF  549

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFE+V
Sbjct  550  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEYV  589



>ref|XP_002311223.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEE88590.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=590

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR NSSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMFR+NG
Sbjct  371  EIVRFTQRNILRVYPKGTRVNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRANG  430

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKP  L+  GP+ EVF+ K +L ++KTLKVK+YMG+GW  DF+ THFD+YSPPDF
Sbjct  431  GCGFVKKPSFLLKSGPHGEVFDTKAKLPMQKTLKVKIYMGEGWFYDFQHTHFDAYSPPDF  490

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD VMKKTK  ED+W P W EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  491  YARVGIAGVPADTVMKKTKTLEDSWIPFWNEEFEFPLTVPELALLRIEVHEYDMSEKDDF  550

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL DRKGE+Y  V+LL+R EFV
Sbjct  551  GGQTCLPVWELREGIRAVPLHDRKGERYKCVKLLVRLEFV  590



>ref|XP_010454117.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Camelina sativa]
 ref|XP_010454124.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Camelina sativa]
Length=599

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQG+GR+LWLM+GMFR+N
Sbjct  379  TDVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGHGRALWLMEGMFRAN  438

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNV P  + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  439  GGCGYVKKPDFLMNVDPTGQSFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPD  498

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDD
Sbjct  499  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDNNEKDD  558

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  559  FGGQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  599



>ref|XP_006411261.1| hypothetical protein EUTSA_v10016400mg [Eutrema salsugineum]
 gb|ESQ52714.1| hypothetical protein EUTSA_v10016400mg [Eutrema salsugineum]
Length=606

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  387  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  446

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+PK +L VK+TLKVKVYMGDGW LDF  THFD+YSPPDF
Sbjct  447  GCGYVKKPNFLMKKGFHDEVFDPKKKLPVKETLKVKVYMGDGWRLDFSHTHFDAYSPPDF  506

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   +KTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  507  YTKMFIVGVPADNAKRKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  566

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  567  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  605



>ref|XP_002879846.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56105.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=618

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  399  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  458

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  459  GCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  518

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   KKTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  519  YTKMFIVGVPADNAKKKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  578

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPVAELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  579  GGQTCLPVAELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  617



>gb|ABJ99758.1| phospholipase C [Nicotiana tabacum]
Length=588

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMVAFNMQGYGRSLWLM GMFRSNG
Sbjct  369  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMVAFNMQGYGRSLWLMHGMFRSNG  428

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN ++F+P+  L VK TLKV V+MG+GW+ DF  THFD+YSPPDF
Sbjct  429  GCGYVKKPDILLKAGPNNQIFDPEANLPVKTTLKVTVFMGEGWYYDFNHTHFDAYSPPDF  488

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKT+  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  489  YAKIGIAGVPADNVMKKTRTLEDNWIPTWDEKFEFPLTVPELALLRVEVHEYDMSEKDDF  548

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFE+V
Sbjct  549  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEYV  588



>ref|XP_009344939.1| PREDICTED: phosphoinositide phospholipase C 2-like [Pyrus x bretschneideri]
Length=592

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW HGAQMVAFNMQGYGRSLWLMQGMFR+NG
Sbjct  373  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNMQGYGRSLWLMQGMFRANG  432

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK  L VK+TLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  433  GCGYVKKPDFLLKSGPHNEVFDPKYDLPVKQTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  492

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  ED+W P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  493  YARVGIAGVAADSVMKKTKTLEDDWIPAWNEEFEFPLTVPELAVLRIEVHEYDMSEKDDF  552

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  +KGEKY SV+LLM F+FV
Sbjct  553  GGQTCLPVSELRRGIRAVPLHSQKGEKYKSVKLLMHFDFV  592



>emb|CDY32691.1| BnaA02g07530D [Brassica napus]
Length=594

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 190/222 (86%), Gaps = 1/222 (0%)
 Frame = -3

Query  788  TDVVS-FTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRS  612
             DV+S FTQ N LR+YPKGTRFNSSNYKP +GWM GAQM+AFNMQGYGR+LWLMQGMFR+
Sbjct  373  ADVISRFTQKNFLRIYPKGTRFNSSNYKPQVGWMSGAQMIAFNMQGYGRALWLMQGMFRA  432

Query  611  NGGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPP  432
            NGGCGYVKKPD LMNVGPN +VF+P      KKTLKVKV MGDGWHLDFK+THFD YSPP
Sbjct  433  NGGCGYVKKPDFLMNVGPNGQVFDPNENSSPKKTLKVKVLMGDGWHLDFKKTHFDLYSPP  492

Query  431  DFYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKD  252
            DFY RVGIAG PADE M+KT++K D WTP+W +EF F LTVPELALLR+EVHE+D +EKD
Sbjct  493  DFYVRVGIAGAPADETMEKTEVKYDTWTPIWNQEFTFKLTVPELALLRVEVHEYDANEKD  552

Query  251  DFAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            DF GQTCLPV+ELR GIRAV L +RKG KY+  RLLMRF+FV
Sbjct  553  DFGGQTCLPVSELRQGIRAVSLFNRKGVKYSCTRLLMRFDFV  594



>ref|XP_002278839.2| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Vitis vinifera]
Length=590

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LRVYPK TRFNSSNYKPLIGWMHG Q++AFNMQG+GRSLWLM GMFR+NG
Sbjct  371  DVVRFTQKNLLRVYPKATRFNSSNYKPLIGWMHGVQLLAFNMQGHGRSLWLMHGMFRANG  430

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+NV P+ +VF+PK +L VKKTLKV+VY+GDGW+ DFK+THFD YSPPDF
Sbjct  431  GCGYVKKPDFLLNVSPHNQVFDPKAKLPVKKTLKVRVYLGDGWNFDFKKTHFDFYSPPDF  490

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAG  AD+ MK+TK K++NW PVW EEF FPLTVPELALLRIEV+E+++ EKD F
Sbjct  491  YTRVGIAGAAADKTMKETKKKQNNWKPVWNEEFTFPLTVPELALLRIEVYEYNMPEKDMF  550

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL +RKGE Y+SVRLLM F+FV
Sbjct  551  AGQTCLPVWELRQGIRAVPLFNRKGEMYSSVRLLMSFQFV  590



>ref|XP_010689655.1| PREDICTED: phosphoinositide phospholipase C 2 [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ N+LR+YPKGTR  SSNY PLI WMHGAQMVAFNMQGYGRSLWLMQGMFR+NG
Sbjct  370  EIVRFTQKNMLRIYPKGTRITSSNYNPLIAWMHGAQMVAFNMQGYGRSLWLMQGMFRANG  429

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ L+N GPN EVF+PK +L VKKTLKV VYMG+GW+ DFK THFD +SPPDF
Sbjct  430  GCGYVKKPNFLLNSGPNGEVFDPKVKLPVKKTLKVTVYMGEGWYYDFKHTHFDQFSPPDF  489

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  EDNW P W EEF FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  490  YVRVGIAGVAADTVMKKTKTLEDNWIPAWNEEFEFPLSVPELALLRIEVHEYDMSEKDDF  549

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIR++PL  R+G KY SV+LLM F+FV
Sbjct  550  GGQTCLPVWELREGIRSIPLFSREGVKYKSVKLLMHFQFV  589



>gb|KDO68971.1| hypothetical protein CISIN_1g007399mg [Citrus sinensis]
Length=591

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D+V FTQ N+LR+YPKG R +SSNY PLIGW HGAQMVAFNMQG+GRSLWLM GMFR+N
Sbjct  371  NDIVRFTQRNLLRIYPKGIRVDSSNYNPLIGWSHGAQMVAFNMQGHGRSLWLMHGMFRAN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ L+  GP+ EVF+PK +L  KKTLKV VYMG+GW+ DF  THFD+YSPPD
Sbjct  431  GGCGYVKKPNFLLQTGPHNEVFDPKVKLPAKKTLKVTVYMGEGWYYDFPHTHFDAYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKTK  EDNW P W EEF FPL+VPELALLRIEVHE+D+SEKDD
Sbjct  491  FYARVGIAGVPADTVMKKTKTLEDNWIPSWNEEFEFPLSVPELALLRIEVHEYDMSEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL DRKGE+Y SV+LLM FEF+
Sbjct  551  FGGQTCLPVSELKQGIRAVPLHDRKGERYKSVKLLMHFEFI  591



>ref|NP_001275400.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63954.1| phosphoinositide-specific phospholipase C [Solanum tuberosum]
Length=585

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILR+YPKG RF+SSNY P   W HGAQMVAFNMQGYGRSLWLM GMFR NG
Sbjct  366  EIIRFTQRNILRIYPKGIRFDSSNYNPFNAWTHGAQMVAFNMQGYGRSLWLMHGMFRGNG  425

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN EVF+P+  L VK TLKV V+MG+GW+ DF+ THFD+YSPPDF
Sbjct  426  GCGYVKKPDILLKAGPNNEVFDPEANLPVKTTLKVTVFMGEGWYYDFEHTHFDAYSPPDF  485

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y R+GIAGV AD VMKKTK  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  486  YARIGIAGVDADIVMKKTKTLEDNWIPTWDEQFEFPLTVPELALLRVEVHEYDMSEKDDF  545

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAVPL +RKGEKYNSV+LL+RFEF+
Sbjct  546  AGQTCLPVSELRQGIRAVPLHNRKGEKYNSVKLLLRFEFI  585



>ref|XP_007141766.1| hypothetical protein PHAVU_008G224000g [Phaseolus vulgaris]
 gb|ESW13760.1| hypothetical protein PHAVU_008G224000g [Phaseolus vulgaris]
Length=599

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKGTR +SSNY PLIGWMHGAQMVAFNMQG+GRSLWLMQGMFR+NGG
Sbjct  380  IVRFTQRNILRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNMQGHGRSLWLMQGMFRANGG  439

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKP+ L+  GP+ EVF+PK +L VK  LKV VYMG+GW+ DFK THFD YSPPDFY
Sbjct  440  CGYVKKPEFLLETGPDNEVFDPKAKLPVKTILKVTVYMGEGWYYDFKHTHFDQYSPPDFY  499

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGV +D VMKKT+  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  500  TRVGIAGVSSDTVMKKTRAIEDNWLPTWNETFEFPLTVPELALLRIEVHEYDMSEKDDFG  559

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTC+P+ ELR GIRA+PL  +KGEKY SV+LLMRFEF+
Sbjct  560  GQTCIPIRELRSGIRAIPLYSQKGEKYASVKLLMRFEFI  598



>gb|KHN20845.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=562

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKGTR +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+NGG
Sbjct  340  IVRFTQRNILRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRANGG  399

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLK--VKVYMGDGWHLDFKQTHFDSYSPPD  429
            CGYVKKP+ L+  GP+ EVFNPK +L VK TLK  V VYMG+GW+ DFK THFD YSPPD
Sbjct  400  CGYVKKPNFLLETGPDDEVFNPKAKLPVKTTLKARVTVYMGEGWYYDFKHTHFDQYSPPD  459

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVP D +MK+TK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  460  FYTRVGIAGVPNDTIMKRTKAIEDNWLPTWNEAFEFPLTVPELALLRVEVHEYDMSEKDD  519

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLP+ ELR GIRA+PL  +KG+KYN+V+LLMRFEF+
Sbjct  520  FGGQTCLPIWELRSGIRAIPLHSQKGDKYNTVKLLMRFEFI  560



>ref|NP_001275075.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63893.1| phosphoinositide-specific phospholipase C [Solanum tuberosum]
Length=565

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG R +SSNY P +GWMHGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  346  EIIRFTQQNLLRIYPKGIRVDSSNYDPFVGWMHGAQMVAFNMQGYGRSLWLMHGMFRANG  405

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P   L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  406  GCGYVKKPDLLLKAGPNNEVFDPTANLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  465

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPADEV K+TK  +DNW P W E+F FPLTVPELALLRI+V +++LS+KD+F
Sbjct  466  YAKLGIAGVPADEVKKRTKTMDDNWIPSWDEQFEFPLTVPELALLRIKVLDYNLSDKDEF  525

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPVAELR GIRAVPL DRKGEKY+SV+LLMRFEF+
Sbjct  526  AGQTCLPVAELRQGIRAVPLYDRKGEKYSSVKLLMRFEFI  565



>ref|XP_006401052.1| hypothetical protein EUTSA_v10013042mg [Eutrema salsugineum]
 gb|ESQ42505.1| hypothetical protein EUTSA_v10013042mg [Eutrema salsugineum]
Length=594

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLMQGMFR+N
Sbjct  374  ADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMQGMFRAN  433

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGP  +VF+P      KKTLKVKV MGDGWHLDF +THFD YSPPD
Sbjct  434  GGCGYVKKPDFLMNVGPTGQVFDPNESSPPKKTLKVKVCMGDGWHLDFNKTHFDLYSPPD  493

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DE MKKT++K D WTP+W EEF F LTVPELALLR+EVHE+D +EKDD
Sbjct  494  FFVRVGIAGAPVDEAMKKTEVKYDTWTPIWNEEFTFQLTVPELALLRVEVHEYDANEKDD  553

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIRAVPL +RKG KY   RLLMRFEFV
Sbjct  554  FGGQTCLPVSELRQGIRAVPLFNRKGVKYGFTRLLMRFEFV  594



>ref|XP_006338846.1| PREDICTED: phosphoinositide phospholipase C 2-like [Solanum tuberosum]
Length=565

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG R +SSNY P +GWMHGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  346  EIIRFTQQNLLRIYPKGIRVDSSNYDPFVGWMHGAQMVAFNMQGYGRSLWLMHGMFRANG  405

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P   L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  406  GCGYVKKPDLLLKAGPNNEVFDPTANLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  465

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPADEV K+TK  +DNW P W E+F FPLTVPELALLRI+V +++LS+KD+F
Sbjct  466  YAKLGIAGVPADEVKKRTKTMDDNWIPSWDEQFEFPLTVPELALLRIKVLDYNLSDKDEF  525

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPVAELR GIRAVPL DRKGEKY+SV+LLMRFEF+
Sbjct  526  AGQTCLPVAELRQGIRAVPLYDRKGEKYSSVKLLMRFEFI  565



>ref|NP_001235324.1| phosphoinositide-specific phospholipase C P25 [Glycine max]
 gb|AAB03259.1| phosphoinositide-specific phospholipase C P25 [Glycine max]
 gb|KHN34717.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=551

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  332  EIVRFTQRNILRVYPKGTRITSTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  391

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+ VGPN EVF+P++ L VK TLKV +YMG+GW LDFK THFD +SPPDF
Sbjct  392  GCGYVKKPDLLLKVGPNNEVFDPRSHLPVKTTLKVTIYMGEGWFLDFKHTHFDKFSPPDF  451

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKT+  EDNW+P W + F FPL VPELALLR+EVHE+D+SEKDDF
Sbjct  452  YARVGIAGVPNDTVMKKTEKVEDNWSPSWNQVFKFPLAVPELALLRVEVHEYDMSEKDDF  511

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKG+KY +V+LLM FEF+
Sbjct  512  GGQTCLPVWELRSGIRAVPLYSRKGDKYANVKLLMHFEFI  551



>ref|XP_007016095.1| Phosphatidylinositol-speciwc phospholipase C4, putative isoform 
2 [Theobroma cacao]
 gb|EOY33714.1| Phosphatidylinositol-speciwc phospholipase C4, putative isoform 
2 [Theobroma cacao]
Length=597

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 196/222 (88%), Gaps = 1/222 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T+VV FTQ NILR+YP+GTR NSSNY PLIGWMHGAQMVA NMQGYG+SLWLM GMFRSN
Sbjct  372  TEVVRFTQRNILRIYPRGTRVNSSNYNPLIGWMHGAQMVALNMQGYGKSLWLMHGMFRSN  431

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ LMNVGPN +VF+PK +L VKK LKVKVYMGDGWHLDFKQ H + +SPP+
Sbjct  432  GGCGYVKKPEFLMNVGPNDQVFDPKAKLPVKKILKVKVYMGDGWHLDFKQRHLNHWSPPE  491

Query  428  FYTR-VGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKD  252
            FYTR VGI GVPAD+ M+KTK +  NWT VW EEF++PLTVPE+ALLR+EVHE+++SEKD
Sbjct  492  FYTRVVGIEGVPADKTMRKTKKRNGNWTLVWDEEFIYPLTVPEIALLRVEVHEYNMSEKD  551

Query  251  DFAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             FAGQTCLPV+ELRPGIRAVPL +RKGEK+ S+ LLMRFEFV
Sbjct  552  YFAGQTCLPVSELRPGIRAVPLFNRKGEKFTSLGLLMRFEFV  593



>gb|KHN48566.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=600

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKGTR +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+NGG
Sbjct  380  IVRFTQRNILRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRANGG  439

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKP+ L+  GP+ EVFNPK +L VK TLKV VYMG+GW+ D K THFD YSPPDFY
Sbjct  440  CGYVKKPNFLLETGPDDEVFNPKAKLPVKTTLKVTVYMGEGWYYDSKHTHFDQYSPPDFY  499

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVP D +MK+TK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  500  TRVGIAGVPNDTIMKRTKAIEDNWLPTWNEVFEFPLTVPELALLRIEVHEYDMSEKDDFG  559

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQ CLP+ ELR GIRA+PL  +KG+KYN+V+LLMRFEF+
Sbjct  560  GQACLPIWELRSGIRAIPLHSQKGDKYNTVKLLMRFEFI  598



>ref|XP_006295484.1| hypothetical protein CARUB_v10024587mg [Capsella rubella]
 gb|EOA28382.1| hypothetical protein CARUB_v10024587mg [Capsella rubella]
Length=617

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  398  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  457

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G   EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  458  GCGYVKKPNFLMKKGFRDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  517

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   KKTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  518  YTKMFIVGVPADNAKKKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  577

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  578  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  616



>ref|XP_002463446.1| hypothetical protein SORBIDRAFT_02g044010 [Sorghum bicolor]
 gb|EER99967.1| hypothetical protein SORBIDRAFT_02g044010 [Sorghum bicolor]
Length=607

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILR+YPKGTR  SSNY P IGW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  389  TEIVRFTQRNILRIYPKGTRVTSSNYNPFIGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  448

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  +VF+P+    VKKTLKVKVYMGDGW +DFKQTHFD YSPPD
Sbjct  449  GGCGYVKKPDFLMQTEP--QVFDPREPQPVKKTLKVKVYMGDGWRMDFKQTHFDQYSPPD  506

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKTK  EDNW PVW EEF FPLTVPE+ALLR+EVHE+D+SEKDD
Sbjct  507  FYTRVGIAGVPADSVMKKTKAIEDNWMPVWEEEFSFPLTVPEIALLRVEVHEYDMSEKDD  566

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQT LPV+ELRPGIRAV L DRKG KYN+V+LLMRFEF 
Sbjct  567  FGGQTVLPVSELRPGIRAVALFDRKGNKYNNVKLLMRFEFA  607



>ref|XP_010517422.1| PREDICTED: phosphoinositide phospholipase C 6 [Camelina sativa]
Length=614

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  395  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  454

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  455  GCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  514

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   +KTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  515  YTKMFIVGVPADNAKRKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  574

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  575  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  613



>ref|XP_006658176.1| PREDICTED: phosphoinositide phospholipase C 2-like [Oryza brachyantha]
Length=373

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 185/220 (84%), Gaps = 2/220 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N+LR+YPKGTR  SSNY P +GW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  155  TDIVRFTQKNLLRIYPKGTRVTSSNYNPFLGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  214

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  EVF+PK  L  KKTLKVKVYMGDGW +DFKQTHFD YSPPD
Sbjct  215  GGCGYVKKPDFLMQSEP--EVFDPKKVLSPKKTLKVKVYMGDGWRMDFKQTHFDQYSPPD  272

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKT+  EDNW PVW EEF FPLTVPE+ALLR+EVHE+D+SEKDD
Sbjct  273  FYARVGIAGVPADSVMKKTRAIEDNWVPVWEEEFAFPLTVPEIALLRVEVHEYDMSEKDD  332

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            F GQT LPV+EL PGIRAV L DRKG  Y +V+LLMRFEF
Sbjct  333  FGGQTVLPVSELLPGIRAVSLFDRKGNMYKNVKLLMRFEF  372



>emb|CAA75546.2| phospholipase C [Pisum sativum]
Length=594

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  375  EIVRFTQRNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD L+  GPN EVF+PK  L +K TLKV VYMG+GW+ DF  THFD +SPPDF
Sbjct  435  GCGFVKKPDFLLKTGPNNEVFDPKASLPLKTTLKVTVYMGEGWYYDFDHTHFDQFSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D +MKKTK  ED+W P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  495  YARVGIAGVPFDTIMKKTKTVEDSWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKG+KYN+V+LLMRFEF+
Sbjct  555  GGQTCLPVWELRTGIRAVPLHSRKGDKYNNVKLLMRFEFI  594



>dbj|BAD95335.1| phosphoinositide specific phospholipase C [Arabidopsis thaliana]
Length=263

 Score =   354 bits (908),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+GW HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  45   IVRFTQHNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  104

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPDLL+  G + ++F+PK  L VK TL+V VYMG+GW+ DF+ THFD YSPPDFY
Sbjct  105  CGYIKKPDLLLKSGSDSDIFDPKATLPVKTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFY  164

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVP D VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  165  TRVGIAGVPGDTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  224

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL  GIRA PL  RKGEKY SV+LL++ EFV
Sbjct  225  GQTCLPVWELSEGIRAFPLHSRKGEKYKSVKLLVKVEFV  263



>gb|EMT14453.1| Phosphoinositide phospholipase C 2 [Aegilops tauschii]
Length=486

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 188/221 (85%), Gaps = 2/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY P IGW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  268  TEIVRFTQRNLLRIYPKGTRVTSSNYNPFIGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  327

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  EVF+PK    VKKTLKVKVYMGDGW +DFKQTHFD YSPPD
Sbjct  328  GGCGYVKKPDFLMQSEP--EVFDPKKPQPVKKTLKVKVYMGDGWRMDFKQTHFDQYSPPD  385

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKTK  EDNW PVWGEEF F LTVPELALLR+E HE+D+SEKDD
Sbjct  386  FYARVGIAGVPADSVMKKTKAVEDNWVPVWGEEFSFDLTVPELALLRVEAHEYDMSEKDD  445

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQT LPV+EL+PGIRAV L DRKG K+ +V+LLMRFEFV
Sbjct  446  FAGQTVLPVSELQPGIRAVALFDRKGNKFPNVKLLMRFEFV  486



>ref|XP_010534599.1| PREDICTED: phosphoinositide phospholipase C 2 [Tarenaya hassleriana]
Length=582

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKG R +SSNY P +GW HGAQMVAFNMQG+GRSLWLMQGMFR+NGG
Sbjct  364  IVRFTQRNLLRIYPKGVRVDSSNYNPFVGWSHGAQMVAFNMQGHGRSLWLMQGMFRANGG  423

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYV+KPD+L+  GPN +VF+PK  LH K TL+V VYMG+GW+ DF+ THFD YSPPDFY
Sbjct  424  CGYVRKPDILLKSGPNDDVFDPKATLHPKTTLRVTVYMGEGWYYDFRHTHFDQYSPPDFY  483

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD +MKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  484  TRVGIAGVPADSIMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRVEVHEYDMSEKDDFG  543

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV ELR GIRA+PL +RKGEKY SV+LLM+FEFV
Sbjct  544  GQTCLPVWELRQGIRAIPLHNRKGEKYKSVKLLMKFEFV  582



>ref|XP_008343623.1| PREDICTED: phosphoinositide phospholipase C 2-like [Malus domestica]
Length=592

 Score =   365 bits (936),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW HGAQMVAFNMQGYGRSLWLMQGMFR+NG
Sbjct  373  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNMQGYGRSLWLMQGMFRANG  432

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  GP+ EVF+PK+ L VK+TLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  433  GCGYVKKPDFLLKSGPHNEVFDPKSDLPVKQTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  492

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  ED+W P W EEF FPLTVPELA+LR+EVHE+D+SEKDDF
Sbjct  493  YARVGIAGVAADSVMKKTKTLEDDWXPAWNEEFAFPLTVPELAVLRVEVHEYDMSEKDDF  552

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RKG  Y SV+LLM F+FV
Sbjct  553  GGQTCLPVSELRTGIRAVPLNCRKGVPYKSVKLLMHFDFV  592



>gb|KHG14938.1| Phosphoinositide phospholipase C 2 -like protein [Gossypium arboreum]
Length=578

 Score =   364 bits (935),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 3/219 (1%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FT+ N+LRVYPK TRF+SSNY PLIGWMHG QMVAFNMQG+GRSLWLM GMF++NGG
Sbjct  363  IVRFTRQNVLRVYPKSTRFDSSNYNPLIGWMHGVQMVAFNMQGHGRSLWLMHGMFKANGG  422

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD L+N   + EVF+PK +L VK TLKV VYMG+GW+ DF  THFD+YSPPDFY
Sbjct  423  CGYVKKPDFLLN---SMEVFDPKIKLPVKTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFY  479

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTKI EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  480  TRVGIAGVPADSVMKKTKILEDNWLPSWNEVFEFPLTVPELALLRIEVHEYDMSEKDDFG  539

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLP++ELR GIRAVPL  RKGEKYNSV+LLM FEF+
Sbjct  540  GQTCLPISELRSGIRAVPLYSRKGEKYNSVKLLMHFEFI  578



>ref|XP_010508911.1| PREDICTED: phosphoinositide phospholipase C 6-like [Camelina 
sativa]
Length=614

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  395  DVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  454

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  455  GCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  514

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ + GVPAD   +KTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  515  YTKMYLVGVPADNAKRKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  574

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  575  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  613



>ref|NP_001234190.1| PI-phospholipase C PLC3 [Solanum lycopersicum]
 gb|ABW81001.1| PI-phospholipase C PLC3 [Solanum lycopersicum]
Length=583

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILR+YPKG RF+SSNY P   W HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  364  EIIRFTQRNILRIYPKGIRFDSSNYNPFNAWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  423

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GP+ +VF+P+  L VK TLKV V+MG+GW+ DF+ THFD+YSPPDF
Sbjct  424  GCGYVKKPDILLKAGPSNQVFDPEASLPVKTTLKVTVFMGEGWYYDFEHTHFDAYSPPDF  483

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y R+GIAGV AD VMKKTK  EDNW P W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  484  YARIGIAGVDADIVMKKTKTLEDNWIPTWDEQFEFPLTVPELALLRVEVHEYDMSEKDDF  543

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAVPL  RKG+KYNSV+LLMRFEF+
Sbjct  544  AGQTCLPVSELRQGIRAVPLHSRKGDKYNSVKLLMRFEFI  583



>gb|AAW81960.1| phosphatidylinositol-specific phospholipase C 2 [Lilium davidii]
Length=543

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 191/221 (86%), Gaps = 1/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ N+LR+Y +GTRFNSSN   L+GWMHGAQMVAFNMQG+GRSLW MQG +R+N
Sbjct  314  ADVIRFTQKNLLRIYQRGTRFNSSN-SILVGWMHGAQMVAFNMQGFGRSLWRMQGFYRAN  372

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP  L+N GP+ EVFNPK +L  KK LKVKVYMGDGW +DFK THFD+YSPPD
Sbjct  373  GGCGYVKKPHFLLNNGPHGEVFNPKAKLPAKKILKVKVYMGDGWRMDFKSTHFDTYSPPD  432

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD  MKKT+  ED+WTPVW EE +FPLTVPELALLRIEVHE+D+S+KDD
Sbjct  433  FYTRVGIAGVPADCTMKKTRTIEDDWTPVWDEELVFPLTVPELALLRIEVHEYDMSDKDD  492

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+PGIRAVPL  RKG KY SVRLL+RFEF+
Sbjct  493  FGGQTCLPVSELKPGIRAVPLFTRKGVKYRSVRLLVRFEFL  533



>ref|XP_008463239.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cucumis melo]
Length=603

 Score =   365 bits (936),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKG RF+SSNY P+IGW HGAQMVA NMQGYGRSLW+M GMFR+NGG
Sbjct  385  IVRFTQKNILRVYPKGIRFDSSNYNPMIGWTHGAQMVALNMQGYGRSLWIMHGMFRANGG  444

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD ++  G + E+F+PK RL VK TLKV VYMG+GW+ DF  THFD+YSPPDFY
Sbjct  445  CGYVKKPDFILKPGSDDEIFDPKVRLPVKTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFY  504

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD +MKKTK  EDNW P W EEF FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  505  TRVGIAGVPADTIMKKTKTLEDNWVPAWNEEFEFPLTVPELALLRIEVHEYDMSEKDDFG  564

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV+ELR GIRAVPL   KGEKY SV+LLM FEFV
Sbjct  565  GQTCLPVSELRRGIRAVPLHSVKGEKYKSVKLLMGFEFV  603



>ref|XP_010658272.1| PREDICTED: phosphoinositide phospholipase C 6 [Vitis vinifera]
 emb|CBI25478.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   364 bits (935),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ N+LR+YPKGTR NSSNYKP++GWMHGAQMVAFNMQGYG+SLWLM GMFR N
Sbjct  372  TDLVRFTQKNVLRIYPKGTRVNSSNYKPMLGWMHGAQMVAFNMQGYGKSLWLMHGMFRCN  431

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD LM  GP  EVFNPK  L VK  LKV VYMGDGW LDF  THFD+YSPPD
Sbjct  432  GGCGYIKKPDFLMKKGPCREVFNPKATLPVKTILKVGVYMGDGWSLDFSPTHFDTYSPPD  491

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPAD   +KTKI  +NW PVW E F+F LTVPELALLRIEV EHD SEKDD
Sbjct  492  FYTKIHIVGVPADNTKRKTKIINNNWFPVWDEAFIFSLTVPELALLRIEVREHDRSEKDD  551

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIR+VPL D+KGEKY SVRLLM FEF+
Sbjct  552  FGGQTCLPVSELRPGIRSVPLFDKKGEKYKSVRLLMEFEFL  592



>ref|XP_004149233.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cucumis sativus]
 ref|XP_004163786.1| PREDICTED: phosphoinositide phospholipase C 2-like [Cucumis sativus]
 gb|KGN50656.1| hypothetical protein Csa_5G203390 [Cucumis sativus]
Length=599

 Score =   364 bits (935),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKG RF+SSNY P+IGW HGAQMVA NMQGYGRSLW+M GMFR+NGG
Sbjct  381  IVRFTQKNILRVYPKGIRFDSSNYNPMIGWTHGAQMVALNMQGYGRSLWIMHGMFRANGG  440

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD ++  G + E+F+P+ RL VK TLKV VYMG+GW+ DF  THFD+YSPPDFY
Sbjct  441  CGYVKKPDFILKPGSDDEIFDPRVRLTVKTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFY  500

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD +MKKTK  EDNW P W EEF FPLTVPELALLRIEVHE+D+SEKDDF 
Sbjct  501  TRVGIAGVPADTIMKKTKTLEDNWVPAWNEEFEFPLTVPELALLRIEVHEYDMSEKDDFG  560

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV+ELR GIRAVPL   KGEKY SV+LLM FEFV
Sbjct  561  GQTCLPVSELRRGIRAVPLHSVKGEKYKSVKLLMGFEFV  599



>ref|XP_002866286.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42545.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=598

 Score =   364 bits (934),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FT+ N LR+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+N
Sbjct  378  ADVIRFTRKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN  437

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+ G N + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPD
Sbjct  438  GGCGYVKKPDFLMDAGSNGQGFYPKDNSCPKKTLKVKVLMGDGWLLDFKKTHFDSYSPPD  497

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            F+ RVGIAG P DEVM+KTKI+ D WTP+W +EF+FPL VPELALLR+EVHEHD++EKDD
Sbjct  498  FFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFIFPLAVPELALLRVEVHEHDINEKDD  557

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+E+R GI AVPL +RKG KY+S RLLMRFEFV
Sbjct  558  FGGQTCLPVSEIRQGIHAVPLFNRKGVKYSSTRLLMRFEFV  598



>ref|XP_008666992.1| PREDICTED: phosphoinositide-specific phospholipase C isoform 
X1 [Zea mays]
 ref|XP_008666993.1| PREDICTED: phosphoinositide-specific phospholipase C isoform 
X1 [Zea mays]
 tpg|DAA41848.1| TPA: hypothetical protein ZEAMMB73_100644 [Zea mays]
Length=587

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 188/221 (85%), Gaps = 2/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILR+YPKGTR  SSNY P +GW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  369  TEIVRFTQRNILRIYPKGTRVTSSNYNPFVGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  +VF+P+    VKKTLKVKVYMGDGW +DFKQTHFD YSPPD
Sbjct  429  GGCGYVKKPDFLMQTEP--QVFDPREPQPVKKTLKVKVYMGDGWRMDFKQTHFDQYSPPD  486

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VMKKT   EDNWTPVW +EF FPLTVPELALLR+EVHE+D+SEKDD
Sbjct  487  FYTRVGIAGVPADSVMKKTNAIEDNWTPVWEKEFSFPLTVPELALLRVEVHEYDMSEKDD  546

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQT LPV+ELRPGIRAV L DRKG KYN V+LLMRFEF 
Sbjct  547  FGGQTVLPVSELRPGIRAVALFDRKGMKYNHVKLLMRFEFA  587



>ref|XP_011046045.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=586

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R NSSNY PLIGWMHGAQMVAFNMQG+GRSLWLMQGMFR+NG
Sbjct  367  EIVRFTQRNILRVYPKGIRVNSSNYNPLIGWMHGAQMVAFNMQGHGRSLWLMQGMFRANG  426

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKP  L+  GP+ EVF+ K +L  +KTLKVK+YMG+GW+ DF  THFD+YSPPDF
Sbjct  427  GCGFVKKPSFLLKSGPHGEVFDTKAKLPKQKTLKVKIYMGEGWYYDFHHTHFDAYSPPDF  486

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD VMKKTK  ED+W P W EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  487  YARVGIAGVPADTVMKKTKTLEDSWIPYWNEEFEFPLTVPELALLRIEVHEYDMSEKDDF  546

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL DRKGE+Y  V+LL+R EFV
Sbjct  547  GGQTCLPVWELREGIRAVPLHDRKGERYKCVKLLVRLEFV  586



>ref|XP_003600904.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AAL17948.1| phosphoinositide-specific phospholipase C [Medicago truncatula]
 gb|AES71155.1| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=593

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  374  EIVRFTQQNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  433

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD L+  GPN E+F+PK  L  K TLKV VYMG+GW+ DFK THFD +SPPDF
Sbjct  434  GCGFVKKPDFLLKTGPNNEIFDPKANLPSKTTLKVTVYMGEGWYYDFKHTHFDQFSPPDF  493

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  ED+W P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  494  YARVGIAGVPFDTVMKKTKSIEDSWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  553

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRA+PL  RKG+KYN+V+LLMRFEF+
Sbjct  554  GGQTCLPVWELRSGIRAIPLHSRKGDKYNNVKLLMRFEFI  593



>ref|XP_004958809.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Setaria italica]
 ref|XP_004958810.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Setaria italica]
Length=601

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ NILR+YPKGTR  SSNY P +GW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  383  TEIVRFTQRNILRIYPKGTRVTSSNYNPFLGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  442

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  EVF+P+ R  VKKTLKVKVY+GDGW +DFKQTHFD YSPPD
Sbjct  443  GGCGYVKKPDFLMQTEP--EVFDPRERQPVKKTLKVKVYLGDGWRMDFKQTHFDQYSPPD  500

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD +MKKT+  EDNW PVW EEF FPLTVPE+ALLR+EVHE+D+SEKDD
Sbjct  501  FYARVGIAGVPADSMMKKTRAIEDNWVPVWEEEFTFPLTVPEIALLRVEVHEYDMSEKDD  560

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQT LPV+ELRPGIRAV L DRKG +YN V+LLMRFEFV
Sbjct  561  FGGQTVLPVSELRPGIRAVALFDRKGNQYNHVKLLMRFEFV  601



>gb|AAM90315.1| phospholipase C [Pisum sativum]
Length=594

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  375  EIVRFTQRNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD L+  GPN EVF+PK  L +K TLKV VYMG+GW+ DF  THFD +SPPDF
Sbjct  435  GCGFVKKPDFLLKTGPNNEVFDPKASLPLKTTLKVTVYMGEGWYYDFDHTHFDQFSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D +MKKTK  ED+W P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  495  YARVGIAGVPFDTIMKKTKTVEDSWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  RKG KYN+V+LLMRFEF+
Sbjct  555  GGQTCLPVWELRTGIRAVPLHSRKGGKYNNVKLLMRFEFI  594



>ref|XP_011042811.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=586

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR NSSNY PLIGWMHGAQMVAFNMQG+GRSLWLMQGMFR+NG
Sbjct  367  EIVRFTQRNILRVYPKGTRVNSSNYNPLIGWMHGAQMVAFNMQGHGRSLWLMQGMFRANG  426

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKP  L+  GP+ EVF+ K +L  +KTLKVK+YMG+GW  DF+ T+FD+YSPPDF
Sbjct  427  GCGFVKKPSFLLKSGPHGEVFDTKAKLPKQKTLKVKIYMGEGWFYDFQHTYFDAYSPPDF  486

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD VMKKTK  ED+W P W EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  487  YARVGIAGVPADTVMKKTKTLEDSWIPYWNEEFEFPLTVPELALLRIEVHEYDMSEKDDF  546

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL DRKGE+Y  V+LL+R EFV
Sbjct  547  GGQTCLPVWELREGIRAVPLHDRKGERYKCVKLLVRLEFV  586



>ref|XP_010505719.1| PREDICTED: phosphoinositide phospholipase C 6-like [Camelina 
sativa]
Length=614

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRF SSNYKPLIGW HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  395  DVVRFTQRNLLRIYPKGTRFKSSNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANG  454

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ +L VK+TLKVKVYMGDGW +DF  THFD+YSPPDF
Sbjct  455  GCGYVKKPNFLMKKGFHDEVFDPRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDF  514

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD   +KTKI EDNW P+W EEF FPLTVPELALLRIEV E+D+SEKDDF
Sbjct  515  YTKMFIVGVPADNTKRKTKIIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDF  574

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  575  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  613



>dbj|BAK01542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=610

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY P IGW+HGAQMVAFNMQGYGR+LWLM G +R+N
Sbjct  392  TEIVRFTQRNLLRIYPKGTRVTSSNYNPFIGWVHGAQMVAFNMQGYGRALWLMHGFYRAN  451

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  EVF+PKT   VKKTLKVKVYMGDGW +DFKQTHFD YSPPD
Sbjct  452  GGCGYVKKPDFLMQSEP--EVFDPKTPQPVKKTLKVKVYMGDGWRMDFKQTHFDQYSPPD  509

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKTK  EDNW PVWG+EF F LTVPELALLR+EVHE+D+SEKDD
Sbjct  510  FYARVGIAGVPADSVMKKTKAVEDNWVPVWGDEFSFGLTVPELALLRVEVHEYDMSEKDD  569

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQT LPV+EL+PGIRAV L DRKG KY + +LLMRFEFV
Sbjct  570  FAGQTVLPVSELQPGIRAVALFDRKGNKYPNAKLLMRFEFV  610



>emb|CAC81703.2| phospholipase C [Oryza sativa]
Length=280

 Score =   352 bits (904),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ NILRVYPKGTR NSSNY P+  W HGAQMVAFNMQG+ ++L LMQG FR+N
Sbjct  60   ADVIRFTQKNILRVYPKGTRINSSNYDPMNAWTHGAQMVAFNMQGHDKALRLMQGFFRAN  119

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+P   + VKKTLKVKVYMGDGW +DF +THFD++SPPD
Sbjct  120  GGCGYVKKPDFLLRTGPNGEVFDPNASMPVKKTLKVKVYMGDGWRMDFSKTHFDTFSPPD  179

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGV AD VMKKT+  ED W P+W EEF FPLTVPELA+LRIEVHE+D+SEK D
Sbjct  180  FYTRVGIAGVRADCVMKKTRTIEDQWVPMWDEEFTFPLTVPELAVLRIEVHEYDMSEKHD  239

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL DR+G +Y SVRLLMRF+F+
Sbjct  240  FGGQTCLPVSELKQGIRAVPLHDRRGTRYKSVRLLMRFDFL  280



>ref|XP_009385550.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=570

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NI+RVYPKGTRFNSSNY PL GW+HGAQMVA NMQGYGRSLWLMQG+FR+NG
Sbjct  351  DLVRFTQKNIVRVYPKGTRFNSSNYCPLPGWLHGAQMVALNMQGYGRSLWLMQGLFRANG  410

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYV+KPD LMN+GP   V NP+  L VK TLKVK+YMGDGWH DF +THFD YSPPDF
Sbjct  411  GCGYVRKPDFLMNIGPQAAVSNPEASLPVKITLKVKIYMGDGWHKDFSRTHFDVYSPPDF  470

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +V IAGVPAD   K+T+ ++D+W PVWGEEF FPLTVPELALLRIE  E+++S+ DDF
Sbjct  471  YAKVEIAGVPADIKTKRTRTRQDDWMPVWGEEFSFPLTVPELALLRIEACEYNMSDMDDF  530

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV EL+PGIRAVPL DRKG KYNSVRLLMRF+FV
Sbjct  531  GGQTCLPVWELKPGIRAVPLHDRKGNKYNSVRLLMRFQFV  570



>gb|AEK84223.1| phosphoinositide-specific phospholipase-like protein [Cucurbita 
maxima]
Length=597

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ NILRVYPKG R +SSNY P+IGW+HGAQMVA NMQGYGRSLWLM GMFR+NGG
Sbjct  379  IVRFTQQNILRVYPKGIRVDSSNYNPMIGWIHGAQMVALNMQGYGRSLWLMHGMFRANGG  438

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD ++  G + ++F+PK RL VK TLKV VYMG+GW+ DF  THFD+YSPPDFY
Sbjct  439  CGYVKKPDFMLKPGSDDQIFDPKVRLPVKTTLKVTVYMGEGWYYDFHHTHFDAYSPPDFY  498

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W EEF FPL+VPELALLRIEVHE+D+SEKDDF 
Sbjct  499  TRVGIAGVPADTVMKKTKTLEDNWVPAWNEEFEFPLSVPELALLRIEVHEYDMSEKDDFG  558

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPVAELR GIRA+PL + KGEKY SV+LLM FEFV
Sbjct  559  GQTCLPVAELRKGIRAIPLRNVKGEKYKSVKLLMGFEFV  597



>ref|XP_009143251.1| PREDICTED: phosphoinositide phospholipase C 6 [Brassica rapa]
Length=615

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ NILR+YPKGTRFNSSNYKPL GW+HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  396  DVVRFTQRNILRIYPKGTRFNSSNYKPLSGWIHGAQMIAFNMQGYGKSLWLMHGMFRANG  455

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+P+ ++ VK+TLKVKVYMGDGW LDF  THFDSYSPPDF
Sbjct  456  GCGYVKKPNFLMKKGFHDEVFDPRKKIPVKETLKVKVYMGDGWRLDFSHTHFDSYSPPDF  515

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+V I GVPAD   +KT++ EDNW P+W EEF FPLTVPELALLRIEV E+D+S+KDDF
Sbjct  516  YTKVYIVGVPADNAKRKTRVIEDNWYPIWDEEFSFPLTVPELALLRIEVSEYDMSDKDDF  575

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SV+LLMRF F
Sbjct  576  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVKLLMRFIF  614



>gb|ADR00313.1| phosphoinositide-specific phospholipase C1 [Triticum aestivum]
Length=506

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 187/221 (85%), Gaps = 2/221 (1%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY P IGW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  288  TEIVRFTQRNLLRIYPKGTRVTSSNYNPFIGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  347

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM   P  EVF+PK    VKKTLKVKVYMGDGW +DFKQTHFD YSPPD
Sbjct  348  GGCGYVKKPDFLMQSEP--EVFDPKKPQPVKKTLKVKVYMGDGWRMDFKQTHFDQYSPPD  405

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKTK  EDNW PVWGEEF F LTVPELALLR+E HE+D+SEKDD
Sbjct  406  FYARVGIAGVPADSVMKKTKAVEDNWVPVWGEEFSFDLTVPELALLRVEAHEYDMSEKDD  465

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQT LPV+EL+PGIRAV L DRKG K  +V+LLMRFEFV
Sbjct  466  FAGQTVLPVSELQPGIRAVALFDRKGNKLPNVKLLMRFEFV  506



>ref|XP_010443621.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Camelina sativa]
Length=590

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
             V+    +++R+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+NGG
Sbjct  372  AVAAYGTDVIRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRANGG  431

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD LMNVGPN + F PK  L  KKTLKVKV MGDGW LDFK+THFDSYSPPDF+
Sbjct  432  CGYVKKPDFLMNVGPNGQGFYPKDNLSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPDFF  491

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
             RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDDF 
Sbjct  492  VRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDKNEKDDFG  551

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  552  GQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  590



>ref|XP_002525652.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF36770.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=578

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKG R +SSNYKP+ GW+HGAQMVA NMQGYG+ LWLM GMFR+N
Sbjct  358  TDVVRFTQRNILRIYPKGIRIDSSNYKPMNGWLHGAQMVALNMQGYGKPLWLMHGMFRAN  417

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LMNVGP  +VFNPK +L VKKTLKVK+YMG+GWHLDFK+  +  +S PD
Sbjct  418  GGCGYVKKPDFLMNVGPENQVFNPKEKLPVKKTLKVKIYMGNGWHLDFKRAQYALFSSPD  477

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVG+AG PAD  MKKTK +E+NWTP+W EEF+F LTVPELALLR+EVH+  + EKDD
Sbjct  478  FYIRVGMAGAPADNTMKKTKKRENNWTPIWNEEFIFALTVPELALLRVEVHDRIMPEKDD  537

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV++LRPGI A+PL DRKG K++S+RLLMRFEF+
Sbjct  538  FAGQTCLPVSQLRPGIHAIPLFDRKGNKFSSMRLLMRFEFL  578



>gb|EYU22354.1| hypothetical protein MIMGU_mgv1a001900mg [Erythranthe guttata]
Length=741

 Score =   367 bits (942),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILRV+PKGTR  SSN++P  GWMHGAQMVAFNMQGYG+SLW+M G+FR+N
Sbjct  521  TDVVRFTQKNILRVFPKGTRVTSSNFRPTTGWMHGAQMVAFNMQGYGKSLWMMHGLFRAN  580

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY KKPDLL   GPN EVF+PK+ L VKKTLKV VYMGDGW LDF QTHFD++SPPD
Sbjct  581  GGCGYFKKPDLLTRRGPNDEVFDPKSTLAVKKTLKVTVYMGDGWALDFSQTHFDAFSPPD  640

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I GVPAD   +KT++ ED+W P W EEF FPLTVPELALLRIEV EHDLSEKDD
Sbjct  641  FYTKVHIVGVPADAAKRKTRVIEDDWIPYWDEEFSFPLTVPELALLRIEVREHDLSEKDD  700

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            F GQTCLPV+ELRPGIR+VPL D+KG KY SV+LLM+F F
Sbjct  701  FGGQTCLPVSELRPGIRSVPLYDKKGHKYKSVKLLMKFHF  740



>ref|XP_010685545.1| PREDICTED: phosphoinositide phospholipase C 4-like [Beta vulgaris 
subsp. vulgaris]
Length=582

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD++ +TQ NI+R++PK TRFNSSNY+P +GWMHGAQMVAFNMQG+G+ LWLM GMF++N
Sbjct  362  TDIIRYTQKNIMRIFPKVTRFNSSNYEPFLGWMHGAQMVAFNMQGHGKPLWLMHGMFKAN  421

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYVKKPD LM++GP  +VF+PK  L VK TLKVK+Y+GDGW  DFKQTHFD++SPPD
Sbjct  422  GSCGYVKKPDFLMSIGPENQVFDPKADLPVKITLKVKIYLGDGWREDFKQTHFDTFSPPD  481

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY +VGIAG PADEVMKKTK+ ED+W P W EEF FPL +PELALLRIEVHE+D ++KDD
Sbjct  482  FYAKVGIAGAPADEVMKKTKVIEDHWRPAWNEEFSFPLKIPELALLRIEVHEYDKTDKDD  541

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV EL+PGI AVP+CD KG++Y SV+LLM+F FV
Sbjct  542  FAGQTCLPVHELKPGIHAVPICDNKGKEYPSVKLLMQFTFV  582



>ref|XP_010535594.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Tarenaya hassleriana]
Length=479

 Score =   358 bits (919),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ N+LR+YPKG R +SSNY P +GW HGAQMVAFNMQG+GRSLW+MQGM+R+NG
Sbjct  260  EIVRFTQRNLLRIYPKGVRVDSSNYNPFVGWSHGAQMVAFNMQGHGRSLWVMQGMYRANG  319

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP +L+   PN +VF+PK  L  K TL+V VYMG+GW+ DF+ THFD YSPPDF
Sbjct  320  GCGYVKKPHILLKSSPNNDVFDPKATLPQKTTLRVTVYMGEGWYYDFRHTHFDQYSPPDF  379

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  380  YTRVGIAGVPADSVMKKTKTLEDNWIPSWDEAFEFPLTVPELALLRIEVHEYDMSEKDDF  439

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL +RKGEKY SV+LLMRFEFV
Sbjct  440  GGQTCLPVWELRQGIRAVPLHNRKGEKYKSVKLLMRFEFV  479



>gb|ACF93733.1| phospholipase C [Spinacia oleracea]
Length=587

 Score =   362 bits (928),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FT  N+LR+YPKGTR  SSNY PL+GWMHGAQMVAFNMQG GRSLWLMQGMFR+NG
Sbjct  368  DIVRFTHKNMLRIYPKGTRITSSNYNPLVGWMHGAQMVAFNMQGCGRSLWLMQGMFRANG  427

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP  L+N GPN EVF+PK +L VKKTLKV V+MG+GW+ DFK THFD +SPPDF
Sbjct  428  GCGYVKKPHFLLNSGPNGEVFDPKIKLPVKKTLKVTVFMGEGWYYDFKHTHFDQFSPPDF  487

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV AD VMKKTK  EDNW P W EEF FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  488  YVRVGIAGVAADTVMKKTKTLEDNWIPAWNEEFEFPLSVPELALLRIEVHEYDMSEKDDF  547

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQT LPV E+  GIR+VPLC+R+G KY SV+LLMRF+F+
Sbjct  548  GGQTVLPVWEISEGIRSVPLCNREGIKYPSVKLLMRFQFI  587



>ref|XP_010937846.1| PREDICTED: phosphoinositide phospholipase C 2-like [Elaeis guineensis]
Length=590

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 187/220 (85%), Gaps = 1/220 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T+++ FT+ N+LR+YPKG R  SSNY PL+GWMHGAQMVA NMQGYGR+LWLM GMFR+N
Sbjct  369  TEIIRFTRKNLLRIYPKGMRITSSNYNPLLGWMHGAQMVALNMQGYGRALWLMHGMFRAN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L++  P+   F+PK  L VKKTLKV+VYMGDGW  DF  THFD+YSPPD
Sbjct  429  GGCGYVKKPDFLLDNVPD-RFFDPKAALPVKKTLKVRVYMGDGWRFDFHHTHFDTYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGVPAD VM++T+  EDNWTPVW EEF F LTVPELALLR+EVHE+D+SEKDD
Sbjct  488  FYTRVGIAGVPADTVMRRTRAVEDNWTPVWDEEFEFRLTVPELALLRVEVHEYDMSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            FAGQTCLPV ELRPGIR VPLCDRKGE   SV+LLM FEF
Sbjct  548  FAGQTCLPVWELRPGIRCVPLCDRKGETLKSVKLLMHFEF  587



>ref|XP_006338847.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum tuberosum]
Length=591

 Score =   362 bits (928),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTR  SSN+KP+ GWMHGAQMVAFNMQGYG+SLW+M GMFRSN
Sbjct  371  TDLVRFTQKNILRVYPKGTRVTSSNFKPMTGWMHGAQMVAFNMQGYGKSLWMMHGMFRSN  430

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYVKKP  LM++GP+ EVF+PK +L VKKTL+V+VYMGDGW LDF  THFD+YSPPD
Sbjct  431  GSCGYVKKPQFLMDIGPHNEVFDPKVKLPVKKTLQVRVYMGDGWRLDFSHTHFDAYSPPD  490

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ + GVPAD   KKT+I ED+W PVW EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  491  FYTKLYLVGVPADTRKKKTRILEDDWCPVWDEEFNFPLTVPELALLRIEVREYDMSEKDD  550

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIR+VPL D+KG K  SVRLLMRF+F+
Sbjct  551  FGGQTCLPVSELRTGIRSVPLYDKKGHKMKSVRLLMRFQFL  591



>gb|AJA33385.1| phosphatidylinositol phospholipase C 5 [Solanum lycopersicum]
Length=593

 Score =   362 bits (928),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTR  SSN+KP+ GWMHGAQMVAFNMQGYG+SLW+M GMFRSN
Sbjct  373  TDLVRFTQKNILRVYPKGTRVTSSNFKPMTGWMHGAQMVAFNMQGYGKSLWMMHGMFRSN  432

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYVKKP  LM+ GPN EVF+PK +L VK+TL+V+VYMGDGW LDF  THFD+YSPPD
Sbjct  433  GSCGYVKKPQFLMDKGPNNEVFDPKVKLPVKQTLQVRVYMGDGWRLDFSHTHFDAYSPPD  492

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ + GVPAD   KKT+I ED+W PVW EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  493  FYTKLYLVGVPADSRKKKTRILEDDWCPVWDEEFNFPLTVPELALLRIEVREYDMSEKDD  552

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIR+VPL D+KG K  SVRLLMRF+F+
Sbjct  553  FGGQTCLPVSELRTGIRSVPLYDKKGHKMKSVRLLMRFQFL  593



>gb|KDP46487.1| hypothetical protein JCGZ_08459 [Jatropha curcas]
Length=571

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKG R +SSNYKP+ GW+HGAQMVA NMQGYG+SLWLM GMFRSN
Sbjct  351  TDVVRFTQKNILRIYPKGIRIDSSNYKPMNGWLHGAQMVALNMQGYGKSLWLMHGMFRSN  410

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM +GP  +VF+PK +L VKKTLKVKVYMGDGW+LDFK+  F  +S PD
Sbjct  411  GGCGYVKKPDFLMTMGPENQVFDPKAKLPVKKTLKVKVYMGDGWYLDFKRAQFALFSSPD  470

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAG P D+ MKKTK  E+NW P+W EEF+FPLTVPELALLR+EVH+  + EKDD
Sbjct  471  FYTRVGIAGAPPDKTMKKTKKSENNWMPIWNEEFIFPLTVPELALLRVEVHDRIMPEKDD  530

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            FAGQTCLPV++LRPGI AVPL DRKG K++S+RLLM FEF+
Sbjct  531  FAGQTCLPVSQLRPGIHAVPLFDRKGNKFSSIRLLMCFEFL  571



>ref|XP_010483472.1| PREDICTED: phosphoinositide phospholipase C 4 isoform X2 [Camelina 
sativa]
Length=590

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
             V+    +++R+YPKGTRFNSSNYKP IGWM GAQM+AFNMQGYGR+LWLM+GMFR+NGG
Sbjct  372  AVAAYGADVIRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRANGG  431

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGYVKKPD LMNVGPN + F PK     KKTLKVKV MGDGW LDFK+THFDSYSPPDF+
Sbjct  432  CGYVKKPDFLMNVGPNGQGFYPKDNSSPKKTLKVKVCMGDGWLLDFKKTHFDSYSPPDFF  491

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
             RVGIAG P DEVM+KTKI+ D WTP+W +EF FPL VPELALLR+EVHEHD +EKDDF 
Sbjct  492  VRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDKNEKDDFG  551

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV+ELR GIRAVPL +RKG KY+S RLLMRFEFV
Sbjct  552  GQTCLPVSELRQGIRAVPLFNRKGVKYSSTRLLMRFEFV  590



>gb|KHN36373.1| Phosphoinositide phospholipase C 2 [Glycine soja]
Length=551

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  332  EIVRFTQRNILRVYPKGTRITSTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  391

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+ VG N EVF+PK  L VK TLKV +YMG+GW  DFK THFD +SPPDF
Sbjct  392  GCGYVKKPDFLLKVGQNNEVFDPKAHLPVKTTLKVTIYMGEGWFHDFKHTHFDKFSPPDF  451

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKT+  EDNW+P W + F FPL VPELALLR+EVHE+D+SEKDDF
Sbjct  452  YARVGIAGVPNDTVMKKTEKVEDNWSPSWNQVFEFPLAVPELALLRVEVHEYDMSEKDDF  511

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  R G+KY +V+LLMRFEF+
Sbjct  512  GGQTCLPVWELRSGIRAVPLYSRNGDKYANVKLLMRFEFI  551



>ref|XP_007163546.1| hypothetical protein PHAVU_001G243300g [Phaseolus vulgaris]
 gb|ESW35540.1| hypothetical protein PHAVU_001G243300g [Phaseolus vulgaris]
Length=591

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  372  EIVRFTQRNILRVYPKGTRITSTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP  L+  G N EVF+PK  L VKKTLKV +YMG+GW  DFK THFD YSPPDF
Sbjct  432  GCGYVKKPHFLLESGLNDEVFDPKADLPVKKTLKVTIYMGEGWFHDFKHTHFDQYSPPDF  491

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKT   EDNW+P W + F FPL+VPELALLR+EVHE+D+SEKDDF
Sbjct  492  YARVGIAGVPCDAVMKKTGTIEDNWSPSWNKAFEFPLSVPELALLRVEVHEYDMSEKDDF  551

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  +KGEKY +V+LLMRFEF+
Sbjct  552  GGQTCLPVWELRSGIRAVPLYSQKGEKYENVKLLMRFEFI  591



>ref|XP_003552353.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform 1 
[Glycine max]
Length=592

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  S+NY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  373  EIVRFTQRNILRVYPKGTRITSTNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  432

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+ VG N EVF+PK  L VK TLKV +YMG+GW  DFK THFD +SPPDF
Sbjct  433  GCGYVKKPDFLLKVGQNNEVFDPKAHLPVKTTLKVTIYMGEGWFHDFKHTHFDKFSPPDF  492

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKT+  EDNW+P W + F FPL VPELALLR+EVHE+D+SEKDDF
Sbjct  493  YARVGIAGVPNDTVMKKTEKVEDNWSPSWNQVFEFPLAVPELALLRVEVHEYDMSEKDDF  552

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  R G+KY +V+LLMRFEF+
Sbjct  553  GGQTCLPVWELRSGIRAVPLYSRNGDKYANVKLLMRFEFI  592



>ref|XP_004500490.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Cicer arietinum]
Length=595

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  376  EIVRFTQRNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
             CG+VKKPD L+  GPN EVF+PK  L VK TLKV VY+G+GW+ DFK THFD +SPPDF
Sbjct  436  RCGFVKKPDFLLKTGPNNEVFDPKAPLPVKTTLKVTVYIGEGWYYDFKHTHFDQFSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D  MKKTK  EDNW P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  496  YARVGIAGVPFDTTMKKTKSIEDNWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RK  KYN+V+LLMRFEF+
Sbjct  556  GGQTCLPVSELRSGIRAVPLHSRKDVKYNNVKLLMRFEFI  595



>ref|XP_004500491.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Cicer arietinum]
Length=594

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  375  EIVRFTQRNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
             CG+VKKPD L+  GPN EVF+PK  L VK TLKV VY+G+GW+ DFK THFD +SPPDF
Sbjct  435  RCGFVKKPDFLLKTGPNNEVFDPKAPLPVKTTLKVTVYIGEGWYYDFKHTHFDQFSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D  MKKTK  EDNW P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  495  YARVGIAGVPFDTTMKKTKSIEDNWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL  RK  KYN+V+LLMRFEF+
Sbjct  555  GGQTCLPVSELRSGIRAVPLHSRKDVKYNNVKLLMRFEFI  594



>ref|XP_009586601.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=560

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LRVYPKG R +SSNY P +GW HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  341  EIIRFTQKNLLRVYPKGIRVDSSNYDPFVGWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  400

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P  +L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  401  GCGYVKKPDLLLTAGPNNEVFDPTKKLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  460

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVPAD + KKTK  +DNW P W E+F FPLTVPELALLRI+V +++ S+KD+F
Sbjct  461  YAKVGIAGVPADAIKKKTKTMDDNWIPTWDEQFEFPLTVPELALLRIKVLDYNRSDKDEF  520

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL DRKGEKY+SV+L MRFEFV
Sbjct  521  AGQTCLPVPELRQGIRAVPLFDRKGEKYSSVKLFMRFEFV  560



>ref|XP_009586600.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=561

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LRVYPKG R +SSNY P +GW HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  342  EIIRFTQKNLLRVYPKGIRVDSSNYDPFVGWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  401

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P  +L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  402  GCGYVKKPDLLLTAGPNNEVFDPTKKLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  461

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVPAD + KKTK  +DNW P W E+F FPLTVPELALLRI+V +++ S+KD+F
Sbjct  462  YAKVGIAGVPADAIKKKTKTMDDNWIPTWDEQFEFPLTVPELALLRIKVLDYNRSDKDEF  521

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL DRKGEKY+SV+L MRFEFV
Sbjct  522  AGQTCLPVPELRQGIRAVPLFDRKGEKYSSVKLFMRFEFV  561



>ref|NP_001234176.1| PI-phospholipase C PLC5 [Solanum lycopersicum]
 gb|ABW80999.1| PI-phospholipase C PLC5 [Solanum lycopersicum]
Length=584

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NILRVYPKGTR  SSN+KP+ GWMHGAQMVAFNMQGYG+SLW+M GMFRSN
Sbjct  364  TDLVRFTQKNILRVYPKGTRVTSSNFKPMTGWMHGAQMVAFNMQGYGKSLWMMHGMFRSN  423

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYVKKP  LM+ GPN EVF+PK +L VK+TL+V+VYMGDGW LDF  THFD+YSPPD
Sbjct  424  GSCGYVKKPQFLMDKGPNNEVFDPKVKLPVKQTLQVRVYMGDGWRLDFSHTHFDAYSPPD  483

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ + GVPAD   KKT+I ED+W PVW EEF FPLTVPELALLR EV E+D+SEKDD
Sbjct  484  FYTKLYLVGVPADSRKKKTRILEDDWCPVWDEEFNFPLTVPELALLRTEVREYDMSEKDD  543

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELR GIR+VPL D+KG K  SVRLLMRF+F+
Sbjct  544  FGGQTCLPVSELRTGIRSVPLYDKKGHKMKSVRLLMRFQFL  584



>ref|XP_009783480.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana sylvestris]
Length=565

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LRVYPKG R +SSNY P +GW HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  346  EIIRFTQKNLLRVYPKGIRVDSSNYDPFVGWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  405

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P  +L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  406  GCGYVKKPDLLLTAGPNNEVFDPTKKLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  465

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVPAD + KKTK  +DNW P W E+F FPLTVPELALLRI+V +++ S+KD+F
Sbjct  466  YAKVGIAGVPADAIKKKTKTMDDNWIPTWDEQFEFPLTVPELALLRIKVLDYNRSDKDEF  525

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL DRKGEKY+SV+L MRFEF+
Sbjct  526  AGQTCLPVPELRQGIRAVPLFDRKGEKYSSVKLFMRFEFI  565



>ref|XP_010535516.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Tarenaya hassleriana]
Length=583

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ N+LR+YPKG R +SSNY P +GW HGAQMVAFNMQG+GRSLW+MQGM+R+NG
Sbjct  364  EIVRFTQRNLLRIYPKGVRVDSSNYNPFVGWSHGAQMVAFNMQGHGRSLWVMQGMYRANG  423

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP +L+   PN +VF+PK  L  K TL+V VYMG+GW+ DF+ THFD YSPPDF
Sbjct  424  GCGYVKKPHILLKSSPNNDVFDPKATLPQKTTLRVTVYMGEGWYYDFRHTHFDQYSPPDF  483

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  484  YTRVGIAGVPADSVMKKTKTLEDNWIPSWDEAFEFPLTVPELALLRIEVHEYDMSEKDDF  543

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL +RKGEKY SV+LLMRFEFV
Sbjct  544  GGQTCLPVWELRQGIRAVPLHNRKGEKYKSVKLLMRFEFV  583



>ref|XP_002533649.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF28737.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=601

 Score =   360 bits (923),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 187/220 (85%), Gaps = 2/220 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTR  SSNY+P+IGWMHGAQM+AFNMQGYG+SLWLM GMFR NG
Sbjct  384  DLVRFTQENILRVYPKGTRITSSNYEPIIGWMHGAQMIAFNMQGYGKSLWLMHGMFRGNG  443

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGY+KKPD LM    + E+F+PK  L V KTLKVKVY+GDGW LDF  THFDSYSPPDF
Sbjct  444  GCGYLKKPDFLMQ--KDEELFDPKRTLSVIKTLKVKVYLGDGWRLDFSHTHFDSYSPPDF  501

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD+  +KTKI EDNW P W EEF FPLTVPELALLR+EV E+D+SEKDDF
Sbjct  502  YTKLYIVGVPADDAKRKTKIIEDNWAPAWNEEFAFPLTVPELALLRVEVREYDMSEKDDF  561

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELRPGIR+VPL D+KGEK N+ RLLM+FEFV
Sbjct  562  GGQTCLPVSELRPGIRSVPLHDKKGEKLNNARLLMKFEFV  601



>ref|XP_009783481.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana sylvestris]
Length=561

 Score =   358 bits (919),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LRVYPKG R +SSNY P +GW HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  342  EIIRFTQKNLLRVYPKGIRVDSSNYDPFVGWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  401

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P  +L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  402  GCGYVKKPDLLLTAGPNNEVFDPTKKLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  461

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVPAD + KKTK  +DNW P W E+F FPLTVPELALLRI+V +++ S+KD+F
Sbjct  462  YAKVGIAGVPADAIKKKTKTMDDNWIPTWDEQFEFPLTVPELALLRIKVLDYNRSDKDEF  521

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL DRKGEKY+SV+L MRFEF+
Sbjct  522  AGQTCLPVPELRQGIRAVPLFDRKGEKYSSVKLFMRFEFI  561



>ref|XP_007008969.1| Phosphoinositide-specific phospholipase C family protein [Theobroma 
cacao]
 gb|EOY17779.1| Phosphoinositide-specific phospholipase C family protein [Theobroma 
cacao]
Length=597

 Score =   359 bits (922),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +DVVSFTQ NILR+YPKGTRF SSNYKP IGWMHGAQM+AFNMQGYG+SLWLM GMFR+N
Sbjct  377  SDVVSFTQKNILRIYPKGTRFTSSNYKPTIGWMHGAQMIAFNMQGYGKSLWLMHGMFRAN  436

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYV+KPD LM  G +  V +PK  L V+K LKVK+YMGDGW LDF  THFD+YSPPD
Sbjct  437  GGCGYVRKPDFLMQKGSHDVVLDPKITLPVQKMLKVKIYMGDGWRLDFSHTHFDTYSPPD  496

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I GVPADE  +KT+I  D+W+PVW EEF +PLTVP+LALLRIEV E+D+SEKDD
Sbjct  497  FYTKVYIVGVPADEAKRKTRIIGDDWSPVWDEEFTYPLTVPDLALLRIEVREYDMSEKDD  556

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV++LRPGIR+VPL D+KG+K  + RLLM+FEFV
Sbjct  557  FGGQTCLPVSDLRPGIRSVPLHDKKGKKLPNARLLMKFEFV  597



>ref|XP_009783482.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Nicotiana sylvestris]
Length=560

 Score =   358 bits (919),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LRVYPKG R +SSNY P +GW HGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  341  EIIRFTQKNLLRVYPKGIRVDSSNYDPFVGWTHGAQMVAFNMQGYGRSLWLMHGMFRANG  400

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GPN EVF+P  +L VK TLKV VYMGDGW  DF QTHFD+YSPPDF
Sbjct  401  GCGYVKKPDLLLTAGPNNEVFDPTKKLPVKTTLKVTVYMGDGWDKDFDQTHFDTYSPPDF  460

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVPAD + KKTK  +DNW P W E+F FPLTVPELALLRI+V +++ S+KD+F
Sbjct  461  YAKVGIAGVPADAIKKKTKTMDDNWIPTWDEQFEFPLTVPELALLRIKVLDYNRSDKDEF  520

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV ELR GIRAVPL DRKGEKY+SV+L MRFEF+
Sbjct  521  AGQTCLPVPELRQGIRAVPLFDRKGEKYSSVKLFMRFEFI  560



>emb|CDP06481.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   359 bits (921),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ N+LR++PK  R +SSNY PLIGW HGAQMVA NMQGYGR LWLMQG+FR+NG
Sbjct  375  DIVRFTQRNLLRIFPKAMRLDSSNYNPLIGWTHGAQMVALNMQGYGRYLWLMQGLFRANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+ +GP+ EVF+PK  L VKKTLKVKVYMGDGW+LDF  THFD YSPPDF
Sbjct  435  GCGYVKKPDILLQIGPHSEVFDPKRALPVKKTLKVKVYMGDGWNLDFHHTHFDMYSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGV  D  +KKTKI EDNW P W EEF F L VPELALLRIEVHE+D+SEKDDF
Sbjct  495  YVKVGIAGVSDDSAVKKTKIVEDNWVPTWEEEFEFQLRVPELALLRIEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIR VPL ++KGEKY SV+LLMRF+F+
Sbjct  555  GGQTCLPVSELREGIRGVPLYNQKGEKYKSVKLLMRFDFL  594



>ref|XP_008369255.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Malus domestica]
Length=594

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW +GAQMVAFNMQGYGR LW+MQGMFR+NG
Sbjct  375  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSYGAQMVAFNMQGYGRPLWVMQGMFRANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
             CGYVKKPD L+  GP+ EVF+PK  L VKKTLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  435  RCGYVKKPDFLLKSGPHNEVFDPKYSLPVKKTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGV  D VMKKTK  EDNW P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  495  YTRVGIAGVADDSVMKKTKALEDNWIPAWNEEFEFPLTVPELAVLRIEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL   KGEKY SV+LLM F+FV
Sbjct  555  GGQTCLPVSELRRGIRAVPLHCPKGEKYKSVKLLMHFDFV  594



>ref|XP_008369254.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Malus domestica]
Length=595

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKG R +SSNY P+IGW +GAQMVAFNMQGYGR LW+MQGMFR+NG
Sbjct  376  EIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSYGAQMVAFNMQGYGRPLWVMQGMFRANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
             CGYVKKPD L+  GP+ EVF+PK  L VKKTLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  436  RCGYVKKPDFLLKSGPHNEVFDPKYSLPVKKTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YTRVGIAGV  D VMKKTK  EDNW P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  496  YTRVGIAGVADDSVMKKTKALEDNWIPAWNEEFEFPLTVPELAVLRIEVHEYDMSEKDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL   KGEKY SV+LLM F+FV
Sbjct  556  GGQTCLPVSELRRGIRAVPLHCPKGEKYKSVKLLMHFDFV  595



>ref|XP_003600780.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AES71031.1| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=572

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  353  EIVRFTQQNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  412

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCG+VKKPD L+  GPN EVF+PK  L  K TLKV VYMG+GW+ DFK THFD +S PDF
Sbjct  413  GCGFVKKPDFLLQTGPNNEVFDPKAHLPSKTTLKVTVYMGEGWYYDFKHTHFDQFSSPDF  472

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  +++W P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  473  YARVGIAGVPFDTVMKKTKSTDNSWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  532

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRAVPL  R+G+KYN+V+LLMRFEF+
Sbjct  533  GGQTCLPVWELRNGIRAVPLHSREGDKYNNVKLLMRFEFI  572



>gb|ABF95389.1| phosphoinositide-specific phospholipase C, putative, expressed 
[Oryza sativa Japonica Group]
Length=490

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 189/220 (86%), Gaps = 1/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++VSFT  N+LR+YPKGTRFNSSNY P +GW+HGAQMVAFNMQGYGRSLWLM G +++NG
Sbjct  272  NIVSFTHKNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFNMQGYGRSLWLMHGFYKANG  331

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD +M   P+  VF+PK  L VKKTLKVKVYMG+GW  DFKQT+FD+YSPPDF
Sbjct  332  GCGYVKKPDFMMQTCPDGNVFDPKADLPVKKTLKVKVYMGEGWQSDFKQTYFDTYSPPDF  391

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVP+D VM+KTK  ED+W PVW EEF+FPLTVPE+ALLR+EVHE+D+SE DDF
Sbjct  392  YAKVGIAGVPSDSVMQKTKAVEDSWVPVWEEEFVFPLTVPEIALLRVEVHEYDVSE-DDF  450

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQT LPV+ELRPGIR VPL D KG K+ SV+LLMRFEFV
Sbjct  451  GGQTALPVSELRPGIRTVPLFDHKGLKFKSVKLLMRFEFV  490



>ref|XP_010031218.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Eucalyptus grandis]
Length=483

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D++ FTQ N+LRV+PK TRF+SSNY P+IGW +GAQMVA NMQG+GR LWLM GMFR+NG
Sbjct  264  DLIRFTQRNLLRVFPKSTRFDSSNYNPMIGWRYGAQMVALNMQGHGRPLWLMHGMFRANG  323

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  GP+ EVF+PK +L VK TLKV VYMG+GW+ DF +THFD+YSPPDF
Sbjct  324  GCGYVKKPEFLMKSGPDNEVFDPKAKLPVKTTLKVTVYMGEGWYYDFHRTHFDAYSPPDF  383

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD  MK+TK  EDNWTP W EEF FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  384  YARVGIAGVPADTGMKRTKTWEDNWTPAWNEEFEFPLTVPELALLRIEVHEYDVSEKDDF  443

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV ELR GIR+VPL + +GEKY SVRLLMRFEF
Sbjct  444  GGQTCLPVWELRRGIRSVPLHNYEGEKYPSVRLLMRFEF  482



>emb|CDP14020.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 191/220 (87%), Gaps = 2/220 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++SFTQ N+LRVYPKG RF+SSNY PLIGWMHGAQMVA NMQGYGRSLW+M+GMFR+NG
Sbjct  372  EIISFTQRNLLRVYPKGIRFDSSNYNPLIGWMHGAQMVALNMQGYGRSLWVMRGMFRANG  431

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYV+KPD+L+  G   E+F+PK +L VK TLKV V+MG+GW+ DF+ THFD+YSPPDF
Sbjct  432  GCGYVRKPDILLKTG--NEIFDPKAKLTVKTTLKVTVFMGEGWYYDFRHTHFDTYSPPDF  489

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD +MKKT+  EDNW P W E F FPLTVPELALLRIEVHE+D+S+KDDF
Sbjct  490  YARVGIAGVPADTLMKKTRTLEDNWIPNWNEHFEFPLTVPELALLRIEVHEYDMSDKDDF  549

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL ++KGE Y SV+LLMRF+F+
Sbjct  550  GGQTCLPVSELREGIRAVPLHNQKGEPYRSVKLLMRFQFI  589



>ref|XP_011084908.1| PREDICTED: phosphoinositide phospholipase C 6 [Sesamum indicum]
Length=588

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDV+ FTQ +ILRV+PK TR  SSN+KP  GWMHGAQMVAFNMQGYG+SLW+M G+FRSN
Sbjct  368  TDVIRFTQKSILRVFPKSTRVTSSNFKPTGGWMHGAQMVAFNMQGYGKSLWMMHGLFRSN  427

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPDLLM  GP+ EVF+PK  L VKKTLKV V+MGDGW LDF  THFD+YSPPD
Sbjct  428  GGCGYVKKPDLLMMGGPDNEVFDPKLTLPVKKTLKVTVFMGDGWRLDFSHTHFDAYSPPD  487

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPAD   KKT++ ED+WTP W E+F FPLTVPELALLRIEV EH+ SEKDD
Sbjct  488  FYTKIYIVGVPADAAKKKTRVIEDDWTPYWDEDFAFPLTVPELALLRIEVREHNRSEKDD  547

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            F GQTCLPV+ELRPGIRAVPL ++KG+K+ SVRLLMRF+F
Sbjct  548  FGGQTCLPVSELRPGIRAVPLYNKKGQKFKSVRLLMRFQF  587



>gb|KDO68972.1| hypothetical protein CISIN_1g007399mg [Citrus sinensis]
Length=605

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 189/235 (80%), Gaps = 14/235 (6%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQ--------------GY  651
             D+V FTQ N+LR+YPKG R +SSNY PLIGW HGAQMVAFNMQ              G+
Sbjct  371  NDIVRFTQRNLLRIYPKGIRVDSSNYNPLIGWSHGAQMVAFNMQEIEEGIEVNFLTGDGH  430

Query  650  GRSLWLMQGMFRSNGGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHL  471
            GRSLWLM GMFR+NGGCGYVKKP+ L+  GP+ EVF+PK +L  KKTLKV VYMG+GW+ 
Sbjct  431  GRSLWLMHGMFRANGGCGYVKKPNFLLQTGPHNEVFDPKVKLPAKKTLKVTVYMGEGWYY  490

Query  470  DFKQTHFDSYSPPDFYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALL  291
            DF  THFD+YSPPDFY RVGIAGVPAD VMKKTK  EDNW P W EEF FPL+VPELALL
Sbjct  491  DFPHTHFDAYSPPDFYARVGIAGVPADTVMKKTKTLEDNWIPSWNEEFEFPLSVPELALL  550

Query  290  RIEVHEHDLSEKDDFAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            RIEVHE+D+SEKDDF GQTCLPV+EL+ GIRAVPL DRKGE+Y SV+LLM FEF+
Sbjct  551  RIEVHEYDMSEKDDFGGQTCLPVSELKQGIRAVPLHDRKGERYKSVKLLMHFEFI  605



>dbj|BAJ91552.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D++ FTQ NILR+YPKGTR NSSNY P+  W HGAQMVAFNMQG+ +SL LMQG FR+N
Sbjct  369  ADIIRFTQKNILRIYPKGTRINSSNYDPMKAWTHGAQMVAFNMQGHDKSLRLMQGFFRAN  428

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+PK  L VKKTLKVKVYMGDGW +DF +THFD++SPPD
Sbjct  429  GGCGYVKKPDFLLKTGPNGEVFDPKASLPVKKTLKVKVYMGDGWRMDFSKTHFDAFSPPD  488

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGV AD VMKKT+  ED W PVWGEEF FPLTVPELALLR+EV E+D+SEK D
Sbjct  489  FYARVGIAGVRADCVMKKTRTIEDQWVPVWGEEFTFPLTVPELALLRVEVQEYDMSEKHD  548

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV EL+ GIRAVPL DRKG +Y SVRLLMRFE +
Sbjct  549  FGGQTCLPVMELKQGIRAVPLHDRKGNRYKSVRLLMRFELI  589



>gb|KHG08567.1| Phosphoinositide phospholipase C 6 -like protein [Gossypium arboreum]
Length=577

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 187/221 (85%), Gaps = 3/221 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTRF SSNYKP IGWMHGAQMVAFNMQGYG+SLWLM GMFR+NG
Sbjct  359  DIVRFTQRNILRVYPKGTRFTSSNYKPTIGWMHGAQMVAFNMQGYGKSLWLMHGMFRANG  418

Query  605  GCGYVKKPDLLMNVGPNCEVFNPK-TRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GCGYV KPD+L       E+F+PK T L V+KTLKVK+YMGDGW LDFK THFD+YSPPD
Sbjct  419  GCGYVIKPDILTRSAD--ELFDPKATFLPVQKTLKVKIYMGDGWRLDFKHTHFDAYSPPD  476

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPADE  KKTKI ED+W PVW EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  477  FYTKIYIVGVPADEAKKKTKIIEDDWCPVWDEEFSFPLTVPELALLRIEVREYDISEKDD  536

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV ELR G R+VPL D+KG K+ +VRLLMRFEFV
Sbjct  537  FGGQTCLPVPELRTGFRSVPLHDKKGVKHKNVRLLMRFEFV  577



>ref|XP_009147001.1| PREDICTED: phosphoinositide phospholipase C 2 [Brassica rapa]
Length=585

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+ W HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  367  IVRFTQQNLLRIYPKGTRVTSSNYNPLVAWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  426

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPD+L+  G + ++F+PK  L VK TLKV +YMG+GW+ DF+ THFD YSPPDFY
Sbjct  427  CGYIKKPDILLKGGSDSDIFDPKATLPVKTTLKVTIYMGEGWYFDFRHTHFDQYSPPDFY  486

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  487  TRVGIAGVPADTVMKKTKTLEDNWVPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  546

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIRA PL +RKGEKY SV+LL+R EFV
Sbjct  547  GQTCLPVWELKEGIRAFPLHNRKGEKYKSVKLLVRCEFV  585



>gb|KJB67581.1| hypothetical protein B456_010G198000 [Gossypium raimondii]
Length=608

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 187/221 (85%), Gaps = 3/221 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTRF SSNYKP IGWMHGAQMVAFNMQGYG+SLWLM GMFR+NG
Sbjct  390  DIVRFTQRNILRVYPKGTRFTSSNYKPTIGWMHGAQMVAFNMQGYGKSLWLMHGMFRANG  449

Query  605  GCGYVKKPDLLMNVGPNCEVFNPK-TRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GCGYV KPD+L       E+F+PK T L V+KTLKVK+YMGDGW LDFK THFD+YSPPD
Sbjct  450  GCGYVIKPDILTRSAD--ELFDPKATLLPVQKTLKVKIYMGDGWRLDFKHTHFDAYSPPD  507

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPADE  KKTKI ED+W PVW EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  508  FYTKIFIVGVPADEAKKKTKIIEDDWCPVWDEEFSFPLTVPELALLRIEVREYDISEKDD  567

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV ELR G R+VPL D+KG K+ +VRLLMRFEFV
Sbjct  568  FGGQTCLPVPELRTGFRSVPLHDKKGVKHKNVRLLMRFEFV  608



>gb|KJB67580.1| hypothetical protein B456_010G198000 [Gossypium raimondii]
Length=596

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 187/221 (85%), Gaps = 3/221 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRVYPKGTRF SSNYKP IGWMHGAQMVAFNMQGYG+SLWLM GMFR+NG
Sbjct  378  DIVRFTQRNILRVYPKGTRFTSSNYKPTIGWMHGAQMVAFNMQGYGKSLWLMHGMFRANG  437

Query  605  GCGYVKKPDLLMNVGPNCEVFNPK-TRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GCGYV KPD+L       E+F+PK T L V+KTLKVK+YMGDGW LDFK THFD+YSPPD
Sbjct  438  GCGYVIKPDILTRSAD--ELFDPKATLLPVQKTLKVKIYMGDGWRLDFKHTHFDAYSPPD  495

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPADE  KKTKI ED+W PVW EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  496  FYTKIFIVGVPADEAKKKTKIIEDDWCPVWDEEFSFPLTVPELALLRIEVREYDISEKDD  555

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV ELR G R+VPL D+KG K+ +VRLLMRFEFV
Sbjct  556  FGGQTCLPVPELRTGFRSVPLHDKKGVKHKNVRLLMRFEFV  596



>ref|XP_007218974.1| hypothetical protein PRUPE_ppa003890mg [Prunus persica]
 gb|EMJ20173.1| hypothetical protein PRUPE_ppa003890mg [Prunus persica]
Length=542

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +DV+ FT  NILRVYPKGTRF SSNYKP +GWMHGAQMVAFNMQG  +  WLM GMFR+N
Sbjct  322  SDVLRFTSKNILRVYPKGTRFTSSNYKPHVGWMHGAQMVAFNMQGNDKYNWLMHGMFRAN  381

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM+ GPN EVF+PK  L VKKTLKVKVY G GWHLDF +THFDS+SPPD
Sbjct  382  GGCGYVKKPDFLMHKGPNDEVFDPKKTLTVKKTLKVKVYTGTGWHLDFSRTHFDSFSPPD  441

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I GVPAD   +KTKI ED W PVW EEF FPLT+PELA+LRIEV E+D SEKDD
Sbjct  442  FYTKVYIVGVPADCGKQKTKIIEDEWIPVWDEEFTFPLTIPELAILRIEVREYDRSEKDD  501

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQ CLPV+EL+PGIRAVPL D+KGEK+ SV+LLMRF+FV
Sbjct  502  FGGQNCLPVSELKPGIRAVPLYDKKGEKFKSVKLLMRFQFV  542



>emb|CDY27998.1| BnaC05g44000D [Brassica napus]
Length=546

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+ W HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  328  IVRFTQRNLLRIYPKGTRVTSSNYNPLVAWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  387

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPD+L+  G + ++F+PK  L VK TL+V +YMG+GW+ DF+ THFD YSPPDFY
Sbjct  388  CGYIKKPDILLKGGSDSDIFDPKATLPVKTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFY  447

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  448  TRVGIAGVPADTVMKKTKTLEDNWVPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  507

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIRA PL +RKGEKY SV+LL+R EFV
Sbjct  508  GQTCLPVWELKEGIRAFPLHNRKGEKYKSVKLLVRCEFV  546



>ref|XP_009612249.1| PREDICTED: phosphoinositide phospholipase C 2-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LRVYPKG R +SSNY PLIGWMHGAQMVAFNMQG GR LWLMQGMFR+NG
Sbjct  376  ELIRFTQRNLLRVYPKGIRVDSSNYNPLIGWMHGAQMVAFNMQGNGRPLWLMQGMFRANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+LL+  GPN EV +PK  L VK TLKVK+YMG GWHLDFK+THFD YSPPDF
Sbjct  436  GCGYVKKPELLLKDGPNNEVHDPKRLLSVKTTLKVKIYMGRGWHLDFKRTHFDIYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD  +KKT+  EDNW P W +EF FPLTVPE+ALLR+EVHE+D+SE DDF
Sbjct  496  YFKIGIAGVPADSRVKKTRPIEDNWVPTWNDEFEFPLTVPEIALLRVEVHEYDMSEIDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTC+PV+ELR GIRAVPL + KGEKY SV+LLMRFEFV
Sbjct  556  GGQTCIPVSELRTGIRAVPLYNEKGEKYPSVKLLMRFEFV  595



>emb|CDY20520.1| BnaC04g05240D [Brassica napus]
Length=608

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 190/221 (86%), Gaps = 2/221 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ NILR+YPKGTRFNSSNYKPLIGW+HGAQM+AFNMQGYG+SLWLM GMFR+NG
Sbjct  387  DVVRFTQRNILRIYPKGTRFNSSNYKPLIGWIHGAQMIAFNMQGYGKSLWLMHGMFRANG  446

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTL--KVKVYMGDGWHLDFKQTHFDSYSPP  432
            GCGYVKKP+ LM  G + EVF+P+ ++ VK+T+   VKVYMGDGW LDF  THFDSYSPP
Sbjct  447  GCGYVKKPNFLMKKGFHDEVFDPRKKIPVKETMAFNVKVYMGDGWRLDFSHTHFDSYSPP  506

Query  431  DFYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKD  252
            DFYT+V + GVPAD   +KT++ EDNW P+W EEF FPLTVPELALLRIEV E+D+S+KD
Sbjct  507  DFYTKVYVVGVPADNAKRKTRVIEDNWYPIWDEEFSFPLTVPELALLRIEVSEYDMSDKD  566

Query  251  DFAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            DF GQTCLPV+ELRPGIR+VPL D+KGEK  SV+LLMRF F
Sbjct  567  DFGGQTCLPVSELRPGIRSVPLYDKKGEKMKSVKLLMRFIF  607



>gb|KFK38259.1| phosphoinositide phospholipase c 2 [Arabis alpina]
Length=581

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+GW HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  363  IVRFTQRNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  422

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPDLL+  G + ++F+PK  L VK TL+V VYMG+GW+ DF+ THFD YSPPDFY
Sbjct  423  CGYIKKPDLLLKGGSDDDIFDPKATLPVKTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFY  482

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD +MKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  483  TRVGIAGVPADTIMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  542

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIRA PL  RKGEKY SV+LL+R EFV
Sbjct  543  GQTCLPVWELQEGIRAFPLHSRKGEKYKSVKLLVRCEFV  581



>ref|NP_001275298.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63777.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Solanum 
tuberosum]
Length=596

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D++ FTQ N+LR+YPKG R +SSNY PL+GWMHGAQMVAFNMQG+GR LWLMQGMF++NG
Sbjct  376  DLIRFTQRNLLRIYPKGMRVDSSNYNPLMGWMHGAQMVAFNMQGHGRPLWLMQGMFKANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+LL+    N EV +PK  L VK TLKVKVYMG GWHLDFK+THFD+YSPPDF
Sbjct  436  GCGYVKKPELLLKTDANNEVHDPKRLLSVKTTLKVKVYMGKGWHLDFKRTHFDAYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGV AD  +KKTK  EDNW P+W +EF FPLTVPELALLR+EVHE+D+SE DDF
Sbjct  496  YVKIGIAGVAADSRVKKTKAIEDNWIPIWNDEFEFPLTVPELALLRVEVHEYDMSEIDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTC+PV+ELR GIRAVP+ + KGEKY SV+LLMRFEFV
Sbjct  556  GGQTCIPVSELRTGIRAVPIYNEKGEKYPSVKLLMRFEFV  595



>emb|CDY35983.1| BnaA05g29670D [Brassica napus]
Length=585

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+ W HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  367  IVRFTQRNLLRIYPKGTRVTSSNYNPLVAWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  426

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPD+L+  G + ++F+PK  L VK TLKV +YMG+GW+ DF+ THFD YSPPDFY
Sbjct  427  CGYIKKPDILLKGGSDSDIFDPKATLPVKTTLKVTIYMGEGWYFDFRHTHFDQYSPPDFY  486

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  487  TRVGIAGVPADTVMKKTKTLEDNWVPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  546

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIRA PL +RKGEKY SV+LL+R EFV
Sbjct  547  GQTCLPVWELKEGIRAFPLHNRKGEKYKSVKLLVRCEFV  585



>ref|XP_006664643.1| PREDICTED: phosphoinositide phospholipase C 6-like [Oryza brachyantha]
Length=557

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ NILRVYPKGTR NSSNY P+  W HGAQMVAFNMQG+ ++L LMQG FR+N
Sbjct  337  ADVIRFTQKNILRVYPKGTRINSSNYDPMNAWTHGAQMVAFNMQGHDKALRLMQGFFRAN  396

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+P   + VKKTLKVKVYMGDGW +DF +THFD++SPPD
Sbjct  397  GGCGYVKKPDFLVRTGPNGEVFDPNASMPVKKTLKVKVYMGDGWRMDFSKTHFDTFSPPD  456

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGV AD VMKKT+  ED W PVW EEF FPLTVPELA+LRIEVHE+D+SEK D
Sbjct  457  FYTRVGIAGVRADCVMKKTQTIEDQWVPVWNEEFTFPLTVPELAVLRIEVHEYDMSEKHD  516

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL DR+G +Y SVRLLMRF+F+
Sbjct  517  FGGQTCLPVSELKQGIRAVPLHDRRGNRYKSVRLLMRFDFL  557



>ref|NP_001234197.1| PI-phospholipase C PLC2 [Solanum lycopersicum]
 gb|ABW81002.1| PI-phospholipase C PLC2 [Solanum lycopersicum]
Length=561

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG R +SSNY P +GWMHGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  342  EIIRFTQHNLLRIYPKGIRVDSSNYDPFVGWMHGAQMVAFNMQGYGRSLWLMHGMFRANG  401

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GP+ EVF+P   L VK TLKV VYMGDGW  DF QT FD+YSPPDF
Sbjct  402  GCGYVKKPDLLLKAGPDNEVFDPTANLPVKTTLKVTVYMGDGWDKDFDQTDFDTYSPPDF  461

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPADEV K+T+  +DNW P W E+F FPLTVPELALLRI+V +++LS+KD+F
Sbjct  462  YAKLGIAGVPADEVKKRTETIDDNWIPSWNEQFEFPLTVPELALLRIKVLDYNLSDKDEF  521

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            AGQTCLPVAELR GIRAVPL DRKGEKY+SV+LLM FEF
Sbjct  522  AGQTCLPVAELRQGIRAVPLYDRKGEKYSSVKLLMHFEF  560



>ref|XP_009385549.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=574

 Score =   356 bits (914),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 188/224 (84%), Gaps = 4/224 (2%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQ----GYGRSLWLMQGMF  618
            D+V FTQ NI+RVYPKGTRFNSSNY PL GW+HGAQMVA NMQ    GYGRSLWLMQG+F
Sbjct  351  DLVRFTQKNIVRVYPKGTRFNSSNYCPLPGWLHGAQMVALNMQSLWQGYGRSLWLMQGLF  410

Query  617  RSNGGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYS  438
            R+NGGCGYV+KPD LMN+GP   V NP+  L VK TLKVK+YMGDGWH DF +THFD YS
Sbjct  411  RANGGCGYVRKPDFLMNIGPQAAVSNPEASLPVKITLKVKIYMGDGWHKDFSRTHFDVYS  470

Query  437  PPDFYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSE  258
            PPDFY +V IAGVPAD   K+T+ ++D+W PVWGEEF FPLTVPELALLRIE  E+++S+
Sbjct  471  PPDFYAKVEIAGVPADIKTKRTRTRQDDWMPVWGEEFSFPLTVPELALLRIEACEYNMSD  530

Query  257  KDDFAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             DDF GQTCLPV EL+PGIRAVPL DRKG KYNSVRLLMRF+FV
Sbjct  531  MDDFGGQTCLPVWELKPGIRAVPLHDRKGNKYNSVRLLMRFQFV  574



>gb|EYU22355.1| hypothetical protein MIMGU_mgv1a003318mg [Erythranthe guttata]
Length=592

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 186/220 (85%), Gaps = 2/220 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ N+LRVYPKG RF+SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  375  DIVRFTQKNLLRVYPKGIRFDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFRANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G   EVF+P+  L VK TL+V VYMG+GW+ DF+ THFD+YSPPDF
Sbjct  435  GCGYVKKPDFLLKGG--GEVFDPRATLPVKTTLRVTVYMGEGWYYDFRHTHFDTYSPPDF  492

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLRIEVHE+D+SEKDDF
Sbjct  493  YARVGIAGVPADVVMKKTKTLEDNWIPTWDEVFEFPLTVPELALLRIEVHEYDMSEKDDF  552

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQ  LP++ELR GIRAVPL   KG +YNSV+LLMRF+F+
Sbjct  553  AGQISLPISELREGIRAVPLHSHKGVRYNSVKLLMRFQFI  592



>emb|CDY07623.1| BnaA03g18880D [Brassica napus]
Length=595

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 185/219 (84%), Gaps = 6/219 (3%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYGRSLWLM GMFR+NG
Sbjct  382  DVVRFTQKNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGRSLWLMHGMFRANG  441

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+PK +LHVK      VYMGDGW LDF  THFD+YSPPDF
Sbjct  442  GCGYVKKPNFLMKKGFHDEVFDPKKKLHVK------VYMGDGWRLDFSHTHFDTYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+V I GVPAD   +KT++ EDNW P+W EEF FPLTVPELALLRIEV E+D+S+KDDF
Sbjct  496  YTKVFIVGVPADNAKRKTRVIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSDKDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  556  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  594



>ref|XP_010322097.1| PREDICTED: PI-phospholipase C PLC2 isoform X1 [Solanum lycopersicum]
Length=560

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG R +SSNY P +GWMHGAQMVAFNMQGYGRSLWLM GMFR+NG
Sbjct  341  EIIRFTQHNLLRIYPKGIRVDSSNYDPFVGWMHGAQMVAFNMQGYGRSLWLMHGMFRANG  400

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPDLL+  GP+ EVF+P   L VK TLKV VYMGDGW  DF QT FD+YSPPDF
Sbjct  401  GCGYVKKPDLLLKAGPDNEVFDPTANLPVKTTLKVTVYMGDGWDKDFDQTDFDTYSPPDF  460

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPADEV K+T+  +DNW P W E+F FPLTVPELALLRI+V +++LS+KD+F
Sbjct  461  YAKLGIAGVPADEVKKRTETIDDNWIPSWNEQFEFPLTVPELALLRIKVLDYNLSDKDEF  520

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
            AGQTCLPVAELR GIRAVPL DRKGEKY+SV+LLM FEF
Sbjct  521  AGQTCLPVAELRQGIRAVPLYDRKGEKYSSVKLLMHFEF  559



>ref|XP_009766854.1| PREDICTED: phosphoinositide phospholipase C 2-like [Nicotiana 
sylvestris]
Length=484

 Score =   353 bits (906),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N++RVYPKG R +SSNY PLIGWMHGAQMVAFNMQG GR LWLMQGMFR+NG
Sbjct  264  ELIRFTQRNLVRVYPKGIRVDSSNYNPLIGWMHGAQMVAFNMQGNGRPLWLMQGMFRANG  323

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+LL+  GPN EV++PK  L +K TLKVK+YMG GWHLDFK+THFD YSPPDF
Sbjct  324  GCGYVKKPELLLKDGPNNEVYDPKRLLSLKTTLKVKIYMGKGWHLDFKRTHFDIYSPPDF  383

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++ IAGVPAD  +KKT+  ED+W P W +EF FPLTVPE+ALLR+EVHE+D+SE DDF
Sbjct  384  YVKIAIAGVPADSGVKKTRPIEDDWVPTWNDEFEFPLTVPEIALLRVEVHEYDMSEIDDF  443

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTC+PV+ELR GIRAVPL + KGEKY SV+LLMRFEFV
Sbjct  444  GGQTCIPVSELRTGIRAVPLYNEKGEKYPSVKLLMRFEFV  483



>gb|AIU41540.1| phosphatidylinositol phospholipase C 7 [Solanum lycopersicum]
Length=594

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 188/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ NILRV+PKGTR  SSN+KP+IGWMHGAQMVAFNMQGYG+SLW+M GMFRSNG
Sbjct  375  DLVRFTQRNILRVFPKGTRVTSSNFKPMIGWMHGAQMVAFNMQGYGKSLWIMHGMFRSNG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYV+KP  LM  GP  E+F+PK  L VKKTL+V+VY+GDGW +DF  THFD++SPPDF
Sbjct  435  GCGYVRKPSFLMERGPCNELFDPKVTLPVKKTLRVRVYLGDGWRMDFSHTHFDAFSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT++ I GVPAD    KT+I ED+W P+WGEEF FPLTVPELALLRIEV E+D+S+KDDF
Sbjct  495  YTKLYIIGVPADAAKSKTRIIEDDWGPIWGEEFKFPLTVPELALLRIEVREYDMSDKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELRPGIRAVPL D+KGEK  SVRLLM+F F+
Sbjct  555  GGQTCLPVSELRPGIRAVPLYDKKGEKLKSVRLLMQFRFI  594



>ref|XP_009369166.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Pyrus x bretschneideri]
Length=595

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKG R +SSNY P+IGW +GAQMVAFNMQGYGR LW+MQGMFR+NG
Sbjct  376  EIIRFTQRNILRVYPKGIRVDSSNYNPMIGWSYGAQMVAFNMQGYGRPLWVMQGMFRANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G + EVF PK  L VKKTLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  436  GCGYVKKPDFLLKSGSHNEVFGPKNGLPVKKTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV  D VMKKTK  EDNW P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  496  YARVGIAGVADDSVMKKTKALEDNWVPAWNEEFKFPLTVPELAVLRIEVHEYDMSEKDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL   KGEKY SV+LLM F+FV
Sbjct  556  GGQTCLPVSELRRGIRAVPLNCPKGEKYKSVKLLMHFDFV  595



>ref|XP_009369167.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Pyrus x bretschneideri]
Length=594

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ NILRVYPKG R +SSNY P+IGW +GAQMVAFNMQGYGR LW+MQGMFR+NG
Sbjct  375  EIIRFTQRNILRVYPKGIRVDSSNYNPMIGWSYGAQMVAFNMQGYGRPLWVMQGMFRANG  434

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD L+  G + EVF PK  L VKKTLKVKVYMG+GW+ DFK THFD+YSPPDF
Sbjct  435  GCGYVKKPDFLLKSGSHNEVFGPKNGLPVKKTLKVKVYMGEGWYYDFKHTHFDAYSPPDF  494

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGV  D VMKKTK  EDNW P W EEF FPLTVPELA+LRIEVHE+D+SEKDDF
Sbjct  495  YARVGIAGVADDSVMKKTKALEDNWVPAWNEEFKFPLTVPELAVLRIEVHEYDMSEKDDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV+ELR GIRAVPL   KGEKY SV+LLM F+FV
Sbjct  555  GGQTCLPVSELRRGIRAVPLNCPKGEKYKSVKLLMHFDFV  594



>emb|CDY60344.1| BnaC03g72360D [Brassica napus]
Length=600

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 185/219 (84%), Gaps = 6/219 (3%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            DVV FTQ N+LR+YPKGTRFNSSNYKPLIGW HGAQM+AFNMQGYGRSLWLM GMFR+NG
Sbjct  387  DVVRFTQKNLLRIYPKGTRFNSSNYKPLIGWTHGAQMIAFNMQGYGRSLWLMHGMFRANG  446

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+ LM  G + EVF+PK +LHVK      VYMGDGW LDF  THFD+YSPPDF
Sbjct  447  GCGYVKKPNFLMKKGFHDEVFDPKKKLHVK------VYMGDGWRLDFSHTHFDTYSPPDF  500

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            YT+V I GVPAD   +KT++ EDNW P+W EEF FPLTVPELALLRIEV E+D+S+KDDF
Sbjct  501  YTKVFIVGVPADNAKRKTRVIEDNWYPIWDEEFSFPLTVPELALLRIEVREYDMSDKDDF  560

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLPV+ELRPGIR+VPL D+KGEK  SVRLLMRF F
Sbjct  561  GGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLLMRFIF  599



>ref|XP_009586599.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
tomentosiformis]
Length=590

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TD+V FTQ NI RVYPKGTR  S+N+KP+ GWMHGAQMVAFNMQGYG+SLW+M GMFRSN
Sbjct  370  TDLVRFTQKNIARVYPKGTRVTSTNFKPMTGWMHGAQMVAFNMQGYGKSLWMMHGMFRSN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            G CGYV+KP  LM  GP+ EVF+PK +L VKKTL+V+VYMGDGW LDF  THFD+YSPPD
Sbjct  430  GSCGYVRKPRFLMEKGPHNEVFDPKVKLPVKKTLQVRVYMGDGWRLDFSHTHFDAYSPPD  489

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPAD   KKT+I ED+W P+W EEF FPLTVPELALLRIEV E+D+SEKDD
Sbjct  490  FYTKLYIVGVPADARKKKTRIIEDDWCPIWDEEFNFPLTVPELALLRIEVREYDMSEKDD  549

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+ELRPGIR+V L D+KG+K  SV+LLMRF+FV
Sbjct  550  FGGQTCLPVSELRPGIRSVALYDKKGQKMKSVKLLMRFQFV  590



>dbj|BAE71237.1| putative phosphoinositide specific phospholipase C [Trifolium 
pratense]
Length=603

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYPKGTR  SSNY PLIGWMHGAQMVAFNMQGYGRSLWLMQGMF++NG
Sbjct  384  EIVRFTQQNILRVYPKGTRITSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFKANG  443

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
             CGYVKKPD L+  GP  EVF+PK  L  K TLKV VYMG+GW+ DFK THFD +SPPDF
Sbjct  444  RCGYVKKPDFLLKPGPINEVFDPKAPLPAKTTLKVTVYMGEGWYYDFKHTHFDQFSPPDF  503

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y R+GIAGVP D VMKKTK  ED+W P W E F FPL+VPELALLRIEVHE+D+SEKDDF
Sbjct  504  YARIGIAGVPFDTVMKKTKSIEDSWLPSWNEVFEFPLSVPELALLRIEVHEYDMSEKDDF  563

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTCLPV ELR GIRA+PL  RKG+KYN+V+LL+RFEF+
Sbjct  564  GGQTCLPVWELRSGIRAIPLHSRKGDKYNNVKLLVRFEFI  603



>gb|AIG51130.1| phospholipase C [Gossypium hirsutum]
Length=578

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 188/219 (86%), Gaps = 3/219 (1%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++V FTQ NILRVYP+GTR +SSNY PLIGWMHGAQMVAFNMQGYGRSLWLM GMF++NG
Sbjct  360  EIVRFTQRNILRVYPRGTRVDSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGMFKANG  419

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGY+KKPD L+N  PN +VF+P  +L VKK LKV +YMG+GW+ DF  THFD+YSPPDF
Sbjct  420  GCGYLKKPDFLLN--PN-KVFDPNVKLPVKKILKVTMYMGEGWYYDFHHTHFDAYSPPDF  476

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y RVGIAGVP D VMKKTK  EDNW P W EEF F LTVPELALLR+EVHE+D+SEKDDF
Sbjct  477  YARVGIAGVPFDSVMKKTKTLEDNWVPCWNEEFEFCLTVPELALLRVEVHEYDMSEKDDF  536

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEF  129
             GQTCLP++ELR GIRAVPL  RKGEKY+SV+LLMRFEF
Sbjct  537  GGQTCLPISELRSGIRAVPLNSRKGEKYSSVKLLMRFEF  575



>ref|NP_187464.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
 ref|NP_001030660.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
 sp|Q39033.1|PLCD2_ARATH RecName: Full=Phosphoinositide phospholipase C 2; AltName: Full=Phosphoinositide 
phospholipase PLC2; Short=AtPLC2; Short=PI-PLC2 
[Arabidopsis thaliana]
 gb|AAG50827.1|AC074395_1 phosphoinositide specific phospholipase (AtPLC2) [Arabidopsis 
thaliana]
 gb|AAK25916.1|AF360206_1 putative phosphoinositide specific phospholipase AtPLC2 [Arabidopsis 
thaliana]
 dbj|BAA09432.1| phosphoinositide specific phospholipase C [Arabidopsis thaliana]
 gb|AAK64112.1| putative phosphoinositide specific phospholipase PLC2 [Arabidopsis 
thaliana]
 dbj|BAH56972.1| AT3G08510 [Arabidopsis thaliana]
 gb|AEE74640.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
 gb|AEE74641.1| phosphoinositide phospholipase C 2 [Arabidopsis thaliana]
Length=581

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+GW HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  363  IVRFTQHNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  422

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPDLL+  G + ++F+PK  L VK TL+V VYMG+GW+ DF+ THFD YSPPDFY
Sbjct  423  CGYIKKPDLLLKSGSDSDIFDPKATLPVKTTLRVTVYMGEGWYFDFRHTHFDQYSPPDFY  482

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVP D VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  483  TRVGIAGVPGDTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  542

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL  GIRA PL  RKGEKY SV+LL++ EFV
Sbjct  543  GQTCLPVWELSEGIRAFPLHSRKGEKYKSVKLLVKVEFV  581



>ref|XP_009123935.1| PREDICTED: phosphoinositide phospholipase C 2 [Brassica rapa]
Length=581

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+GW HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  363  IVRFTQQNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  422

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPD+L+  G + ++F+PK  L VK TL+V +YMG+GW+ DF+ THFD YSPPDFY
Sbjct  423  CGYIKKPDILLKGGSDSDIFDPKATLPVKTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFY  482

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  483  TRVGIAGVPADTVMKKTKTLEDNWVPSWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  542

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIR+ PL  RKGEKY SV+LL+R EFV
Sbjct  543  GQTCLPVWELQEGIRSFPLHSRKGEKYKSVKLLVRCEFV  581



>emb|CDY22153.1| BnaC01g39480D [Brassica napus]
Length=581

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+GW HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  363  IVRFTQQNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  422

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPD+L+  G + ++F+PK  L VK TL+V +YMG+GW+ DF+ THFD YSPPDFY
Sbjct  423  CGYIKKPDILLKGGSDSDIFDPKVTLPVKTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFY  482

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  483  TRVGIAGVPADTVMKKTKTLEDNWVPSWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  542

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIR+ PL  RKGEKY SV+LL+R EFV
Sbjct  543  GQTCLPVWELQEGIRSFPLHSRKGEKYKSVKLLVRCEFV  581



>ref|XP_010106260.1| Phosphoinositide phospholipase C 6 [Morus notabilis]
 gb|EXC09417.1| Phosphoinositide phospholipase C 6 [Morus notabilis]
Length=599

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LRVYPKG R  SSNYKP IGWM+G QMVAFNMQGYG+SLWLM GMFR+N
Sbjct  379  TELVRFTQRNVLRVYPKGMRVTSSNYKPNIGWMYGVQMVAFNMQGYGKSLWLMHGMFRAN  438

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKP+ LM  GP  EVF+PK  L VKKTLKVKVYMGDGW LDF QTHFD+YSPPD
Sbjct  439  GGCGYVKKPEFLMQKGPRNEVFDPKRTLPVKKTLKVKVYMGDGWRLDFSQTHFDTYSPPD  498

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT+V I GVPAD    KT+I  D+W P+W EEF FPLTVPELALLRIEV E+D SEKDD
Sbjct  499  FYTKVYIVGVPADCAKNKTRIIADDWAPIWDEEFTFPLTVPELALLRIEVREYDRSEKDD  558

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV++L+PGIRAVPL D+KG+K  SV+LLMRF+F+
Sbjct  559  FGGQTCLPVSDLKPGIRAVPLYDKKGDKLKSVKLLMRFQFL  599



>ref|NP_001234203.1| PI-phospholipase C PLC1 [Solanum lycopersicum]
 gb|ABW81003.1| PI-phospholipase C PLC1 [Solanum lycopersicum]
Length=601

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 186/220 (85%), Gaps = 0/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            D+V FTQ N+LRVYPKG R +SSNY PLIGWMHG QMVAFN+QG+GR LWLMQGMFR+NG
Sbjct  376  DLVRFTQRNLLRVYPKGMRVDSSNYNPLIGWMHGTQMVAFNIQGHGRPLWLMQGMFRANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKP+LL+    N EV +PK  L VK TLKVKVYMG GWHLDFK+THFD+YSPPDF
Sbjct  436  GCGYVKKPELLLKTDANNEVHDPKRLLSVKTTLKVKVYMGKGWHLDFKRTHFDAYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD  +KKTK  EDNW P W +EF FPLTVPELALLR+EVHE+D+SE DDF
Sbjct  496  YVKIGIAGVPADSRVKKTKAIEDNWIPTWNDEFEFPLTVPELALLRVEVHEYDMSEIDDF  555

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQTC+PV+ELR GIRAVP+ + KGEKY SV+LLM FEFV
Sbjct  556  GGQTCIPVSELRTGIRAVPIYNEKGEKYPSVKLLMCFEFV  595



>ref|XP_004138421.1| PREDICTED: phosphoinositide phospholipase C 6-like [Cucumis sativus]
 gb|KGN45789.1| hypothetical protein Csa_6G011650 [Cucumis sativus]
Length=586

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            +DVV FTQ NILRVYPKGTR  SSN++P IGW HGAQMVA NMQGYGRSLWLM GMFR+N
Sbjct  365  SDVVRFTQRNILRVYPKGTRVTSSNFRPNIGWTHGAQMVALNMQGYGRSLWLMHGMFRAN  424

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGY+KKPD L+  GP  EVF+PK  L VK+TLKV VY+GDGW  DF QTHFD+YSPPD
Sbjct  425  GGCGYLKKPDFLLLKGPQNEVFDPKRPLTVKETLKVTVYLGDGWSSDFSQTHFDNYSPPD  484

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ I GVPAD V KKTK+ E+NW PVW EEF FPLTVPEL LL+IEV + D SEKDD
Sbjct  485  FYTKIRIVGVPADAVKKKTKVVENNWVPVWNEEFKFPLTVPELGLLQIEVRDFDRSEKDD  544

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLP++EL+PGIRAVPL D+KGEK+ SVRLLMRF+F+
Sbjct  545  FGGQTCLPISELKPGIRAVPLYDKKGEKFKSVRLLMRFQFL  585



>gb|AAF33823.1|AF223351_1 phospholipase C1 [Nicotiana tabacum]
Length=586

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 189/220 (86%), Gaps = 1/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            +++ FTQ N+LR+YPKG RF+SSNY P + W HGAQMV  +MQGYGRSLWLM GMFRSNG
Sbjct  368  EIIRFTQRNLLRIYPKGIRFDSSNYNPFVAWTHGAQMV-HHMQGYGRSLWLMHGMFRSNG  426

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD+L+  GPN ++F+P+  L VK TLKV V+MG+GW++DFK THFD+Y+PPDF
Sbjct  427  GCGYVKKPDILLKAGPNNQIFDPEANLPVKTTLKVTVFMGEGWYIDFKHTHFDAYTPPDF  486

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y ++GIAGVPAD VMKKTK  ED  TP W E+F FPLTVPELALLR+EVHE+D+SEKDDF
Sbjct  487  YAKIGIAGVPADNVMKKTKTLEDMDTPTWDEKFEFPLTVPELALLRVEVHEYDMSEKDDF  546

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            AGQTCLPV+ELR GIRAV L DRKGEKYNSV+LLMRFEFV
Sbjct  547  AGQTCLPVSELRQGIRAVSLHDRKGEKYNSVKLLMRFEFV  586



>ref|NP_001049792.2| Os03g0289300 [Oryza sativa Japonica Group]
 dbj|BAF11706.2| Os03g0289300 [Oryza sativa Japonica Group]
Length=594

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 189/220 (86%), Gaps = 1/220 (0%)
 Frame = -3

Query  785  DVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNG  606
            ++VSFT  N+LR+YPKGTRFNSSNY P +GW+HGAQMVAFNMQGYGRSLWLM G +++NG
Sbjct  376  NIVSFTHKNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFNMQGYGRSLWLMHGFYKANG  435

Query  605  GCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDF  426
            GCGYVKKPD +M   P+  VF+PK  L VKKTLKVKVYMG+GW  DFKQT+FD+YSPPDF
Sbjct  436  GCGYVKKPDFMMQTCPDGNVFDPKADLPVKKTLKVKVYMGEGWQSDFKQTYFDTYSPPDF  495

Query  425  YTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDF  246
            Y +VGIAGVP+D VM+KTK  ED+W PVW EEF+FPLTVPE+ALLR+EVHE+D+SE DDF
Sbjct  496  YAKVGIAGVPSDSVMQKTKAVEDSWVPVWEEEFVFPLTVPEIALLRVEVHEYDVSE-DDF  554

Query  245  AGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
             GQT LPV+ELRPGIR VPL D KG K+ SV+LLMRFEFV
Sbjct  555  GGQTALPVSELRPGIRTVPLFDHKGLKFKSVKLLMRFEFV  594



>gb|AAD26119.1|AF108123_1 phosphoinositide-specific phospholipase C [Brassica napus]
Length=581

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  782  VVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSNGG  603
            +V FTQ N+LR+YPKGTR  SSNY PL+GW HGAQMVAFNMQGYGRSLWLMQGMFR+NGG
Sbjct  363  IVRFTQQNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRANGG  422

Query  602  CGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPDFY  423
            CGY+KKPD+L+  G + ++F+PKT L VK TL+V +YMG+GW+ DF+ THFD YSPPDFY
Sbjct  423  CGYIKKPDILLKGGSDSDIFDPKTTLPVKTTLRVTIYMGEGWYFDFRHTHFDQYSPPDFY  482

Query  422  TRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDDFA  243
            TRVGIAGVPAD VMKKTK  EDNW P W E F FPLTVPELALLR+EVHE+D+SEKDDF 
Sbjct  483  TRVGIAGVPADTVMKKTKTLEDNWVPSWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFG  542

Query  242  GQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            GQTCLPV EL+ GIR+ PL +RK EKY SV+LL++ EFV
Sbjct  543  GQTCLPVWELQEGIRSFPLHNRKEEKYKSVKLLVKVEFV  581



>ref|XP_010233537.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Brachypodium distachyon]
Length=600

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 187/221 (85%), Gaps = 4/221 (2%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY P +GW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  384  TEIVRFTQRNLLRIYPKGTRVTSSNYNPFLGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  443

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM      +VF+PK R  VKKTLKVK+YMGDGW +DFK THFD YSPPD
Sbjct  444  GGCGYVKKPDFLMQ----SDVFDPKKRQPVKKTLKVKIYMGDGWRMDFKHTHFDQYSPPD  499

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKT+  EDNW PVW EEF F LTVPE+ALLR+EVHE+D+SEKDD
Sbjct  500  FYARVGIAGVPADSVMKKTRTIEDNWVPVWEEEFAFDLTVPEIALLRVEVHEYDMSEKDD  559

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQT LPV+EL+PGIRAV L DRKG K+N+V+LLMRFEFV
Sbjct  560  FGGQTVLPVSELQPGIRAVALFDRKGNKFNNVKLLMRFEFV  600



>ref|XP_003562396.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Brachypodium distachyon]
Length=599

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 187/221 (85%), Gaps = 4/221 (2%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            T++V FTQ N+LR+YPKGTR  SSNY P +GW+HGAQMVAFNMQGYGR+LWLM G +++N
Sbjct  383  TEIVRFTQRNLLRIYPKGTRVTSSNYNPFLGWVHGAQMVAFNMQGYGRALWLMHGFYKAN  442

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD LM      +VF+PK R  VKKTLKVK+YMGDGW +DFK THFD YSPPD
Sbjct  443  GGCGYVKKPDFLMQ----SDVFDPKKRQPVKKTLKVKIYMGDGWRMDFKHTHFDQYSPPD  498

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGVPAD VMKKT+  EDNW PVW EEF F LTVPE+ALLR+EVHE+D+SEKDD
Sbjct  499  FYARVGIAGVPADSVMKKTRTIEDNWVPVWEEEFAFDLTVPEIALLRVEVHEYDMSEKDD  558

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQT LPV+EL+PGIRAV L DRKG K+N+V+LLMRFEFV
Sbjct  559  FGGQTVLPVSELQPGIRAVALFDRKGNKFNNVKLLMRFEFV  599



>ref|XP_006435739.1| hypothetical protein CICLE_v10031019mg [Citrus clementina]
 ref|XP_006486317.1| PREDICTED: phosphoinositide phospholipase C 6-like [Citrus sinensis]
 gb|ESR48979.1| hypothetical protein CICLE_v10031019mg [Citrus clementina]
Length=595

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
            TDVV FTQ NILR+YPKGTR NSSNYKPLIGWMHGAQM+AFNMQGYG+SLWLM GMFR+N
Sbjct  375  TDVVRFTQKNILRIYPKGTRVNSSNYKPLIGWMHGAQMIAFNMQGYGKSLWLMHGMFRAN  434

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L    P+ ++F+PK  L VK TLKV+VYMGDGW LDF  THFDSYSPPD
Sbjct  435  GGCGYVKKPDFLTKEDPSGQLFDPKRPLPVKTTLKVRVYMGDGWRLDFSHTHFDSYSPPD  494

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYT++ + G+P D+  KKTK+  DNW PVW EEF FPLTVPELALLRIEV EHD+S+ DD
Sbjct  495  FYTKLYLVGLPNDDSKKKTKVILDNWCPVWNEEFTFPLTVPELALLRIEVREHDISDADD  554

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV ELR GIR+VPL ++KGEK  SVRLLM FEF+
Sbjct  555  FGGQTCLPVPELRRGIRSVPLHNKKGEKLKSVRLLMGFEFL  595



>ref|XP_003579061.1| PREDICTED: phosphoinositide phospholipase C 6-like [Brachypodium 
distachyon]
Length=586

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 183/221 (83%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             D++ FTQ NILRVYPKGTR NSSNY P+  W HGAQMVAFNMQG+ +SL LMQG FR+N
Sbjct  366  ADIIRFTQKNILRVYPKGTRINSSNYDPINAWTHGAQMVAFNMQGHDKSLRLMQGFFRAN  425

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+PK  L VKKTLKVKVYMGDGW +DF +THFD++SPPD
Sbjct  426  GGCGYVKKPDFLLKTGPNGEVFDPKANLPVKKTLKVKVYMGDGWRMDFSKTHFDAFSPPD  485

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FY RVGIAGV AD VMKKTK  ED W PVW EEF FPLTVPELALLR+EV E+D+SEK D
Sbjct  486  FYARVGIAGVKADCVMKKTKTIEDQWVPVWDEEFTFPLTVPELALLRVEVQEYDMSEKHD  545

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV EL+ GIRAVPL DRKG +Y SVRLLMRF+ +
Sbjct  546  FGGQTCLPVMELKQGIRAVPLHDRKGNRYKSVRLLMRFDLI  586



>gb|EAY83519.1| hypothetical protein OsI_38731 [Oryza sativa Indica Group]
Length=590

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  788  TDVVSFTQXNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGRSLWLMQGMFRSN  609
             DV+ FTQ NILRVYPKGTR NSSNY P+  W HGAQMVAFNMQG+ ++L LMQG FR+N
Sbjct  370  ADVIRFTQKNILRVYPKGTRINSSNYDPMNAWTHGAQMVAFNMQGHDKALRLMQGFFRAN  429

Query  608  GGCGYVKKPDLLMNVGPNCEVFNPKTRLHVKKTLKVKVYMGDGWHLDFKQTHFDSYSPPD  429
            GGCGYVKKPD L+  GPN EVF+P   + VKKTLKVKVYMGDGW +DF +THFD++SPPD
Sbjct  430  GGCGYVKKPDFLLRTGPNGEVFDPNASMPVKKTLKVKVYMGDGWRMDFSKTHFDTFSPPD  489

Query  428  FYTRVGIAGVPADEVMKKTKIKEDNWTPVWGEEFMFPLTVPELALLRIEVHEHDLSEKDD  249
            FYTRVGIAGV AD VMKKT+  ED W P+W EEF FPLTVPELA+LRIEVHE+D+SEK D
Sbjct  490  FYTRVGIAGVRADCVMKKTRTIEDQWVPMWDEEFTFPLTVPELAVLRIEVHEYDMSEKHD  549

Query  248  FAGQTCLPVAELRPGIRAVPLCDRKGEKYNSVRLLMRFEFV  126
            F GQTCLPV+EL+ GIRAVPL DR+G +Y SVRLLMRF+F+
Sbjct  550  FGGQTCLPVSELKQGIRAVPLHDRRGTRYKSVRLLMRFDFL  590



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570