BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016G15

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010315558.1|  PREDICTED: nucleolin 1 isoform X2                  182   2e-49   
ref|XP_004231484.1|  PREDICTED: nucleolin 1 isoform X1                  182   2e-49   Solanum lycopersicum
ref|XP_006367329.1|  PREDICTED: nucleolin 2-like                        177   1e-47   Solanum tuberosum [potatoes]
dbj|BAC02896.1|  tobacco nucleolin                                      176   3e-47   Nicotiana tabacum [American tobacco]
ref|XP_009624911.1|  PREDICTED: nucleolin 1 isoform X1                  176   4e-47   Nicotiana tomentosiformis
ref|XP_009624912.1|  PREDICTED: nucleolin 1 isoform X2                  176   4e-47   Nicotiana tomentosiformis
ref|XP_009778554.1|  PREDICTED: nucleolin 1 isoform X1                  174   2e-46   Nicotiana sylvestris
ref|XP_009778556.1|  PREDICTED: nucleolin 1 isoform X2                  174   2e-46   Nicotiana sylvestris
ref|XP_002307174.1|  nucleolin family protein                           156   4e-40   Populus trichocarpa [western balsam poplar]
gb|ABK94939.1|  unknown                                                 155   8e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006380517.1|  hypothetical protein POPTR_0007s07800g             155   8e-40   
ref|XP_006380518.1|  hypothetical protein POPTR_0007s07800g             155   9e-40   
ref|XP_011008909.1|  PREDICTED: nucleolin 2 isoform X2                  154   2e-39   Populus euphratica
ref|XP_011008908.1|  PREDICTED: nucleolin 1 isoform X1                  154   2e-39   Populus euphratica
ref|XP_011022059.1|  PREDICTED: nucleolin 1-like isoform X1             154   2e-39   Populus euphratica
ref|XP_011022060.1|  PREDICTED: nucleolin 1-like isoform X2             154   2e-39   Populus euphratica
gb|EYU35586.1|  hypothetical protein MIMGU_mgv1a002998mg                152   6e-39   Erythranthe guttata [common monkey flower]
ref|XP_011070437.1|  PREDICTED: nucleolin 1-like                        152   6e-39   Sesamum indicum [beniseed]
ref|XP_009383653.1|  PREDICTED: nucleolin 2-like isoform X2             152   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383652.1|  PREDICTED: nucleolin 2-like isoform X1             152   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505721.1|  PREDICTED: nucleolin 2-like isoform X2             151   2e-38   
ref|XP_004505720.1|  PREDICTED: nucleolin 2-like isoform X1             151   2e-38   Cicer arietinum [garbanzo]
ref|XP_010549154.1|  PREDICTED: nucleolin 1                             149   9e-38   Tarenaya hassleriana [spider flower]
ref|XP_009420546.1|  PREDICTED: nucleolin 2-like                        149   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909800.1|  PREDICTED: nucleolin 2-like                        147   6e-37   Elaeis guineensis
ref|XP_010249944.1|  PREDICTED: nucleolin 2-like isoform X3             147   7e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003581679.1|  PREDICTED: nucleolin 2-like                        147   9e-37   Brachypodium distachyon [annual false brome]
ref|XP_010249935.1|  PREDICTED: nucleolin 2-like isoform X2             147   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010249927.1|  PREDICTED: nucleolin 2-like isoform X1             147   1e-36   Nelumbo nucifera [Indian lotus]
emb|CBI27136.3|  unnamed protein product                                146   2e-36   Vitis vinifera
ref|XP_010535330.1|  PREDICTED: nucleolin 1-like isoform X2             144   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_010535329.1|  PREDICTED: nucleolin 1-like isoform X1             144   4e-36   Tarenaya hassleriana [spider flower]
gb|EAZ32021.1|  hypothetical protein OsJ_16200                          145   5e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053909.1|  Os04g0620700                                       145   6e-36   
emb|CAH66982.1|  H0714H04.9                                             145   6e-36   Oryza sativa [red rice]
ref|XP_004982918.1|  PREDICTED: nucleolin 2-like isoform X2             145   6e-36   Setaria italica
ref|XP_004982917.1|  PREDICTED: nucleolin 2-like isoform X1             144   7e-36   
ref|XP_010648398.1|  PREDICTED: nucleolin 2 isoform X1                  144   1e-35   Vitis vinifera
ref|XP_006652843.1|  PREDICTED: nucleolin 2-like                        144   1e-35   Oryza brachyantha
ref|XP_010648403.1|  PREDICTED: nucleolin 2 isoform X2                  144   1e-35   Vitis vinifera
ref|XP_010648407.1|  PREDICTED: nucleolin 1 isoform X3                  144   1e-35   
ref|XP_008787580.1|  PREDICTED: nucleolin 2-like isoform X4             144   1e-35   Phoenix dactylifera
ref|XP_008787581.1|  PREDICTED: nucleolin 2-like isoform X5             144   1e-35   Phoenix dactylifera
ref|XP_008787578.1|  PREDICTED: nucleolin 2-like isoform X2             144   2e-35   Phoenix dactylifera
ref|XP_008787577.1|  PREDICTED: nucleolin 2-like isoform X1             144   2e-35   Phoenix dactylifera
ref|XP_008787579.1|  PREDICTED: nucleolin 2-like isoform X3             144   2e-35   
ref|XP_006659905.1|  PREDICTED: nucleolin 1-like                        142   2e-35   Oryza brachyantha
ref|XP_007043310.1|  Nucleolin like 2 isoform 4                         141   5e-35   
ref|XP_007222208.1|  hypothetical protein PRUPE_ppa007807mg             138   9e-35   
ref|XP_004972658.1|  PREDICTED: nucleolin 1-like                        140   9e-35   Setaria italica
ref|XP_007043309.1|  Nucleolin like 2 isoform 3                         142   9e-35   
ref|XP_007043308.1|  Nucleolin like 2 isoform 2                         141   1e-34   
ref|XP_007043307.1|  Nucleolin like 2 isoform 1                         141   1e-34   
ref|XP_002467108.1|  hypothetical protein SORBIDRAFT_01g019710          140   2e-34   Sorghum bicolor [broomcorn]
gb|KJB79877.1|  hypothetical protein B456_013G070400                    142   2e-34   Gossypium raimondii
gb|KJB79879.1|  hypothetical protein B456_013G070400                    142   2e-34   Gossypium raimondii
gb|KJB79874.1|  hypothetical protein B456_013G070400                    142   2e-34   Gossypium raimondii
gb|KJB79880.1|  hypothetical protein B456_013G070400                    142   2e-34   Gossypium raimondii
gb|KJB79881.1|  hypothetical protein B456_013G070400                    142   2e-34   Gossypium raimondii
gb|EPS65245.1|  tobacco nucleolin                                       139   3e-34   Genlisea aurea
dbj|BAJ99185.1|  predicted protein                                      140   3e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010094074.1|  hypothetical protein L484_018090                   138   9e-34   
ref|XP_010910016.1|  PREDICTED: nucleolin 2-like                        140   1e-33   
gb|KHG18558.1|  Nucleolin                                               139   1e-33   Gossypium arboreum [tree cotton]
ref|XP_008221051.1|  PREDICTED: nucleolin 1 isoform X2                  138   1e-33   Prunus mume [ume]
gb|AAA74208.1|  protein localized in the nucleoli of pea nuclei; ...    137   2e-33   Pisum sativum [garden pea]
gb|KJB79878.1|  hypothetical protein B456_013G070400                    139   2e-33   Gossypium raimondii
gb|KJB79875.1|  hypothetical protein B456_013G070400                    139   2e-33   Gossypium raimondii
ref|XP_008221050.1|  PREDICTED: nucleolin 2 isoform X1                  137   2e-33   Prunus mume [ume]
gb|KHG07971.1|  Protein gar2                                            137   2e-33   Gossypium arboreum [tree cotton]
gb|KJB79876.1|  hypothetical protein B456_013G070400                    139   2e-33   Gossypium raimondii
gb|KJB12389.1|  hypothetical protein B456_002G015800                    137   3e-33   Gossypium raimondii
gb|EMT18300.1|  Protein gar2                                            136   7e-33   
gb|KEH30578.1|  RNA recognition motif                                   135   1e-32   Medicago truncatula
gb|KEH30577.1|  RNA recognition motif                                   135   1e-32   Medicago truncatula
ref|XP_003607240.1|  RNA-binding protein                                135   1e-32   Medicago truncatula
ref|XP_003607239.1|  RNA-binding protein                                135   1e-32   Medicago truncatula
ref|XP_010688710.1|  PREDICTED: nucleolin 1                             134   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003607231.1|  28 kDa ribonucleoprotein                           135   2e-32   
ref|XP_011463448.1|  PREDICTED: nucleolin 1 isoform X8                  133   3e-32   Fragaria vesca subsp. vesca
ref|XP_011463446.1|  PREDICTED: nucleolin 1 isoform X6                  133   3e-32   Fragaria vesca subsp. vesca
ref|XP_011463445.1|  PREDICTED: nucleolin 1 isoform X5                  133   4e-32   Fragaria vesca subsp. vesca
ref|XP_004297745.1|  PREDICTED: nucleolin 1 isoform X2                  133   4e-32   Fragaria vesca subsp. vesca
ref|XP_011463447.1|  PREDICTED: nucleolin 1 isoform X7                  133   4e-32   Fragaria vesca subsp. vesca
ref|XP_011463442.1|  PREDICTED: nucleolin 1 isoform X1                  133   4e-32   Fragaria vesca subsp. vesca
ref|XP_011463444.1|  PREDICTED: nucleolin 1 isoform X4                  133   4e-32   Fragaria vesca subsp. vesca
ref|XP_011463443.1|  PREDICTED: nucleolin 1 isoform X3                  133   4e-32   Fragaria vesca subsp. vesca
gb|KHN32280.1|  RNA-binding protein 34                                  134   4e-32   Glycine soja [wild soybean]
ref|XP_003537777.1|  PREDICTED: nucleolin 2-like                        134   5e-32   Glycine max [soybeans]
gb|KJB79882.1|  hypothetical protein B456_013G070400                    135   6e-32   Gossypium raimondii
ref|NP_001061178.1|  Os08g0192900                                       132   7e-32   
gb|EAZ05877.1|  hypothetical protein OsI_28114                          132   7e-32   Oryza sativa Indica Group [Indian rice]
emb|CAA61298.1|  nuM1                                                   133   7e-32   Medicago sativa [alfalfa]
gb|KDP43309.1|  hypothetical protein JCGZ_24230                         133   1e-31   Jatropha curcas
ref|XP_008350969.1|  PREDICTED: nucleolin 2-like                        126   5e-31   
ref|XP_006592048.1|  PREDICTED: nucleolin 2-like isoform X3             129   1e-30   Glycine max [soybeans]
ref|XP_006592047.1|  PREDICTED: nucleolin 2-like isoform X2             129   2e-30   Glycine max [soybeans]
ref|XP_003540672.1|  PREDICTED: nucleolin 2-like isoform X1             130   2e-30   Glycine max [soybeans]
gb|KHN05443.1|  Protein gar2                                            130   2e-30   Glycine soja [wild soybean]
ref|XP_002527136.1|  nucleic acid binding protein, putative             129   3e-30   
ref|XP_008360013.1|  PREDICTED: nucleolin 2-like                        128   3e-30   
ref|XP_008389084.1|  PREDICTED: nucleolin 2-like                        128   4e-30   
ref|XP_008340448.1|  PREDICTED: nucleolin 1-like                        126   5e-30   Malus domestica [apple tree]
ref|XP_009351719.1|  PREDICTED: nucleolin 1                             126   7e-30   
ref|XP_006836341.1|  hypothetical protein AMTR_s00092p00090110          127   8e-30   
tpg|DAA49685.1|  TPA: putative nucleolin-like family protein            121   1e-29   
ref|XP_011070700.1|  PREDICTED: nucleolin 2-like                        128   1e-29   
emb|CDP16867.1|  unnamed protein product                                127   2e-29   Coffea canephora [robusta coffee]
ref|XP_007131647.1|  hypothetical protein PHAVU_011G030600g             126   3e-29   Phaseolus vulgaris [French bean]
gb|KDO52763.1|  hypothetical protein CISIN_1g045516mg                   126   3e-29   Citrus sinensis [apfelsine]
ref|XP_006484546.1|  PREDICTED: nucleolin 2-like                        126   3e-29   Citrus sinensis [apfelsine]
gb|AFW61036.1|  putative nucleolin-like family protein                  121   4e-29   
ref|XP_006437567.1|  hypothetical protein CICLE_v10030875mg             125   5e-29   Citrus clementina [clementine]
ref|XP_003573379.1|  PREDICTED: nucleolin 1                             124   9e-29   Brachypodium distachyon [annual false brome]
ref|NP_001132813.1|  uncharacterized protein LOC100194303               121   1e-28   
gb|ACN25922.1|  unknown                                                 122   1e-28   Zea mays [maize]
gb|AFW61035.1|  putative nucleolin-like family protein                  124   2e-28   
ref|XP_008676638.1|  PREDICTED: uncharacterized protein LOC100194...    123   2e-28   
gb|AFW61032.1|  putative nucleolin-like family protein                  123   4e-28   
ref|XP_006306519.1|  hypothetical protein CARUB_v10012524mg             121   4e-28   Capsella rubella
ref|XP_008676637.1|  PREDICTED: uncharacterized protein LOC100194...    123   4e-28   Zea mays [maize]
ref|XP_010500433.1|  PREDICTED: nucleolin 1-like                        121   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010479318.1|  PREDICTED: nucleolin 1-like                        120   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010461727.1|  PREDICTED: nucleolin 1-like                        120   1e-27   Camelina sativa [gold-of-pleasure]
dbj|BAK07329.1|  predicted protein                                      116   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010066989.1|  PREDICTED: nucleolin 2 isoform X4                  120   3e-27   
gb|KCW65048.1|  hypothetical protein EUGRSUZ_G02571                     120   3e-27   Eucalyptus grandis [rose gum]
gb|KFK36056.1|  hypothetical protein AALP_AA4G072000                    119   3e-27   Arabis alpina [alpine rockcress]
ref|XP_010066987.1|  PREDICTED: nucleolin 1 isoform X2                  120   4e-27   Eucalyptus grandis [rose gum]
gb|KCW65047.1|  hypothetical protein EUGRSUZ_G02571                     120   4e-27   Eucalyptus grandis [rose gum]
ref|XP_010066988.1|  PREDICTED: nucleolin 2 isoform X3                  120   4e-27   
ref|XP_010066986.1|  PREDICTED: nucleolin 2 isoform X1                  120   4e-27   Eucalyptus grandis [rose gum]
ref|XP_002891463.1|  hypothetical protein ARALYDRAFT_474037             119   5e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_006406587.1|  hypothetical protein EUTSA_v10020940mg             117   6e-27   
ref|XP_006406586.1|  hypothetical protein EUTSA_v10020940mg             116   7e-27   
ref|XP_011465351.1|  PREDICTED: nucleolin 1-like isoform X7             118   9e-27   Fragaria vesca subsp. vesca
ref|XP_004301800.1|  PREDICTED: nucleolin 1-like isoform X4             118   9e-27   Fragaria vesca subsp. vesca
ref|XP_011465350.1|  PREDICTED: nucleolin 1-like isoform X6             118   1e-26   Fragaria vesca subsp. vesca
ref|XP_011465348.1|  PREDICTED: nucleolin 1-like isoform X3             118   1e-26   Fragaria vesca subsp. vesca
ref|XP_011465349.1|  PREDICTED: nucleolin 1-like isoform X5             118   1e-26   Fragaria vesca subsp. vesca
ref|XP_011465347.1|  PREDICTED: nucleolin 1-like isoform X2             118   1e-26   Fragaria vesca subsp. vesca
ref|XP_011465346.1|  PREDICTED: nucleolin 1-like isoform X1             118   1e-26   Fragaria vesca subsp. vesca
ref|XP_002445177.1|  hypothetical protein SORBIDRAFT_07g005510          118   2e-26   Sorghum bicolor [broomcorn]
ref|XP_008461860.1|  PREDICTED: nucleolin 1 isoform X2                  117   3e-26   Cucumis melo [Oriental melon]
dbj|BAK02407.1|  predicted protein                                      117   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004172525.1|  PREDICTED: uncharacterized protein LOC101223830    115   3e-26   
gb|EMT20945.1|  Nucleolin                                               116   4e-26   
ref|XP_008461859.1|  PREDICTED: nucleolin 1 isoform X1                  117   6e-26   Cucumis melo [Oriental melon]
gb|EMS57596.1|  Nucleolin                                               115   2e-25   Triticum urartu
ref|XP_009144995.1|  PREDICTED: nucleolin 1-like                        113   2e-25   Brassica rapa
ref|XP_004148591.1|  PREDICTED: uncharacterized protein LOC101206235    114   8e-25   
emb|CDY65178.1|  BnaCnng45920D                                          111   1e-24   Brassica napus [oilseed rape]
gb|KJB49997.1|  hypothetical protein B456_008G149100                    107   7e-24   Gossypium raimondii
gb|KJB49998.1|  hypothetical protein B456_008G149100                    107   7e-24   Gossypium raimondii
gb|KJB49999.1|  hypothetical protein B456_008G149100                    107   9e-24   Gossypium raimondii
ref|XP_006393330.1|  hypothetical protein EUTSA_v10011361mg             109   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009107584.1|  PREDICTED: nucleolin 1-like                        109   2e-23   
gb|KFK39211.1|  hypothetical protein AALP_AA3G213800                    108   2e-23   Arabis alpina [alpine rockcress]
gb|KFK39212.1|  hypothetical protein AALP_AA3G213800                    108   2e-23   Arabis alpina [alpine rockcress]
emb|CDX77274.1|  BnaC08g03190D                                          108   2e-23   
ref|XP_006605422.1|  PREDICTED: nucleolin 2-like isoform X3             109   3e-23   Glycine max [soybeans]
ref|XP_006605428.1|  PREDICTED: nucleolin 2-like isoform X9             108   4e-23   Glycine max [soybeans]
ref|XP_006605427.1|  PREDICTED: nucleolin 2-like isoform X8             108   4e-23   Glycine max [soybeans]
ref|XP_006605429.1|  PREDICTED: nucleolin 2-like isoform X10            108   4e-23   
ref|XP_006605438.1|  PREDICTED: nucleolin 2-like isoform X19            108   4e-23   Glycine max [soybeans]
ref|XP_006605420.1|  PREDICTED: nucleolin 2-like isoform X1             108   4e-23   Glycine max [soybeans]
ref|XP_006605421.1|  PREDICTED: nucleolin 2-like isoform X2             108   5e-23   Glycine max [soybeans]
ref|XP_006605441.1|  PREDICTED: nucleolin 2-like isoform X22            108   5e-23   Glycine max [soybeans]
ref|XP_006605430.1|  PREDICTED: nucleolin 2-like isoform X11            108   5e-23   Glycine max [soybeans]
ref|XP_010466013.1|  PREDICTED: nucleolin 2-like isoform X12            108   5e-23   
ref|XP_010466011.1|  PREDICTED: nucleolin 2-like isoform X10            108   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466007.1|  PREDICTED: nucleolin 2-like isoform X7             108   6e-23   
ref|XP_010466010.1|  PREDICTED: nucleolin 2-like isoform X9             108   7e-23   
ref|XP_010466008.1|  PREDICTED: nucleolin 2-like isoform X8             108   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466000.1|  PREDICTED: dentin sialophosphoprotein-like i...    108   8e-23   
ref|XP_010466006.1|  PREDICTED: nucleolin 2-like isoform X6             108   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466005.1|  PREDICTED: nucleolin 2-like isoform X5             108   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006587954.1|  PREDICTED: nucleolin 1-like                        105   9e-23   
ref|XP_010466004.1|  PREDICTED: dentin sialophosphoprotein-like i...    108   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466003.1|  PREDICTED: dentin sialophosphoprotein-like i...    108   9e-23   Camelina sativa [gold-of-pleasure]
ref|NP_175322.1|  nucleolin like 1                                      107   1e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93706.1|  BnaA06g03420D                                          105   3e-22   
ref|XP_009148215.1|  PREDICTED: nucleolin 1-like                        106   4e-22   
emb|CDX93704.1|  BnaA06g03440D                                          105   5e-22   
ref|XP_002983635.1|  hypothetical protein SELMODRAFT_234317             104   9e-22   
emb|CDY59893.1|  BnaC06g40890D                                          103   1e-21   Brassica napus [oilseed rape]
gb|KHN29567.1|  Polyadenylate-binding protein, cytoplasmic and nu...    103   2e-21   Glycine soja [wild soybean]
ref|XP_009145877.1|  PREDICTED: nucleolin 2-like                        102   3e-21   
ref|XP_002990577.1|  hypothetical protein SELMODRAFT_448081             102   4e-21   Selaginella moellendorffii
ref|XP_010507220.1|  PREDICTED: nucleolin 2-like isoform X2             102   4e-21   
ref|XP_010507230.1|  PREDICTED: nucleolin 2-like isoform X4             102   4e-21   
ref|XP_010507224.1|  PREDICTED: nucleolin 2-like isoform X3             102   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002885266.1|  hypothetical protein ARALYDRAFT_479366             102   5e-21   
ref|XP_010507217.1|  PREDICTED: nucleolin 2-like isoform X1             102   5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010507033.1|  PREDICTED: nucleolin 2-like isoform X3             102   6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010487806.1|  PREDICTED: nucleolin 2-like                        102   6e-21   
ref|XP_010507028.1|  PREDICTED: nucleolin 2-like isoform X1             102   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010507032.1|  PREDICTED: nucleolin 2-like isoform X2             102   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010465970.1|  PREDICTED: nucleolin 2-like                        102   8e-21   Camelina sativa [gold-of-pleasure]
dbj|BAB02219.1|  unnamed protein product                                101   8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188491.1|  protein NUCLEOLIN LIKE 2                              101   9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489916.1|  PREDICTED: nucleolin 2-like                        101   1e-20   Camelina sativa [gold-of-pleasure]
gb|KGN58514.1|  hypothetical protein Csa_3G653460                       101   2e-20   
ref|XP_009145876.1|  PREDICTED: nucleolin 2-like                      97.8    2e-20   Brassica rapa
emb|CDX92252.1|  BnaA05g21550D                                        99.0    6e-20   
gb|EAY95603.1|  hypothetical protein OsI_17455                        98.6    1e-19   Oryza sativa Indica Group [Indian rice]
emb|CDX92253.1|  BnaA05g21540D                                        95.9    1e-19   
ref|XP_001773240.1|  predicted protein                                98.2    2e-19   
emb|CDX99339.1|  BnaC05g34540D                                        95.9    8e-19   
ref|XP_006297116.1|  hypothetical protein CARUB_v10013117mg           94.7    2e-18   
ref|XP_006297117.1|  hypothetical protein CARUB_v10013117mg           94.7    2e-18   Capsella rubella
ref|XP_006297118.1|  hypothetical protein CARUB_v10013117mg           94.7    2e-18   Capsella rubella
ref|XP_006297119.1|  hypothetical protein CARUB_v10013117mg           94.4    3e-18   Capsella rubella
ref|XP_007156397.1|  hypothetical protein PHAVU_003G282900g           93.2    6e-18   Phaseolus vulgaris [French bean]
ref|XP_007156396.1|  hypothetical protein PHAVU_003G282900g           93.2    7e-18   Phaseolus vulgaris [French bean]
ref|XP_007156398.1|  hypothetical protein PHAVU_003G282900g           93.2    8e-18   Phaseolus vulgaris [French bean]
ref|XP_007156395.1|  hypothetical protein PHAVU_003G282900g           93.2    9e-18   Phaseolus vulgaris [French bean]
emb|CDX99340.1|  BnaC05g34550D                                        92.4    1e-17   
ref|XP_001757595.1|  predicted protein                                90.5    2e-17   
ref|XP_011396887.1|  Protein gar2                                     86.3    1e-16   Auxenochlorella protothecoides
ref|XP_001769822.1|  predicted protein                                88.6    1e-16   
ref|XP_004513591.1|  PREDICTED: RNA-binding protein 28-like isofo...  87.4    6e-16   Cicer arietinum [garbanzo]
ref|XP_004513589.1|  PREDICTED: RNA-binding protein 28-like isofo...  87.0    6e-16   Cicer arietinum [garbanzo]
ref|XP_004513590.1|  PREDICTED: RNA-binding protein 28-like isofo...  87.0    6e-16   
gb|KEH40855.1|  RNA recognition motif                                 84.0    7e-15   Medicago truncatula
ref|XP_005849687.1|  hypothetical protein CHLNCDRAFT_143267           82.0    3e-14   Chlorella variabilis
gb|KHM99054.1|  Protein gar2                                          82.4    3e-14   Glycine soja [wild soybean]
emb|CDY16474.1|  BnaA08g02930D                                        80.5    7e-14   Brassica napus [oilseed rape]
gb|AAF69708.1|AC016041_13  F27J15.29                                  71.2    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EPX72616.1|  gar2                                                  73.6    1e-11   Schizosaccharomyces octosporus yFS286
emb|CAA39224.1|  glycine-rich protein                                 67.8    5e-11   Solanum lycopersicum
ref|XP_002171551.1|  hypothetical protein SJAG_00259                  71.6    6e-11   Schizosaccharomyces japonicus yFS275
ref|XP_010491460.1|  PREDICTED: nucleolin 1-like                      70.1    7e-11   Camelina sativa [gold-of-pleasure]
emb|CCG81513.1|  Gar2                                                 70.9    1e-10   Taphrina deformans PYCC 5710
tpg|DAA38878.1|  TPA: putative nucleolin-like family protein          70.1    2e-10   
ref|XP_009544258.1|  hypothetical protein HETIRDRAFT_314076           67.8    4e-10   Heterobasidion irregulare TC 32-1
ref|NP_593531.1|  nucleolar protein required for rRNA processing      68.6    7e-10   Schizosaccharomyces pombe
ref|XP_010423112.1|  PREDICTED: nucleolin 1-like                      64.7    1e-09   
emb|CAA88179.1|  gar2                                                 68.2    1e-09   Schizosaccharomyces pombe
emb|CDJ36172.1|  nucleolar phosphoprotein nucleolin, putative         67.4    2e-09   Eimeria mitis
gb|KFK23930.1|  hypothetical protein AALP_AAs47265U000100             65.1    3e-09   Arabis alpina [alpine rockcress]
emb|CDJ60925.1|  nucleolar phosphoprotein nucleolin, putative         67.0    3e-09   Eimeria maxima
gb|ESA01445.1|  hypothetical protein GLOINDRAFT_68561                 65.5    3e-09   
gb|KFK41492.1|  hypothetical protein AALP_AA2G137300                  65.9    4e-09   Arabis alpina [alpine rockcress]
gb|KIJ32303.1|  hypothetical protein M422DRAFT_184633                 64.3    4e-09   Sphaerobolus stellatus SS14
gb|KFK41567.1|  hypothetical protein AALP_AA2G146000                  64.7    4e-09   Arabis alpina [alpine rockcress]
emb|CDJ50319.1|  nucleolar phosphoprotein nucleolin, putative         66.2    5e-09   Eimeria brunetti
ref|XP_001837329.1|  single-stranded DNA binding protein              65.9    6e-09   Coprinopsis cinerea okayama7#130
gb|EXX76493.1|  Nsr1p                                                 65.1    9e-09   Rhizophagus irregularis DAOM 197198w
ref|XP_010443562.1|  PREDICTED: polyadenylate-binding protein 2-like  63.5    1e-08   
emb|CDJ41252.1|  nucleolar phosphoprotein nucleolin, putative         65.1    1e-08   Eimeria tenella
emb|CDX91450.1|  BnaC04g07000D                                        62.8    1e-08   
gb|EPY52807.1|  nucleolar protein required for rRNA processing        64.7    1e-08   Schizosaccharomyces cryophilus OY26
emb|CDI83845.1|  nucleolar phosphoprotein nucleolin, putative         64.7    1e-08   Eimeria acervulina
gb|KIY45179.1|  RNA-binding domain-containing protein                 62.8    2e-08   Fistulina hepatica ATCC 64428
ref|XP_009143396.1|  PREDICTED: polyadenylate-binding protein 2-like  62.4    2e-08   Brassica rapa
ref|XP_010477184.1|  PREDICTED: nucleolin 2-like                      61.6    2e-08   
ref|XP_007338439.1|  RNA-binding domain-containing protein            63.9    2e-08   
ref|XP_008787582.1|  PREDICTED: nucleolin 2-like isoform X6           63.9    3e-08   
emb|CDJ66362.1|  nucleolar phosphoprotein nucleolin, putative         63.2    5e-08   Eimeria necatrix
emb|CDX91454.1|  BnaC04g06960D                                        61.2    5e-08   
ref|XP_010469654.1|  PREDICTED: nucleolin 1-like                      62.4    5e-08   Camelina sativa [gold-of-pleasure]
gb|KFK41695.1|  hypothetical protein AALP_AA2G161100                  62.0    5e-08   Arabis alpina [alpine rockcress]
gb|KIR48502.1|  nucleolin                                             62.8    6e-08   Cryptococcus gattii CA1280
gb|KFK41489.1|  hypothetical protein AALP_AA2G137000                  62.4    6e-08   Arabis alpina [alpine rockcress]
gb|KIR69281.1|  nucleolin                                             62.8    6e-08   Cryptococcus gattii CA1873
ref|XP_777972.1|  hypothetical protein CNBA4410                       62.4    7e-08   Cryptococcus neoformans var. neoformans B-3501A
emb|CDI75493.1|  nucleolar phosphoprotein nucleolin, putative         62.8    8e-08   Eimeria praecox
gb|KIR50807.1|  nucleolin                                             62.4    8e-08   Cryptococcus gattii Ru294
ref|XP_566835.1|  single-stranded DNA binding protein                 62.4    8e-08   Cryptococcus neoformans var. neoformans JEC21
ref|XP_010485217.1|  PREDICTED: polyadenylate-binding protein 2-like  60.1    8e-08   
gb|KJE02769.1|  nucleolin                                             62.4    8e-08   Cryptococcus gattii NT-10
gb|KIY37049.1|  nucleolin                                             62.4    8e-08   Cryptococcus gattii E566
ref|XP_003191429.1|  single-stranded DNA binding protein              62.0    9e-08   Cryptococcus gattii WM276
gb|KIR79756.1|  nucleolin                                             62.0    9e-08   Cryptococcus gattii EJB2
ref|XP_002840583.1|  hypothetical protein                             62.0    1e-07   Tuber melanosporum Mel28
gb|KIO03051.1|  hypothetical protein M404DRAFT_59789                  60.5    1e-07   Pisolithus tinctorius Marx 270
emb|CCF75957.1|  unnamed protein product                              60.8    1e-07   
gb|EPS99701.1|  hypothetical protein FOMPIDRAFT_1050281               62.0    1e-07   Fomitopsis pinicola FP-58527 SS1
ref|XP_007388527.1|  RNA-binding domain-containing protein            61.6    1e-07   
ref|XP_010453613.1|  PREDICTED: uncharacterized protein LOC104735498  59.7    1e-07   
ref|XP_010436361.1|  PREDICTED: nucleolin 1-like                      61.2    2e-07   
ref|XP_002448857.1|  hypothetical protein SORBIDRAFT_05g000362        57.8    2e-07   
gb|ELU39701.1|  RNA recognition motif domain-containing protein       61.6    2e-07   
gb|KIR42247.1|  nucleolin                                             61.2    2e-07   
gb|KGB75595.1|  nuclear localization sequence binding protein         61.2    2e-07   
gb|KIR86724.1|  nucleolin                                             60.8    2e-07   
gb|KIM20731.1|  hypothetical protein M408DRAFT_55298                  60.8    2e-07   
gb|KIO31343.1|  hypothetical protein M407DRAFT_220481                 61.2    2e-07   
ref|XP_001877216.1|  predicted protein                                59.3    3e-07   
gb|KFK25167.1|  hypothetical protein AALP_AA8G075100                  60.1    3e-07   
emb|CDX91465.1|  BnaC04g06850D                                        58.5    3e-07   
ref|XP_003652233.1|  hypothetical protein THITE_2113488               60.5    3e-07   
gb|KIL68118.1|  hypothetical protein M378DRAFT_191130                 60.5    3e-07   
emb|CDY54454.1|  BnaAnng13210D                                        59.3    4e-07   
ref|XP_001220056.1|  hypothetical protein CHGG_00835                  60.1    4e-07   
gb|KIK08421.1|  hypothetical protein K443DRAFT_128336                 60.1    4e-07   
emb|CBN78824.1|  Protein for assembly of pre-ribosomal particles ...  60.1    5e-07   
emb|CDX91458.1|  BnaC04g06920D                                        58.5    5e-07   
ref|XP_006400770.1|  hypothetical protein EUTSA_v10015531mg           57.4    5e-07   
ref|XP_001730007.1|  hypothetical protein MGL_2993                    60.1    5e-07   
gb|AFR92610.1|  nucleolin                                             59.7    6e-07   
ref|XP_001742876.1|  hypothetical protein                             60.1    6e-07   
gb|EJY70479.1|  hypothetical protein OXYTRI_08772                     59.7    6e-07   
ref|XP_006670721.1|  nucleolin protein Nsr1, putative                 59.3    8e-07   
ref|XP_006414776.1|  hypothetical protein EUTSA_v10026891mg           58.2    9e-07   
gb|EST06788.1|  hypothetical protein PSEUBRA_SCAF25g00991             59.3    9e-07   
ref|XP_006414774.1|  hypothetical protein EUTSA_v10027509mg           56.2    1e-06   
ref|XP_011501159.1|  PREDICTED: RNA-binding protein 34-like           58.9    1e-06   
gb|KFK41491.1|  hypothetical protein AALP_AA2G137200                  58.5    1e-06   
ref|XP_003881295.1|  putative nucleolar phosphoprotein nucleolin      58.9    1e-06   
gb|KFK23548.1|  hypothetical protein AALP_AAs66918U001200             57.4    1e-06   
ref|XP_010443563.1|  PREDICTED: polyadenylate-binding protein 2-like  57.4    2e-06   
gb|EKD03282.1|  hypothetical protein A1Q2_02392                       58.2    2e-06   
ref|XP_003659355.1|  hypothetical protein MYCTH_2296269               58.5    2e-06   
gb|EJY71156.1|  RNA-binding proteins (RRM domain)                     58.5    2e-06   
gb|KIK95448.1|  hypothetical protein PAXRUDRAFT_11433                 58.5    2e-06   
ref|NP_001140942.1|  uncharacterized protein LOC100273020             58.2    2e-06   
emb|CCG83374.1|  Protein gar2                                         56.6    2e-06   
gb|KGO48613.1|  Nucleotide-binding, alpha-beta plait                  58.2    2e-06   
ref|XP_002436725.1|  hypothetical protein SORBIDRAFT_10g007620        56.2    2e-06   
ref|XP_002907539.1|  nucleolin, putative                              57.8    3e-06   
gb|KJB17317.1|  hypothetical protein B456_003G040800                  56.2    3e-06   
emb|CDI56738.1|  related to NSR1-nuclear localization sequence bi...  57.8    3e-06   
emb|CDY55162.1|  BnaCnng28280D                                        56.6    3e-06   
ref|XP_002871317.1|  predicted protein                                57.4    3e-06   
ref|XP_007002180.1|  hypothetical protein TREMEDRAFT_72942            57.8    3e-06   
ref|XP_008035938.1|  RNA-binding domain-containing protein            57.8    3e-06   
ref|XP_009126872.1|  PREDICTED: histone deacetylase HDT2-like         57.4    3e-06   
gb|ACF87534.1|  unknown                                               56.2    3e-06   
emb|CDY09156.1|  BnaA02g05820D                                        57.4    3e-06   
ref|XP_002681059.1|  RRM domain-containing protein                    57.0    3e-06   
ref|XP_007767853.1|  RNA-binding domain-containing protein            57.8    3e-06   
ref|XP_006696337.1|  hypothetical protein CTHT_0060190                57.4    4e-06   
ref|XP_006400968.1|  hypothetical protein EUTSA_v10015284mg           55.1    4e-06   
ref|XP_010474315.1|  PREDICTED: nucleolin 2-like                      55.5    4e-06   
sp|P20397.3|NUCL_XENLA  RecName: Full=Nucleolin; AltName: Full=Pr...  57.4    4e-06   
gb|KJB17319.1|  hypothetical protein B456_003G040800                  55.8    4e-06   
dbj|GAM41058.1|  hypothetical protein TCE0_041f13886                  57.0    5e-06   
gb|KIM84049.1|  hypothetical protein PILCRDRAFT_424711                57.0    5e-06   
gb|KHG00394.1|  Polyadenylate-binding 2                               55.8    5e-06   
ref|XP_007047888.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...  55.8    5e-06   
gb|KFK41703.1|  hypothetical protein AALP_AA2G161900                  56.6    5e-06   
gb|KFX49923.1|  Nuclear localization sequence-binding protein         57.0    5e-06   
ref|XP_006289866.1|  hypothetical protein CARUB_v10003477mg           54.7    5e-06   
gb|KFX49922.1|  Protein gar2                                          57.0    5e-06   
ref|XP_008887909.1|  RNA recognition motif-containing protein         57.0    5e-06   
ref|XP_002153520.1|  nucleolin protein Nsr1, putative                 57.0    5e-06   
emb|CBN77067.1|  Sart3 protein                                        57.4    5e-06   
gb|KJB17316.1|  hypothetical protein B456_003G040800                  55.1    5e-06   
ref|XP_007047889.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...  55.5    5e-06   
gb|KFG30860.1|  RNA recognition motif-containing protein              57.0    6e-06   
gb|EPR59683.1|  RNA recognition motif-containing protein              57.0    6e-06   
ref|XP_003005240.1|  gar2                                             56.6    6e-06   
ref|XP_011392562.1|  hypothetical protein UMAG_06193                  56.6    7e-06   
ref|XP_007391620.1|  hypothetical protein PHACADRAFT_169505           56.6    7e-06   
ref|XP_009649128.1|  gar2                                             56.6    7e-06   
ref|XP_002368535.1|  nucleolar phosphoprotein nucleolin, putative     56.6    7e-06   
ref|XP_002873095.1|  predicted protein                                55.5    7e-06   
ref|XP_004964965.1|  PREDICTED: polyadenylate-binding protein 2-l...  55.1    7e-06   
gb|KFG62879.1|  RNA recognition motif-containing protein              56.6    7e-06   
gb|KFH05868.1|  RNA recognition motif-containing protein              56.6    7e-06   
ref|XP_004964966.1|  PREDICTED: polyadenylate-binding protein 2-l...  55.1    7e-06   
ref|XP_006406656.1|  hypothetical protein EUTSA_v10021355mg           55.8    7e-06   
gb|KGO75463.1|  Nucleotide-binding, alpha-beta plait                  56.6    7e-06   
ref|XP_006406655.1|  hypothetical protein EUTSA_v10021355mg           55.8    8e-06   
ref|XP_002541901.1|  predicted protein                                56.6    8e-06   
dbj|GAC77060.1|  nuclear localization sequence binding protein        56.2    8e-06   
ref|XP_010495045.1|  PREDICTED: nucleolin 2-like                      53.1    8e-06   
gb|ETS59745.1|  hypothetical protein PaG_06268                        56.2    8e-06   
dbj|GAK67593.1|  conserved hypothetical protein                       56.2    8e-06   
ref|XP_010424438.1|  PREDICTED: nucleolin 1-like                      54.7    9e-06   
ref|WP_034616338.1|  RNA-binding protein                              52.8    9e-06   
ref|XP_003327073.1|  hypothetical protein PGTG_08850                  56.2    9e-06   
ref|XP_001435565.1|  hypothetical protein                             56.2    9e-06   
ref|NP_201329.1|  RNA recognition motif-containing protein            55.1    9e-06   
ref|XP_002866661.1|  polyadenylate-binding protein family protein     55.1    9e-06   
gb|KJB07918.1|  hypothetical protein B456_001G052500                  55.1    9e-06   
gb|KFH70493.1|  nucleolin                                             55.8    1e-05   
gb|EMD31812.1|  hypothetical protein CERSUDRAFT_88684                 55.8    1e-05   
ref|NP_001288928.1|  polyadenylate-binding protein 2                  55.1    1e-05   
gb|KFK38051.1|  hypothetical protein AALP_AA3G063900                  55.8    1e-05   
ref|XP_006394056.1|  hypothetical protein EUTSA_v10004890mg           55.1    1e-05   
ref|XP_010469614.1|  PREDICTED: nucleolin 1-like                      54.7    1e-05   
emb|CBQ71460.1|  related to NSR1-nuclear localization sequence bi...  55.8    1e-05   
ref|XP_002487897.1|  nucleolin protein Nsr1, putative                 56.2    1e-05   
ref|XP_002871038.1|  predicted protein                                55.5    1e-05   
ref|XP_002883446.1|  predicted protein                                55.8    1e-05   
ref|XP_006423797.1|  hypothetical protein CICLE_v100293173mg          52.8    1e-05   
ref|XP_008786202.1|  PREDICTED: polyadenylate-binding protein 2-like  54.7    1e-05   
emb|CDO78060.1|  hypothetical protein BN946_scf184826.g5              56.2    1e-05   
ref|XP_007921995.1|  hypothetical protein MYCFIDRAFT_149907           55.8    1e-05   
gb|KIK21916.1|  hypothetical protein PISMIDRAFT_680875                55.8    1e-05   
ref|XP_006679392.1|  hypothetical protein BATDEDRAFT_19718            55.8    1e-05   
ref|XP_005237874.1|  PREDICTED: nucleolin                             56.2    1e-05   
ref|XP_005443793.1|  PREDICTED: nucleolin                             55.8    1e-05   
gb|EER42426.1|  ribonucleoprotein                                     55.8    1e-05   
ref|XP_005671017.1|  PREDICTED: RNA-binding protein 34                55.8    1e-05   
ref|XP_007882500.1|  hypothetical protein PFL1_06763                  55.8    1e-05   
gb|KEQ76204.1|  RNA-binding domain-containing protein                 55.5    1e-05   
ref|XP_004143458.1|  PREDICTED: polyadenylate-binding protein 2-like  54.3    1e-05   
ref|XP_010267253.1|  PREDICTED: polyadenylate-binding protein 2       54.7    1e-05   
ref|XP_007862641.1|  RNA-binding domain-containing protein            55.8    1e-05   
ref|XP_002490979.1|  Poly(A) binding protein, part of the 3'-end ...  55.8    1e-05   
gb|EEH08455.1|  ribonucleoprotein                                     55.5    1e-05   
gb|ACU17272.1|  unknown                                               53.9    1e-05   
ref|XP_010519384.1|  PREDICTED: polyadenylate-binding protein 2-l...  54.3    2e-05   
gb|KIZ02338.1|  Protein gar2                                          55.1    2e-05   
ref|XP_001544861.1|  predicted protein                                55.5    2e-05   
gb|KFQ46694.1|  Nucleolin                                             55.5    2e-05   
ref|XP_010523297.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    2e-05   
ref|XP_006394055.1|  hypothetical protein EUTSA_v10004890mg           54.3    2e-05   
ref|XP_006376950.1|  hypothetical protein POPTR_0012s11480g           54.3    2e-05   
gb|KJB07914.1|  hypothetical protein B456_001G052500                  54.3    2e-05   
ref|XP_002945845.1|  hypothetical protein VOLCADRAFT_54847            54.3    2e-05   
ref|NP_001152340.1|  polyadenylate-binding protein 2                  53.9    2e-05   
gb|KFK28208.1|  hypothetical protein AALP_AA8G486500                  54.3    2e-05   
ref|XP_011003544.1|  PREDICTED: polyadenylate-binding protein 1-like  54.3    2e-05   
gb|EQL37534.1|  nucleolin, variant 1                                  55.5    2e-05   
ref|XP_002628857.1|  ribonucleoprotein                                55.5    2e-05   
ref|XP_005142361.1|  PREDICTED: nucleolin                             55.5    2e-05   
gb|EEQ85305.1|  nucleolin protein Nsr1                                55.5    2e-05   
ref|XP_010009175.1|  PREDICTED: nucleolin                             55.5    2e-05   
gb|ETP04064.1|  hypothetical protein F441_19082                       55.1    2e-05   
ref|XP_006460156.1|  hypothetical protein AGABI2DRAFT_142473          55.5    2e-05   
gb|EQL37533.1|  nucleolin                                             55.5    2e-05   
ref|XP_007329028.1|  hypothetical protein AGABI1DRAFT_73218           55.5    2e-05   
gb|EQL37535.1|  nucleolin, variant 2                                  55.1    2e-05   
gb|KDO60716.1|  hypothetical protein CISIN_1g041633mg                 54.3    2e-05   
ref|XP_009554853.1|  PREDICTED: nucleolin                             55.5    2e-05   
ref|XP_002873094.1|  predicted protein                                54.7    2e-05   
gb|KFP00522.1|  Nucleolin                                             55.5    2e-05   
ref|XP_008491559.1|  PREDICTED: nucleolin                             55.5    2e-05   
gb|EUC56223.1|  RNA recognition motif 2 gar2-like protein             55.1    2e-05   
emb|CBN76756.1|  conserved unknown protein                            55.5    2e-05   
emb|CDY33952.1|  BnaC02g43850D                                        53.9    2e-05   
gb|KIK41144.1|  hypothetical protein CY34DRAFT_806434                 55.1    2e-05   
gb|KEP49441.1|  putative RNA recognition motif                        55.1    2e-05   
ref|XP_011465382.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    2e-05   
ref|XP_006466250.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    2e-05   
gb|KIO30901.1|  hypothetical protein M407DRAFT_20023                  55.1    2e-05   
ref|XP_004307764.1|  PREDICTED: polyadenylate-binding protein 1       53.9    2e-05   
gb|KJB19595.1|  hypothetical protein B456_003G110600                  53.9    2e-05   
sp|Q8C5L7.1|RBM34_MOUSE  RecName: Full=RNA-binding protein 34; Al...  54.7    3e-05   
ref|XP_006531245.1|  PREDICTED: RNA-binding protein 34 isoform X1     54.7    3e-05   
ref|NP_766350.2|  RNA-binding protein 34                              54.7    3e-05   
ref|XP_009632663.1|  PREDICTED: nucleolin                             55.1    3e-05   
gb|KFP12218.1|  Nucleolin                                             55.1    3e-05   
gb|KFR00575.1|  Nucleolin                                             55.1    3e-05   
gb|KIP10589.1|  hypothetical protein PHLGIDRAFT_18270                 54.7    3e-05   
ref|XP_008453839.1|  PREDICTED: polyadenylate-binding protein 2-l...  53.9    3e-05   
gb|EDL11823.1|  RNA binding motif protein 34, isoform CRA_b           54.7    3e-05   
gb|KID77185.1|  cutinase negative acting protein                      54.7    3e-05   
ref|XP_006146031.1|  PREDICTED: RNA-binding protein 34                54.7    3e-05   
ref|XP_009466710.1|  PREDICTED: nucleolin                             54.7    3e-05   
gb|KEQ80245.1|  RNA-binding domain-containing protein                 54.7    3e-05   
gb|KIJ19775.1|  hypothetical protein PAXINDRAFT_152836                54.7    3e-05   
ref|XP_006281788.1|  hypothetical protein CARUB_v10027958mg           53.9    3e-05   
emb|CDM31783.1|  Nucleotide-binding, alpha-beta plait                 54.7    3e-05   
gb|EPS71398.1|  hypothetical protein M569_03365                       53.5    3e-05   
ref|NP_001235474.1|  uncharacterized protein LOC100527139             53.1    3e-05   
emb|CDY07010.1|  BnaA04g23050D                                        53.9    3e-05   
ref|NP_195968.1|  RNA-binding (RRM/RBD/RNP motifs) family protein     54.3    4e-05   
gb|KFP93324.1|  Nucleolin                                             54.7    4e-05   
ref|XP_011022817.1|  PREDICTED: polyadenylate-binding protein 2-l...  53.1    4e-05   
gb|KFQ16634.1|  Nucleolin                                             54.7    4e-05   
ref|XP_009910518.1|  PREDICTED: nucleolin                             54.7    4e-05   
ref|XP_006280995.1|  hypothetical protein CARUB_v10027002mg           53.5    4e-05   
gb|KDO50217.1|  hypothetical protein CISIN_1g029268mg                 52.8    4e-05   
gb|KHN30707.1|  Polyadenylate-binding protein 2                       53.1    4e-05   
ref|XP_010274505.1|  PREDICTED: polyadenylate-binding protein 2       53.5    4e-05   
ref|XP_003348326.1|  hypothetical protein SMAC_02824                  54.3    4e-05   
ref|XP_010571328.1|  PREDICTED: nucleolin                             54.7    4e-05   
ref|XP_009363742.1|  PREDICTED: polyadenylate-binding protein 2       53.1    4e-05   
gb|KIE03089.1|  cutinase negative acting protein                      54.3    4e-05   
gb|KID88149.1|  cutinase negative acting protein                      54.3    4e-05   
emb|CEL59234.1|  Protein gar2 OS=Schizosaccharomyces pombe (strai...  54.3    4e-05   
gb|KJB19594.1|  hypothetical protein B456_003G110600                  53.5    4e-05   
emb|CCO30077.1|  Protein gar2                                         54.3    4e-05   
ref|XP_009958402.1|  PREDICTED: nucleolin                             54.3    4e-05   
ref|XP_009141809.1|  PREDICTED: uncharacterized protein LOC103865720  53.9    4e-05   
ref|XP_007042910.1|  RNA-binding family protein isoform 2             52.8    4e-05   
gb|KDQ65125.1|  hypothetical protein JAAARDRAFT_168025                53.5    4e-05   
ref|NP_001237617.1|  uncharacterized protein LOC100527545             53.1    4e-05   
ref|XP_002309968.1|  hypothetical protein POPTR_0007s05140g           53.1    4e-05   
gb|KFZ56261.1|  Nucleolin                                             54.3    4e-05   
gb|KFP23741.1|  Nucleolin                                             54.3    4e-05   
gb|EMS18176.1|  single-stranded DNA binding protein                   54.3    4e-05   
ref|XP_005485009.1|  PREDICTED: nucleolin                             54.3    4e-05   
ref|XP_007591433.1|  RNA recognition domain-containing protein        54.3    4e-05   
gb|KDO50216.1|  hypothetical protein CISIN_1g029268mg                 52.8    4e-05   
gb|ETL81234.1|  hypothetical protein, variant 3                       53.9    4e-05   
emb|CCC10246.1|  unnamed protein product                              54.3    4e-05   
ref|XP_010452589.1|  PREDICTED: nucleolin 2-like                      52.0    5e-05   
ref|XP_009131004.1|  PREDICTED: nucleolin 1-like                      52.8    5e-05   
ref|XP_007144150.1|  hypothetical protein PHAVU_007G133000g           53.1    5e-05   
ref|XP_010207384.1|  PREDICTED: nucleolin                             54.3    5e-05   
emb|CDY33970.1|  BnaC02g43670D                                        52.8    5e-05   
ref|NP_001014037.1|  RNA-binding protein 34                           53.9    5e-05   
gb|KFH73324.1|  nucleolin                                             53.9    5e-05   



>ref|XP_010315558.1| PREDICTED: nucleolin 1 isoform X2 [Solanum lycopersicum]
Length=631

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 5/138 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG DLLGRDV+LDLA+ERG YTP SG   N +  Q     E TT+FVRGF
Sbjct  417  AEAAHKALELNGHDLLGRDVRLDLARERGEYTPRSG---NENSFQRPARSEGTTIFVRGF  473

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D DA++KALEL+ 
Sbjct  474  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDG  533

Query  408  SQLGHSSLYVDEAKPRND  355
            S++G  SL V EAKPR D
Sbjct  534  SEVGGFSLNVQEAKPRGD  551



>ref|XP_004231484.1| PREDICTED: nucleolin 1 isoform X1 [Solanum lycopersicum]
Length=632

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 5/138 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG DLLGRDV+LDLA+ERG YTP SG   N +  Q     E TT+FVRGF
Sbjct  418  AEAAHKALELNGHDLLGRDVRLDLARERGEYTPRSG---NENSFQRPARSEGTTIFVRGF  474

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D DA++KALEL+ 
Sbjct  475  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDG  534

Query  408  SQLGHSSLYVDEAKPRND  355
            S++G  SL V EAKPR D
Sbjct  535  SEVGGFSLNVQEAKPRGD  552



>ref|XP_006367329.1| PREDICTED: nucleolin 2-like [Solanum tuberosum]
Length=626

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG DLLGRDV+LDLA+ERG YTP SG  D +S ++     + TT+FVRGF
Sbjct  410  AEAAHKALELNGHDLLGRDVRLDLARERGEYTPRSGR-DENSFQKPAARSDGTTIFVRGF  468

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D DA++KALEL+ 
Sbjct  469  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDG  528

Query  408  SQLGHSSLYVDEAKP  364
            S++G  SL V EAKP
Sbjct  529  SEVGGFSLNVQEAKP  543



>dbj|BAC02896.1| tobacco nucleolin [Nicotiana tabacum]
Length=620

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 4/135 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNGQDLLGR V+LDLA+ERG YTP +G  +NS QRQ R   E TT+FVRGF
Sbjct  417  AEAAHKALELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGF  474

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D+DA++KALEL+ 
Sbjct  475  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDSDALNKALELDG  534

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L V EAKP
Sbjct  535  SEVGGYNLTVQEAKP  549



>ref|XP_009624911.1| PREDICTED: nucleolin 1 isoform X1 [Nicotiana tomentosiformis]
Length=632

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 4/135 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNGQDLLGR V+LDLA+ERG YTP +G  +NS QRQ R   E TT+FVRGF
Sbjct  418  AEAAHKALELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGF  475

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D+DA++KALEL+ 
Sbjct  476  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDSDALNKALELDG  535

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L V EAKP
Sbjct  536  SEVGGYNLTVQEAKP  550



>ref|XP_009624912.1| PREDICTED: nucleolin 1 isoform X2 [Nicotiana tomentosiformis]
Length=631

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 4/135 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNGQDLLGR V+LDLA+ERG YTP +G  +NS QRQ R   E TT+FVRGF
Sbjct  417  AEAAHKALELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGF  474

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D+DA++KALEL+ 
Sbjct  475  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDSDALNKALELDG  534

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L V EAKP
Sbjct  535  SEVGGYNLTVQEAKP  549



>ref|XP_009778554.1| PREDICTED: nucleolin 1 isoform X1 [Nicotiana sylvestris]
Length=628

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNGQDLLGR V+LDLA+ERG YTP +G  +NS QRQ R   E TT+FVRGF
Sbjct  414  AEAAHKALELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGF  471

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D D ++KALEL+ 
Sbjct  472  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDGDTLNKALELDG  531

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L V EAKP
Sbjct  532  SEVGGYNLTVQEAKP  546



>ref|XP_009778556.1| PREDICTED: nucleolin 1 isoform X2 [Nicotiana sylvestris]
Length=627

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNGQDLLGR V+LDLA+ERG YTP +G  +NS QRQ R   E TT+FVRGF
Sbjct  413  AEAAHKALELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGF  470

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNN  409
            DKN+ ED IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D D ++KALEL+ 
Sbjct  471  DKNEAEDQIRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDGDTLNKALELDG  530

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L V EAKP
Sbjct  531  SEVGGYNLTVQEAKP  545



>ref|XP_002307174.1| nucleolin family protein [Populus trichocarpa]
 gb|EEE94170.1| nucleolin family protein [Populus trichocarpa]
Length=660

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL  NG+ LLGRDV+LDLA+ERG  T N+    +S+  Q  G G+S T+FV+GF
Sbjct  441  TEAALKALNFNGKSLLGRDVRLDLARERGERTSNTPYSKDSNSFQKGGRGQSQTIFVKGF  500

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK   ED IRS+L+ HFGSCGEI    IPTD E G IKGMAY+EF D DAM+KA ELN S
Sbjct  501  DKFGAEDEIRSSLQEHFGSCGEISRISIPTDYETGAIKGMAYLEFNDADAMNKAFELNGS  560

Query  405  QLGHSSLYVDEAKPRND  355
            QLG S L VDEAKPR D
Sbjct  561  QLGESYLTVDEAKPRTD  577



>gb|ABK94939.1| unknown [Populus trichocarpa]
Length=590

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL+L+G  LLGRDV+LDLA+E+G+ TP S    +SS     G G+S T+FVRGF
Sbjct  390  AEAAQKALKLHGNTLLGRDVRLDLAREKGSNTPYS---KDSSSFPKGGSGQSQTIFVRGF  446

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA+SKA ELN S
Sbjct  447  DKSAGEDEIRSSLQEHFGSCGEIKRVSIPTDYDTGAIKGMAYLEFNDADALSKAFELNGS  506

Query  405  QLGHSSLYVDEAKPRND  355
            QLG   L VDEAKPR+D
Sbjct  507  QLGEYCLTVDEAKPRSD  523



>ref|XP_006380517.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
 gb|ERP58314.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
Length=548

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL+L+G  LLGRDV+LDLA+E+G+ TP S    +SS     G G+S T+FVRGF
Sbjct  348  AEAAQKALKLHGNTLLGRDVRLDLAREKGSNTPYS---KDSSSFPKGGSGQSQTIFVRGF  404

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA+SKA ELN S
Sbjct  405  DKSAGEDEIRSSLQEHFGSCGEIKRVSIPTDYDTGAIKGMAYLEFNDADALSKAFELNGS  464

Query  405  QLGHSSLYVDEAKPRND  355
            QLG   L VDEAKPR+D
Sbjct  465  QLGEYRLTVDEAKPRSD  481



>ref|XP_006380518.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
 gb|ERP58315.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
Length=590

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL+L+G  LLGRDV+LDLA+E+G+ TP S    +SS     G G+S T+FVRGF
Sbjct  390  AEAAQKALKLHGNTLLGRDVRLDLAREKGSNTPYS---KDSSSFPKGGSGQSQTIFVRGF  446

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA+SKA ELN S
Sbjct  447  DKSAGEDEIRSSLQEHFGSCGEIKRVSIPTDYDTGAIKGMAYLEFNDADALSKAFELNGS  506

Query  405  QLGHSSLYVDEAKPRND  355
            QLG   L VDEAKPR+D
Sbjct  507  QLGEYRLTVDEAKPRSD  523



>ref|XP_011008909.1| PREDICTED: nucleolin 2 isoform X2 [Populus euphratica]
Length=582

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL+L+G+ LLGRDV+LDLA+E+G+ TP S    +S+  Q  G G+S T+FV+GF
Sbjct  390  AEAAQKALKLHGKTLLGRDVRLDLAREKGSNTPYS---KDSNSFQKGGSGQSQTIFVKGF  446

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA++KA ELN S
Sbjct  447  DKSAGEDEIRSSLQEHFGSCGEIKRISIPTDYDTGAIKGMAYLEFNDADALNKAFELNGS  506

Query  405  QLGHSSLYVDEAKPRND  355
            QLG   L VDEAKPRND
Sbjct  507  QLGECYLTVDEAKPRND  523



>ref|XP_011008908.1| PREDICTED: nucleolin 1 isoform X1 [Populus euphratica]
Length=594

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL+L+G+ LLGRDV+LDLA+E+G+ TP S    +S+  Q  G G+S T+FV+GF
Sbjct  390  AEAAQKALKLHGKTLLGRDVRLDLAREKGSNTPYS---KDSNSFQKGGSGQSQTIFVKGF  446

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA++KA ELN S
Sbjct  447  DKSAGEDEIRSSLQEHFGSCGEIKRISIPTDYDTGAIKGMAYLEFNDADALNKAFELNGS  506

Query  405  QLGHSSLYVDEAKPRND  355
            QLG   L VDEAKPRND
Sbjct  507  QLGECYLTVDEAKPRND  523



>ref|XP_011022059.1| PREDICTED: nucleolin 1-like isoform X1 [Populus euphratica]
Length=673

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL  NG+ LLGRDV+LDLA+ERG  + N+    +S+  Q  G G+S T+FV+GF
Sbjct  465  TEAALKALNFNGKSLLGRDVRLDLARERGDRSSNTPYSKDSNSFQKGGRGQSQTIFVKGF  524

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK   ED IRS+L+ HFGSCGEI    IPTD E G IKGMAY+EF D DAM+KA ELN S
Sbjct  525  DKFCGEDEIRSSLQEHFGSCGEITRISIPTDYETGAIKGMAYLEFNDADAMNKAFELNGS  584

Query  405  QLGHSSLYVDEAKPRND  355
            QLG S L VDEAKPRND
Sbjct  585  QLGESYLTVDEAKPRND  601



>ref|XP_011022060.1| PREDICTED: nucleolin 1-like isoform X2 [Populus euphratica]
Length=636

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL  NG+ LLGRDV+LDLA+ERG  + N+    +S+  Q  G G+S T+FV+GF
Sbjct  428  TEAALKALNFNGKSLLGRDVRLDLARERGDRSSNTPYSKDSNSFQKGGRGQSQTIFVKGF  487

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK   ED IRS+L+ HFGSCGEI    IPTD E G IKGMAY+EF D DAM+KA ELN S
Sbjct  488  DKFCGEDEIRSSLQEHFGSCGEITRISIPTDYETGAIKGMAYLEFNDADAMNKAFELNGS  547

Query  405  QLGHSSLYVDEAKPRND  355
            QLG S L VDEAKPRND
Sbjct  548  QLGESYLTVDEAKPRND  564



>gb|EYU35586.1| hypothetical protein MIMGU_mgv1a002998mg [Erythranthe guttata]
Length=617

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 12/140 (9%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVF  595
            +EAA KA E +NGQ+LL R+V+LD A+ERG   AYTPNSG          R   +  T+F
Sbjct  410  AEAAKKAFEQMNGQELLNREVRLDFARERGERPAYTPNSGG--------PRSQSQGPTLF  461

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALEL  415
            V+GFD  + ED IRS+LE HFG+CGEI    +PTDPEG +KG+AYI F DN+A +KALEL
Sbjct  462  VKGFDTRNGEDQIRSSLEEHFGTCGEITRVSLPTDPEGGVKGIAYINFKDNNAFNKALEL  521

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N S+ G+ SL VDEAKPR D
Sbjct  522  NGSEFGNGSLTVDEAKPRFD  541



>ref|XP_011070437.1| PREDICTED: nucleolin 1-like [Sesamum indicum]
Length=599

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  SEAAAKAL-ELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KAL ELNG++LLGR V+LDLA+ERGA TP SG  D  S ++     +  T+FVRG
Sbjct  393  AEAAEKALRELNGEELLGRSVRLDLARERGANTPYSGGKDTQSFQKGGRA-QGQTIFVRG  451

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  406
            F+K D+ED IRS+LE HFGSCGEI    IP D +G +KGMAY++F D++   +ALELN S
Sbjct  452  FNKYDSEDQIRSSLEEHFGSCGEITRVSIPKDQDGAVKGMAYLDFKDSNGFKQALELNGS  511

Query  405  QLGHSSLYVDEAKPRND  355
            + G S+L V+EA+PR D
Sbjct  512  EFGESTLSVEEARPRGD  528



>ref|XP_009383653.1| PREDICTED: nucleolin 2-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=628

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EA  KALE+NGQ+L GR V+LD+A+ERG+YTPN+G  DN S ++   G +S T+FVRGFD
Sbjct  423  EAVQKALEMNGQELFGRAVRLDVARERGSYTPNNGK-DNYSHQKGGTG-QSQTIFVRGFD  480

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS+LE HFGSCGE+    IP D E G  KG+AY++F D DA ++ALELN S+
Sbjct  481  KSLEEDQIRSSLEEHFGSCGELTRVSIPKDYESGASKGIAYMDFKDQDAFTQALELNGSE  540

Query  402  LGHSSLYVDEAKPRND  355
            LG  +L VDEAKPR D
Sbjct  541  LGGYTLTVDEAKPRGD  556



>ref|XP_009383652.1| PREDICTED: nucleolin 2-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EA  KALE+NGQ+L GR V+LD+A+ERG+YTPN+G  DN S ++   G +S T+FVRGFD
Sbjct  423  EAVQKALEMNGQELFGRAVRLDVARERGSYTPNNGK-DNYSHQKGGTG-QSQTIFVRGFD  480

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS+LE HFGSCGE+    IP D E G  KG+AY++F D DA ++ALELN S+
Sbjct  481  KSLEEDQIRSSLEEHFGSCGELTRVSIPKDYESGASKGIAYMDFKDQDAFTQALELNGSE  540

Query  402  LGHSSLYVDEAKPRND  355
            LG  +L VDEAKPR D
Sbjct  541  LGGYTLTVDEAKPRGD  556



>ref|XP_004505721.1| PREDICTED: nucleolin 2-like isoform X2 [Cicer arietinum]
Length=613

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 95/134 (71%), Gaps = 9/134 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA  ALELNGQDLL R V+LDLA+ERGA+TPNS              G+S TVFVRGFD
Sbjct  416  EAAQTALELNGQDLLNRAVRLDLARERGAFTPNSAP--------RGPRGQSQTVFVRGFD  467

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IR++LE HF SCGEI    IP D   GY+KG AY++F D+D++ KALEL+ S+
Sbjct  468  KSQGEDEIRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESE  527

Query  402  LGHSSLYVDEAKPR  361
            LG  +L VDEAKPR
Sbjct  528  LGGYTLSVDEAKPR  541



>ref|XP_004505720.1| PREDICTED: nucleolin 2-like isoform X1 [Cicer arietinum]
Length=615

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 95/134 (71%), Gaps = 9/134 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA  ALELNGQDLL R V+LDLA+ERGA+TPNS              G+S TVFVRGFD
Sbjct  416  EAAQTALELNGQDLLNRAVRLDLARERGAFTPNSAP--------RGPRGQSQTVFVRGFD  467

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IR++LE HF SCGEI    IP D   GY+KG AY++F D+D++ KALEL+ S+
Sbjct  468  KSQGEDEIRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESE  527

Query  402  LGHSSLYVDEAKPR  361
            LG  +L VDEAKPR
Sbjct  528  LGGYTLSVDEAKPR  541



>ref|XP_010549154.1| PREDICTED: nucleolin 1 [Tarenaya hassleriana]
Length=610

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNGQ LLGR+V+LDLA+E+GAYTP SG  +N    QS G G+ TTVFV+GF
Sbjct  399  AEAAQKALELNGQSLLGREVRLDLAREKGAYTPQSGKTNN---FQSGGRGQGTTVFVKGF  455

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D + +ED +RSAL+ HFG CGEI    +PTD E G +KG AY++  D++AM+KALELN S
Sbjct  456  DYSLSEDEVRSALKDHFGGCGEINRISVPTDRETGSVKGFAYMDVKDSEAMNKALELNGS  515

Query  405  QLGHSSLYVDEAKP  364
            ++G  +L VDEA+P
Sbjct  516  EMGGYNLTVDEAQP  529



>ref|XP_009420546.1| PREDICTED: nucleolin 2-like [Musa acuminata subsp. malaccensis]
Length=728

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EA  KALE+NGQ+L GR V+LD+A+ERGAYTP SG    +   Q    G S T+FVRGFD
Sbjct  524  EAVQKALEMNGQELFGRAVRLDVARERGAYTPQSG--RENYSYQKGSKGNSQTIFVRGFD  581

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS+LE HFGSCG++    IP D E G  KG+AY++F D DA S+ALELN S+
Sbjct  582  KSLEEDQIRSSLEEHFGSCGDVTRVSIPRDYESGASKGIAYMDFKDQDAFSQALELNGSE  641

Query  402  LGHSSLYVDEAKPRND  355
            LG  +L V+EAKPR+D
Sbjct  642  LGGYTLTVEEAKPRSD  657



>ref|XP_010909800.1| PREDICTED: nucleolin 2-like [Elaeis guineensis]
Length=686

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            +AA KALELNG +LLGR V+LD+A ERGAYTP SG   NS Q+  +G   S T+FV+GFD
Sbjct  495  DAAQKALELNGMELLGRAVRLDVAHERGAYTPYSGKESNSYQKGGKG--PSYTIFVKGFD  552

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K   ED IRS+LE HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+
Sbjct  553  KFVEEDQIRSSLEEHFGSCGEITRLSLPKDYETGAFKGMAYMDFREQDAFSKALELDGSE  612

Query  402  LGHSSLYVDEAKPRND  355
            LG  SL VDEAKPR D
Sbjct  613  LGGYSLTVDEAKPRGD  628



>ref|XP_010249944.1| PREDICTED: nucleolin 2-like isoform X3 [Nelumbo nucifera]
Length=683

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E+A KALELNGQDLLGR V+LDLA+ER +YTP SG  ++S Q+  +   +  T++VRGFD
Sbjct  483  ESAMKALELNGQDLLGRSVRLDLARERNSYTPYSGKENSSYQKGGKS--QGQTIYVRGFD  540

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS LE HFGSCGEI    IP D   G  KG+AYIEF D D+ SKALELN S+
Sbjct  541  KSGGEDQIRSTLEEHFGSCGEITRMSIPKDFDSGAPKGIAYIEFGDGDSFSKALELNGSE  600

Query  402  LGHSSLYVDEAKP  364
            LG  SL V+EA+P
Sbjct  601  LGDYSLTVEEARP  613



>ref|XP_003581679.1| PREDICTED: nucleolin 2-like [Brachypodium distachyon]
Length=741

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EA  KA ELNG DL+GR V+LDLA+ERGAYTP SG  DNSS ++      S T F+RGF
Sbjct  523  TEAVHKARELNGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPGQSS-SNTAFIRGF  580

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRS+L+ HFGSCGEI    IP D E G  KG+AY+EF+D  ++SKA EL+ S
Sbjct  581  DASLGEDQIRSSLQKHFGSCGEITRVSIPKDYETGASKGIAYMEFSDQSSLSKAFELSGS  640

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEA+P+ D
Sbjct  641  DLGGFSLYVDEARPKQD  657



>ref|XP_010249935.1| PREDICTED: nucleolin 2-like isoform X2 [Nelumbo nucifera]
Length=756

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E+A KALELNGQDLLGR V+LDLA+ER +YTP SG  ++S Q+  +   +  T++VRGFD
Sbjct  556  ESAMKALELNGQDLLGRSVRLDLARERNSYTPYSGKENSSYQKGGKS--QGQTIYVRGFD  613

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS LE HFGSCGEI    IP D   G  KG+AYIEF D D+ SKALELN S+
Sbjct  614  KSGGEDQIRSTLEEHFGSCGEITRMSIPKDFDSGAPKGIAYIEFGDGDSFSKALELNGSE  673

Query  402  LGHSSLYVDEAKP  364
            LG  SL V+EA+P
Sbjct  674  LGDYSLTVEEARP  686



>ref|XP_010249927.1| PREDICTED: nucleolin 2-like isoform X1 [Nelumbo nucifera]
Length=757

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E+A KALELNGQDLLGR V+LDLA+ER +YTP SG  ++S Q+  +   +  T++VRGFD
Sbjct  557  ESAMKALELNGQDLLGRSVRLDLARERNSYTPYSGKENSSYQKGGKS--QGQTIYVRGFD  614

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS LE HFGSCGEI    IP D   G  KG+AYIEF D D+ SKALELN S+
Sbjct  615  KSGGEDQIRSTLEEHFGSCGEITRMSIPKDFDSGAPKGIAYIEFGDGDSFSKALELNGSE  674

Query  402  LGHSSLYVDEAKP  364
            LG  SL V+EA+P
Sbjct  675  LGDYSLTVEEARP  687



>emb|CBI27136.3| unnamed protein product [Vitis vinifera]
Length=691

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (75%), Gaps = 4/134 (3%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL++NG+DLLGR V+LDLA+ERGAYTP SG   N      +GG ++ T+FVRGFD
Sbjct  499  EAAQKALKMNGKDLLGRAVRLDLARERGAYTPYSGKESN---SFQKGGSQAQTIFVRGFD  555

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++
Sbjct  556  KSGDEDQVRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTE  615

Query  402  LGHSSLYVDEAKPR  361
            LG  +L V+EAKPR
Sbjct  616  LGGYTLNVEEAKPR  629



>ref|XP_010535330.1| PREDICTED: nucleolin 1-like isoform X2 [Tarenaya hassleriana]
Length=610

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKER-GAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KAL+LNGQDLLGR+V+LDLA+ER  +YTP SG  +N          + +TVF++G
Sbjct  401  AEAAQKALQLNGQDLLGREVRLDLARERDSSYTPQSGKSNNFQSGGRG---QGSTVFIKG  457

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            FD + TED+IRSAL+ HFGSCGEI    +PTD E G IKG AY++  D++ M+KALELN 
Sbjct  458  FDYSLTEDDIRSALKEHFGSCGEITRISVPTDRETGNIKGFAYMDVKDSETMNKALELNG  517

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L VDEA+P
Sbjct  518  SEMGGYNLTVDEARP  532



>ref|XP_010535329.1| PREDICTED: nucleolin 1-like isoform X1 [Tarenaya hassleriana]
Length=611

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKER-GAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KAL+LNGQDLLGR+V+LDLA+ER  +YTP SG  +N          + +TVF++G
Sbjct  402  AEAAQKALQLNGQDLLGREVRLDLARERDSSYTPQSGKSNNFQSGGRG---QGSTVFIKG  458

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            FD + TED+IRSAL+ HFGSCGEI    +PTD E G IKG AY++  D++ M+KALELN 
Sbjct  459  FDYSLTEDDIRSALKEHFGSCGEITRISVPTDRETGNIKGFAYMDVKDSETMNKALELNG  518

Query  408  SQLGHSSLYVDEAKP  364
            S++G  +L VDEA+P
Sbjct  519  SEMGGYNLTVDEARP  533



>gb|EAZ32021.1| hypothetical protein OsJ_16200 [Oryza sativa Japonica Group]
Length=728

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL G DL+GR V+LDLA+ERGAYTP SG  DNSS ++        T+F++GF
Sbjct  520  AEAAKKALELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGF  577

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +     IR++LE HFGSCGEI    IP D E G  KGMAY++FADN ++SKA ELN S
Sbjct  578  DTSLDIHQIRNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSKAYELNGS  637

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEA+PR D
Sbjct  638  DLGGYSLYVDEARPRPD  654



>ref|NP_001053909.1| Os04g0620700 [Oryza sativa Japonica Group]
 sp|Q7XTT4.2|NUCL2_ORYSJ RecName: Full=Nucleolin 2; AltName: Full=Protein NUCLEOLIN LIKE 
2 [Oryza sativa Japonica Group]
 emb|CAD41755.2| OSJNBa0058K23.21 [Oryza sativa Japonica Group]
 dbj|BAF15823.1| Os04g0620700 [Oryza sativa Japonica Group]
 dbj|BAG96085.1| unnamed protein product [Oryza sativa Japonica Group]
Length=707

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL G DL+GR V+LDLA+ERGAYTP SG  DNSS ++        T+F++GF
Sbjct  499  AEAAKKALELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGF  556

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +     IR++LE HFGSCGEI    IP D E G  KGMAY++FADN ++SKA ELN S
Sbjct  557  DTSLDIHQIRNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSKAYELNGS  616

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEA+PR D
Sbjct  617  DLGGYSLYVDEARPRPD  633



>emb|CAH66982.1| H0714H04.9 [Oryza sativa Indica Group]
Length=704

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL G DL+GR V+LDLA+ERGAYTP SG  DNSS ++        T+F++GF
Sbjct  496  AEAAKKALELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGF  553

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +     IR++LE HFGSCGEI    IP D E G  KGMAY++FADN ++SKA ELN S
Sbjct  554  DTSLDIHQIRNSLEEHFGSCGEITRVSIPRDYETGASKGMAYMDFADNGSLSKAYELNGS  613

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEA+PR D
Sbjct  614  DLGGYSLYVDEARPRPD  630



>ref|XP_004982918.1| PREDICTED: nucleolin 2-like isoform X2 [Setaria italica]
Length=674

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALE    DL+GR V++DLA ERGAYTP SG  DNSS ++        TVF++GF
Sbjct  466  AEAAQKALEFANHDLMGRPVRVDLALERGAYTPGSGR-DNSSFKKFAPRS-GNTVFIKGF  523

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRSALEG FGSCGEI    IP D E G  KGMAY++F D D+++KA ELN S
Sbjct  524  DTSSGEDQIRSALEGLFGSCGEITRVSIPKDYETGACKGMAYMDFKDPDSLNKAYELNGS  583

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEAKPR D
Sbjct  584  DLGGYSLYVDEAKPRPD  600



>ref|XP_004982917.1| PREDICTED: nucleolin 2-like isoform X1 [Setaria italica]
Length=679

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALE    DL+GR V++DLA ERGAYTP SG  DNSS ++        TVF++GF
Sbjct  466  AEAAQKALEFANHDLMGRPVRVDLALERGAYTPGSGR-DNSSFKKFAPRS-GNTVFIKGF  523

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRSALEG FGSCGEI    IP D E G  KGMAY++F D D+++KA ELN S
Sbjct  524  DTSSGEDQIRSALEGLFGSCGEITRVSIPKDYETGACKGMAYMDFKDPDSLNKAYELNGS  583

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEAKPR D
Sbjct  584  DLGGYSLYVDEAKPRPD  600



>ref|XP_010648398.1| PREDICTED: nucleolin 2 isoform X1 [Vitis vinifera]
Length=710

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL++NG+DLLGR V+LDLA+ERGAYTP SG   N      +GG ++ T+FVRGFD
Sbjct  499  EAAQKALKMNGKDLLGRAVRLDLARERGAYTPYSGKESN---SFQKGGSQAQTIFVRGFD  555

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++
Sbjct  556  KSGDEDQVRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTE  615

Query  402  LGHSSLYVDEAKP  364
            LG  +L V+EAKP
Sbjct  616  LGGYTLNVEEAKP  628



>ref|XP_006652843.1| PREDICTED: nucleolin 2-like [Oryza brachyantha]
Length=712

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALE  G DL+GR VKLDLA+ERGAYTP  G+  ++S  +        T+F++GF
Sbjct  506  AEAAKKALEFAGHDLMGRPVKLDLARERGAYTP--GSERDNSSFKKPAQSSGNTIFIKGF  563

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D     D IR++LE HFG+CGEI    IP D + G  KGMAY++FADN A+SKA ELN S
Sbjct  564  DTTLGIDQIRTSLEEHFGTCGEITRVSIPKDYDTGASKGMAYMDFADNGALSKAFELNGS  623

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEA+PR D
Sbjct  624  DLGGYSLYVDEARPRPD  640



>ref|XP_010648403.1| PREDICTED: nucleolin 2 isoform X2 [Vitis vinifera]
Length=708

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL++NG+DLLGR V+LDLA+ERGAYTP SG   N      +GG ++ T+FVRGFD
Sbjct  497  EAAQKALKMNGKDLLGRAVRLDLARERGAYTPYSGKESN---SFQKGGSQAQTIFVRGFD  553

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++
Sbjct  554  KSGDEDQVRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTE  613

Query  402  LGHSSLYVDEAKP  364
            LG  +L V+EAKP
Sbjct  614  LGGYTLNVEEAKP  626



>ref|XP_010648407.1| PREDICTED: nucleolin 1 isoform X3 [Vitis vinifera]
Length=699

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL++NG+DLLGR V+LDLA+ERGAYTP SG   N      +GG ++ T+FVRGFD
Sbjct  488  EAAQKALKMNGKDLLGRAVRLDLARERGAYTPYSGKESN---SFQKGGSQAQTIFVRGFD  544

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++
Sbjct  545  KSGDEDQVRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTE  604

Query  402  LGHSSLYVDEAKP  364
            LG  +L V+EAKP
Sbjct  605  LGGYTLNVEEAKP  617



>ref|XP_008787580.1| PREDICTED: nucleolin 2-like isoform X4 [Phoenix dactylifera]
Length=678

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKN  574
            A KALE+NG +LLGR V+LD+A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+
Sbjct  469  AQKALEMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKS  526

Query  573  DTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLG  397
              ED IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG
Sbjct  527  PEEDQIRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELG  586

Query  396  HSSLYVDEAKPRND  355
              SL VDEAKPR D
Sbjct  587  GYSLTVDEAKPRGD  600



>ref|XP_008787581.1| PREDICTED: nucleolin 2-like isoform X5 [Phoenix dactylifera]
Length=676

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKN  574
            A KALE+NG +LLGR V+LD+A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+
Sbjct  467  AQKALEMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKS  524

Query  573  DTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLG  397
              ED IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG
Sbjct  525  PEEDQIRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELG  584

Query  396  HSSLYVDEAKPRND  355
              SL VDEAKPR D
Sbjct  585  GYSLTVDEAKPRGD  598



>ref|XP_008787578.1| PREDICTED: nucleolin 2-like isoform X2 [Phoenix dactylifera]
Length=719

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKN  574
            A KALE+NG +LLGR V+LD+A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+
Sbjct  510  AQKALEMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKS  567

Query  573  DTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLG  397
              ED IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG
Sbjct  568  PEEDQIRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELG  627

Query  396  HSSLYVDEAKPRND  355
              SL VDEAKPR D
Sbjct  628  GYSLTVDEAKPRGD  641



>ref|XP_008787577.1| PREDICTED: nucleolin 2-like isoform X1 [Phoenix dactylifera]
Length=721

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKN  574
            A KALE+NG +LLGR V+LD+A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+
Sbjct  512  AQKALEMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKS  569

Query  573  DTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLG  397
              ED IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG
Sbjct  570  PEEDQIRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELG  629

Query  396  HSSLYVDEAKPRND  355
              SL VDEAKPR D
Sbjct  630  GYSLTVDEAKPRGD  643



>ref|XP_008787579.1| PREDICTED: nucleolin 2-like isoform X3 [Phoenix dactylifera]
Length=712

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKN  574
            A KALE+NG +LLGR V+LD+A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+
Sbjct  503  AQKALEMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKS  560

Query  573  DTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLG  397
              ED IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG
Sbjct  561  PEEDQIRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELG  620

Query  396  HSSLYVDEAKPRND  355
              SL VDEAKPR D
Sbjct  621  GYSLTVDEAKPRGD  634



>ref|XP_006659905.1| PREDICTED: nucleolin 1-like, partial [Oryza brachyantha]
Length=597

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 96/139 (69%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNS----GAFDNssqrqsrggGESTTVF  595
            SE A KA+ELNGQDL+GR V+LDLA+ERGAYTP+S    G+F   ++        S ++F
Sbjct  393  SEDAKKAIELNGQDLMGRAVRLDLARERGAYTPHSRNDTGSFQKQNRGS------SQSIF  446

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  E  IR +LEGHF  CGEI    +P D E G  +GMAYI+F D  ++SKALE
Sbjct  447  VKGFDSSLEESKIRESLEGHFAECGEITRVSVPMDRETGACRGMAYIDFKDQASLSKALE  506

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYVDEA+PR
Sbjct  507  LSGSDLGGYNLYVDEARPR  525



>ref|XP_007043310.1| Nucleolin like 2 isoform 4, partial [Theobroma cacao]
 gb|EOX99141.1| Nucleolin like 2 isoform 4, partial [Theobroma cacao]
Length=487

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP SG  +NS Q+  R   ++ T+FV+GF
Sbjct  282  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGF  339

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++  ED IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S
Sbjct  340  DQSLGEDEIRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGS  399

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  400  ELSNYSLSVDEAKPRGE  416



>ref|XP_007222208.1| hypothetical protein PRUPE_ppa007807mg [Prunus persica]
 gb|EMJ23407.1| hypothetical protein PRUPE_ppa007807mg [Prunus persica]
Length=355

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 93/135 (69%), Gaps = 4/135 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            SEAA KALELNG +LLGR V+LDLA+ERGAYTP SG   NS Q+  +G    +T+F+RGF
Sbjct  144  SEAAQKALELNGVELLGRGVRLDLARERGAYTPQSGKEGNSYQKGGQG---QSTIFIRGF  200

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYI-KGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRS+L+  FG CGEI    IP D E    KGMAY+EF D D+  KAL+LN S
Sbjct  201  DTSQGEDEIRSSLQEFFGGCGEITRLSIPKDYETQAPKGMAYLEFQDGDSFKKALQLNQS  260

Query  405  QLGHSSLYVDEAKPR  361
              G+  L V EAKPR
Sbjct  261  DFGNGPLTVQEAKPR  275



>ref|XP_004972658.1| PREDICTED: nucleolin 1-like [Setaria italica]
Length=567

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KA E ++G+++ GR V+LD A+ER AYTP SG  +++   Q    G S++VF+RG
Sbjct  352  AEAAKKACEEMSGKEMQGRAVRLDFAQERNAYTPRSG--NDTGSFQKPVRGASSSVFIRG  409

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            FDKN  ED IRS+LE HFG CGEI    IPTD E G +KG+AY++F D D+MSKALEL+ 
Sbjct  410  FDKNLEEDKIRSSLEQHFGECGEITRVSIPTDYETGAVKGIAYLDFKDQDSMSKALELSG  469

Query  408  SQLGHSSLYVDEAKPR  361
            S +G   L+VDEAKP+
Sbjct  470  SDIGGYELFVDEAKPK  485



>ref|XP_007043309.1| Nucleolin like 2 isoform 3 [Theobroma cacao]
 gb|EOX99140.1| Nucleolin like 2 isoform 3 [Theobroma cacao]
Length=698

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP SG  +NS Q+  R   ++ T+FV+GF
Sbjct  493  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGF  550

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++  ED IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S
Sbjct  551  DQSLGEDEIRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGS  610

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  611  ELSNYSLSVDEAKPRGE  627



>ref|XP_007043308.1| Nucleolin like 2 isoform 2 [Theobroma cacao]
 gb|EOX99139.1| Nucleolin like 2 isoform 2 [Theobroma cacao]
Length=697

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP SG  +NS Q+  R   ++ T+FV+GF
Sbjct  492  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGF  549

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++  ED IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S
Sbjct  550  DQSLGEDEIRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGS  609

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  610  ELSNYSLSVDEAKPRGE  626



>ref|XP_007043307.1| Nucleolin like 2 isoform 1 [Theobroma cacao]
 gb|EOX99138.1| Nucleolin like 2 isoform 1 [Theobroma cacao]
Length=726

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP SG  +NS Q+  R   ++ T+FV+GF
Sbjct  521  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGF  578

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++  ED IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S
Sbjct  579  DQSLGEDEIRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGS  638

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  639  ELSNYSLSVDEAKPRGE  655



>ref|XP_002467108.1| hypothetical protein SORBIDRAFT_01g019710 [Sorghum bicolor]
 gb|EER94106.1| hypothetical protein SORBIDRAFT_01g019710 [Sorghum bicolor]
Length=664

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALE  G+DL+GR +++DLA ERGAYTPNSG  DN S R+S       TVF++GF
Sbjct  463  AEAAQKALEFGGRDLMGRSLRIDLAVERGAYTPNSGK-DNGSFRKSAQRS-GNTVFIKGF  520

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRSALE HF SCG+I    IP D + G  KGMAY++F D D+++KA E+N +
Sbjct  521  DTSVGEDQIRSALEEHFRSCGDITRISIPKDYDTGASKGMAYMDFKDPDSLNKAYEMNGT  580

Query  405  QLGHSSLYVDEAKPRND  355
             LG  SLYVDEAKPR D
Sbjct  581  YLGDYSLYVDEAKPRPD  597



>gb|KJB79877.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=860

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG+ +N    Q  G G++ T++VRGF
Sbjct  652  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGSGNN--SFQKGGRGQARTIYVRGF  709

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  710  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  769

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  770  ELNNYSLTVDEAKPRGE  786



>gb|KJB79879.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=859

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG+ +N    Q  G G++ T++VRGF
Sbjct  651  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGSGNN--SFQKGGRGQARTIYVRGF  708

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  709  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  768

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  769  ELNNYSLTVDEAKPRGE  785



>gb|KJB79874.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=900

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG+ +N    Q  G G++ T++VRGF
Sbjct  692  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGSGNN--SFQKGGRGQARTIYVRGF  749

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  750  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  809

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  810  ELNNYSLTVDEAKPRGE  826



>gb|KJB79880.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=860

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG+ +N    Q  G G++ T++VRGF
Sbjct  652  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGSGNN--SFQKGGRGQARTIYVRGF  709

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  710  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  769

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  770  ELNNYSLTVDEAKPRGE  786



>gb|KJB79881.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=901

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG+ +N    Q  G G++ T++VRGF
Sbjct  693  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGSGNN--SFQKGGRGQARTIYVRGF  750

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  751  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  810

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  811  ELNNYSLTVDEAKPRGE  827



>gb|EPS65245.1| tobacco nucleolin, partial [Genlisea aurea]
Length=494

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 8/133 (6%)
 Frame = -2

Query  759  EAAAKAL-ELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +AA KAL ELNG+DLLGR+V+LDLAKERG YTP SG         S       T FVRGF
Sbjct  307  DAAQKALKELNGKDLLGREVRLDLAKERGQYTPQSG-------DASSFQKGGKTAFVRGF  359

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQ  403
            D N+ E  I+ +LE HF SCGE+    +P D EG  KGMAYI+F D DA+ KALE+N S 
Sbjct  360  DINNDEAQIKGSLEEHFTSCGEVTRISLPKDQEGNFKGMAYIDFKDGDALEKALEMNGSD  419

Query  402  LGHSSLYVDEAKP  364
             G++SL V+EA+P
Sbjct  420  FGNASLMVEEARP  432



>dbj|BAJ99185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=724

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA ELNG DL GR V+LD A+ERGA TP SG  DNSS ++S    +S T FVRGF
Sbjct  515  TEAAQKAYELNGHDLSGRPVRLDFARERGAITPGSGR-DNSSFKKSG---QSNTAFVRGF  570

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRS+L+ HF SCG I    IP D E G  KG+AY+EF D +++ KALELN S
Sbjct  571  DSSLGEDEIRSSLQEHFSSCGAIGRVSIPKDYETGTSKGIAYVEFTDGNSLPKALELNGS  630

Query  405  QLGHSSLYVDEAKPRND  355
             +G  SL+VDEAKPR D
Sbjct  631  NIGEFSLFVDEAKPRAD  647



>ref|XP_010094074.1| hypothetical protein L484_018090 [Morus notabilis]
 gb|EXB55164.1| hypothetical protein L484_018090 [Morus notabilis]
Length=654

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG++  GR VKLD A+ERGAYTP SG  D+ +  Q+RG  +  T+FVRG 
Sbjct  464  AEAAKKALELNGKEFRGRAVKLDFARERGAYTPYSGGKDDRNSFQNRGRDQVKTIFVRGL  523

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IRS+L+ HFGSCGEI    +P D + G IKG+AY++F D  + +KALELN  
Sbjct  524  DKSIGEDEIRSSLQEHFGSCGEISRISVPRDYDTGSIKGLAYLDFNDTGSFNKALELNGV  583

Query  405  QLGHSSLYVDEAKPR  361
            +L ++ L V+EAKPR
Sbjct  584  ELDNNYLTVEEAKPR  598



>ref|XP_010910016.1| PREDICTED: nucleolin 2-like [Elaeis guineensis]
Length=848

 Score =   140 bits (352),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            +AA KALELNG +LLGR V+LD+A ERG YTP SG   NS Q+  +G   S T+FV+GFD
Sbjct  649  DAAQKALELNGMELLGRAVRLDVAHERGVYTPYSGKEGNSYQKGGKGL--SYTIFVKGFD  706

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  ED IRS+LE HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+
Sbjct  707  KSVEEDQIRSSLEEHFGSCGEITRLSLPKDYETGAFKGMAYMDFREQDAFSKALELDGSE  766

Query  402  LGHSSLYVDEAKPRND  355
            LG  SL V+EAKPR D
Sbjct  767  LGGYSLTVNEAKPRGD  782



>gb|KHG18558.1| Nucleolin [Gossypium arboreum]
Length=902

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG  +NS Q+  RG  ++ T++VRGF
Sbjct  694  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGNGNNSFQKGGRG--QTRTIYVRGF  751

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            +++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F D D+ +KALELN S
Sbjct  752  NQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYLRGYAYLDFNDGDSFNKALELNGS  811

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  812  ELNNYSLTVDEAKPRGE  828



>ref|XP_008221051.1| PREDICTED: nucleolin 1 isoform X2 [Prunus mume]
Length=637

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            SEAA KALEL+G +LLGR V+LDLA+ERG+YTP+SG   NS Q+  +G    +T+F+RGF
Sbjct  426  SEAAQKALELHGVELLGRGVRLDLARERGSYTPHSGKEGNSYQKGGQG---QSTIFIRGF  482

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYI-KGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRS+L+  FG CGEI    IP D E    KGMAY+EF D D+  KAL+LN +
Sbjct  483  DTSQGEDEIRSSLQEFFGGCGEITRLSIPKDYETQAPKGMAYLEFQDGDSFKKALQLNQA  542

Query  405  QLGHSSLYVDEAKPRND  355
              G  +L V EAKPR D
Sbjct  543  NFGKCTLTVQEAKPRAD  559



>gb|AAA74208.1| protein localized in the nucleoli of pea nuclei; ORF; putative 
[Pisum sativum]
Length=611

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 94/135 (70%), Gaps = 7/135 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALELNGQ+LL R V+LDLA+ERGA+TPNS    N       G G+S TVFVRGF
Sbjct  405  AEAAQSALELNGQELLQRGVRLDLARERGAFTPNSTGNQN------SGRGQSQTVFVRGF  458

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED IR+ LE HF SCG+     IP D + GY KG AY++F D+D+ +KA+EL+ S
Sbjct  459  DKSLGEDEIRAKLEQHFASCGQASRVSIPKDYDTGYSKGFAYMDFKDSDSFNKAIELHGS  518

Query  405  QLGHSSLYVDEAKPR  361
            +L    L +DEAKPR
Sbjct  519  ELDGYPLSIDEAKPR  533


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R+ +D +G  KG  ++EFA  +A   ALELN  +L    + +D
Sbjct  368  RSDIESFFQECGEVVDVRLASDEDGRFKGFGHVEFATAEAAQSALELNGQELLQRGVRLD  427

Query  375  EAKPR  361
             A+ R
Sbjct  428  LARER  432



>gb|KJB79878.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=858

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG  ++  +       ++ T++VRGF
Sbjct  651  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGGNNSFQKGGRG---QARTIYVRGF  707

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  708  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  767

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  768  ELNNYSLTVDEAKPRGE  784



>gb|KJB79875.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=899

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG  ++  +       ++ T++VRGF
Sbjct  692  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGGNNSFQKGGRG---QARTIYVRGF  748

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  749  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  808

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  809  ELNNYSLTVDEAKPRGE  825



>ref|XP_008221050.1| PREDICTED: nucleolin 2 isoform X1 [Prunus mume]
Length=669

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            SEAA KALEL+G +LLGR V+LDLA+ERG+YTP+SG   NS Q+  +G    +T+F+RGF
Sbjct  458  SEAAQKALELHGVELLGRGVRLDLARERGSYTPHSGKEGNSYQKGGQG---QSTIFIRGF  514

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYI-KGMAYIEFADNDAMSKALELNNS  406
            D +  ED IRS+L+  FG CGEI    IP D E    KGMAY+EF D D+  KAL+LN +
Sbjct  515  DTSQGEDEIRSSLQEFFGGCGEITRLSIPKDYETQAPKGMAYLEFQDGDSFKKALQLNQA  574

Query  405  QLGHSSLYVDEAKPRND  355
              G  +L V EAKPR D
Sbjct  575  NFGKCTLTVQEAKPRAD  591



>gb|KHG07971.1| Protein gar2 [Gossypium arboreum]
Length=639

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R V+LDLA+ERGAYTP SG  +N    Q  G G+S T+FV+G 
Sbjct  428  AEAAQKALELNGEYLMNRAVRLDLARERGAYTPYSGNGNN--SFQKGGKGQSRTIFVKGL  485

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IR++L+ HFGSCGEI    IPTD + G +KG AY++F D  +++KALEL+ S
Sbjct  486  DASLDEDTIRNSLQEHFGSCGEISRVAIPTDRDSGAVKGFAYLDFKDEGSLNKALELDGS  545

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKP+ D
Sbjct  546  KLNNQSLSVDEAKPKGD  562



>gb|KJB79876.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=859

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG  ++  +       ++ T++VRGF
Sbjct  652  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGGNNSFQKGGRG---QARTIYVRGF  708

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  709  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  768

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  769  ELNNYSLTVDEAKPRGE  785



>gb|KJB12389.1| hypothetical protein B456_002G015800 [Gossypium raimondii]
Length=639

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R V+LDLA+ERGAYTP SG  +N    Q  G G+S T+FV+G 
Sbjct  428  AEAAQKALELNGEYLMNRAVRLDLARERGAYTPYSGNGNN--SFQKGGKGQSRTIFVKGL  485

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IR++L+ HFGSCGEI    IPTD + G +KG AY++F D  +++KALEL+ S
Sbjct  486  DASLDEDTIRNSLQEHFGSCGEISRVAIPTDRDSGAVKGFAYLDFKDEGSLNKALELDGS  545

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKP+ D
Sbjct  546  KLNNQSLSVDEAKPKGD  562



>gb|EMT18300.1| Protein gar2 [Aegilops tauschii]
Length=688

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 6/138 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA ELNG DL GR V+LD A+ERGA TP SG  DNSS ++     +S T FVRGF
Sbjct  514  TEAAQKAYELNGGDLAGRPVRLDFARERGAITPGSG-RDNSSFKKPG---QSNTAFVRGF  569

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  E+ IRS+L+GHF SCG+I+   IP D + G  KG+AYIEF D  ++ KALELN S
Sbjct  570  DSSLGEEEIRSSLQGHFSSCGDIRRVSIPKDYDTGASKGIAYIEFDDISSLPKALELNGS  629

Query  405  QLGHS-SLYVDEAKPRND  355
             +G   SL+VDEAKPR D
Sbjct  630  NIGEGLSLFVDEAKPRAD  647



>gb|KEH30578.1| RNA recognition motif [Medicago truncatula]
Length=588

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALE+NGQ+LL R V+LDLA+ERGA+TPN+   +++   QS G G+S TVFVRGF
Sbjct  379  AEAAQSALEMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGF  435

Query  582  DKNDTEDNIRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            DKN  ED IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ 
Sbjct  436  DKNLGEDEIRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHE  495

Query  408  SQLGHSSLYVDEAKPRN  358
            S+L    L VDEAKPR+
Sbjct  496  SELDGYQLSVDEAKPRD  512


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D
Sbjct  342  RSDIEKFFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLD  401

Query  375  EAKPR  361
             A+ R
Sbjct  402  LARER  406



>gb|KEH30577.1| RNA recognition motif [Medicago truncatula]
Length=600

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALE+NGQ+LL R V+LDLA+ERGA+TPN+   +++   QS G G+S TVFVRGF
Sbjct  391  AEAAQSALEMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGF  447

Query  582  DKNDTEDNIRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            DKN  ED IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ 
Sbjct  448  DKNLGEDEIRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHE  507

Query  408  SQLGHSSLYVDEAKPRN  358
            S+L    L VDEAKPR+
Sbjct  508  SELDGYQLSVDEAKPRD  524


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D
Sbjct  354  RSDIEKFFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLD  413

Query  375  EAKPR  361
             A+ R
Sbjct  414  LARER  418



>ref|XP_003607240.1| RNA-binding protein [Medicago truncatula]
 gb|AES89437.1| RNA recognition motif [Medicago truncatula]
Length=623

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALE+NGQ+LL R V+LDLA+ERGA+TPN+   +++   QS G G+S TVFVRGF
Sbjct  414  AEAAQSALEMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGF  470

Query  582  DKNDTEDNIRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            DKN  ED IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ 
Sbjct  471  DKNLGEDEIRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHE  530

Query  408  SQLGHSSLYVDEAKPRN  358
            S+L    L VDEAKPR+
Sbjct  531  SELDGYQLSVDEAKPRD  547


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D
Sbjct  377  RSDIEKFFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLD  436

Query  375  EAKPR  361
             A+ R
Sbjct  437  LARER  441



>ref|XP_003607239.1| RNA-binding protein [Medicago truncatula]
 gb|AES89436.1| RNA recognition motif [Medicago truncatula]
Length=635

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALE+NGQ+LL R V+LDLA+ERGA+TPN+   +++   QS G G+S TVFVRGF
Sbjct  426  AEAAQSALEMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGF  482

Query  582  DKNDTEDNIRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            DKN  ED IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ 
Sbjct  483  DKNLGEDEIRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHE  542

Query  408  SQLGHSSLYVDEAKPRN  358
            S+L    L VDEAKPR+
Sbjct  543  SELDGYQLSVDEAKPRD  559


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D
Sbjct  389  RSDIEKFFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLD  448

Query  375  EAKPR  361
             A+ R
Sbjct  449  LARER  453



>ref|XP_010688710.1| PREDICTED: nucleolin 1 [Beta vulgaris subsp. vulgaris]
Length=599

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KALELNGQDLL R V+LDLA+ERGAYTPN+      +    +GGG+ T++FVRGFD
Sbjct  392  EAAKKALELNGQDLLNRAVRLDLARERGAYTPNT----RENNSFQKGGGQGTSLFVRGFD  447

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K   ED  RS L+  FG CGEI    IP D E   +KGMA+I+F+D++ ++KA+ELN S+
Sbjct  448  KYGDEDETRSGLQELFGPCGEITRISIPPDRENNCLKGMAFIDFSDSNGLNKAIELNGSE  507

Query  402  LGHSSLYVDEAKPR  361
             G S L V+E+KPR
Sbjct  508  FGGSYLTVNESKPR  521



>ref|XP_003607231.1| 28 kDa ribonucleoprotein [Medicago truncatula]
Length=643

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALE+NGQ+LL R V+LDLA+ERGA+TPN+   +++   QS G G+S TVFVRGF
Sbjct  434  AEAAQSALEMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGF  490

Query  582  DKNDTEDNIRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            DKN  ED IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ 
Sbjct  491  DKNLGEDEIRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHE  550

Query  408  SQLGHSSLYVDEAKPRN  358
            S+L    L VDEAKPR+
Sbjct  551  SELDGYQLSVDEAKPRD  567


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D
Sbjct  397  RSDIEKFFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLD  456

Query  375  EAKPR  361
             A+ R
Sbjct  457  LARER  461



>ref|XP_011463448.1| PREDICTED: nucleolin 1 isoform X8 [Fragaria vesca subsp. vesca]
Length=567

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  363  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  420

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  421  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  480

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  481  DNSDLGNGCYLSVQPAKPRGD  501



>ref|XP_011463446.1| PREDICTED: nucleolin 1 isoform X6 [Fragaria vesca subsp. vesca]
Length=587

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  383  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  440

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  441  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  500

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  501  DNSDLGNGCYLSVQPAKPRGD  521



>ref|XP_011463445.1| PREDICTED: nucleolin 1 isoform X5 [Fragaria vesca subsp. vesca]
Length=591

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  398  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  455

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  456  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  515

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  516  DNSDLGNGCYLSVQPAKPRGD  536



>ref|XP_004297745.1| PREDICTED: nucleolin 1 isoform X2 [Fragaria vesca subsp. vesca]
Length=601

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  397  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  454

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  455  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  514

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  515  DNSDLGNGCYLSVQPAKPRGD  535



>ref|XP_011463447.1| PREDICTED: nucleolin 1 isoform X7 [Fragaria vesca subsp. vesca]
Length=583

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  379  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  436

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  437  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  496

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  497  DNSDLGNGCYLSVQPAKPRGD  517



>ref|XP_011463442.1| PREDICTED: nucleolin 1 isoform X1 [Fragaria vesca subsp. vesca]
Length=602

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  398  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  455

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  456  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  515

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  516  DNSDLGNGCYLSVQPAKPRGD  536



>ref|XP_011463444.1| PREDICTED: nucleolin 1 isoform X4 [Fragaria vesca subsp. vesca]
Length=597

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  393  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  450

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  451  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  510

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  511  DNSDLGNGCYLSVQPAKPRGD  531



>ref|XP_011463443.1| PREDICTED: nucleolin 1 isoform X3 [Fragaria vesca subsp. vesca]
Length=598

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KA+ LNG DL GR ++LDLA+ERG   AYTP+SG   NS QR  +G  +S T+FV
Sbjct  394  AEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFV  451

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD    ED IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE 
Sbjct  452  RGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEF  511

Query  414  NNSQLGHSS-LYVDEAKPRND  355
            +NS LG+   L V  AKPR D
Sbjct  512  DNSDLGNGCYLSVQPAKPRGD  532



>gb|KHN32280.1| RNA-binding protein 34 [Glycine soja]
Length=735

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  AL LNGQ L  R+++LDLA+ERGAYTPNS     ++  Q    G+S T+FVRGF
Sbjct  529  AEAAQNALGLNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSERGQSQTIFVRGF  586

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IR +L+ HFGSCG+I    IP D E G +KG AY++F D D+M KALEL+ +
Sbjct  587  DTSLGEDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFGDADSMGKALELHET  646

Query  405  QLGHSSLYVDEAKPRND  355
            +LG  +L VDEAKPR++
Sbjct  647  ELGGYTLTVDEAKPRDN  663



>ref|XP_003537777.1| PREDICTED: nucleolin 2-like [Glycine max]
Length=748

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  AL LNGQ L  R+++LDLA+ERGAYTPNS     ++  Q    G+S T+FVRGF
Sbjct  529  AEAAQNALGLNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSERGQSQTIFVRGF  586

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED IR +L+ HFGSCG+I    IP D E G +KG AY++F D D+M KALEL+ +
Sbjct  587  DTSLGEDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFGDADSMGKALELHET  646

Query  405  QLGHSSLYVDEAKPRND  355
            +LG  +L VDEAKPR++
Sbjct  647  ELGGYTLTVDEAKPRDN  663



>gb|KJB79882.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=930

 Score =   135 bits (339),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R ++LDLA+ERGAYTP+SG+ +N    Q  G G++ T++VRGF
Sbjct  722  AEAAQKALELNGEYLMNRSLRLDLARERGAYTPSSGSGNN--SFQKGGRGQARTIYVRGF  779

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D++ ++D  + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S
Sbjct  780  DQSLSQDEAKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGS  839

Query  405  QLGHSSLYVDEAKPRND  355
            +L + SL VDEAKPR +
Sbjct  840  ELNNYSLTVDEAKPRGE  856



>ref|NP_001061178.1| Os08g0192900 [Oryza sativa Japonica Group]
 sp|Q6Z1C0.1|NUCL1_ORYSJ RecName: Full=Nucleolin 1; AltName: Full=Protein NUCLEOLIN LIKE 
1 [Oryza sativa Japonica Group]
 dbj|BAD05605.1| putative nucleolin [Oryza sativa Japonica Group]
 gb|AAU01907.1| putative nucleolin [Oryza sativa Indica Group]
 dbj|BAF23092.1| Os08g0192900 [Oryza sativa Japonica Group]
 gb|EAZ41784.1| hypothetical protein OsJ_26324 [Oryza sativa Japonica Group]
Length=572

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 92/139 (66%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNS----GAFDNssqrqsrggGESTTVF  595
            SE A KALEL+G DL GR V+LDLA ERGAYTP+S    G+F   ++        S ++F
Sbjct  361  SEEAKKALELHGCDLDGRPVRLDLAHERGAYTPHSRNDTGSFQKQNRGS------SQSIF  414

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  E  IR +LEGHF  CGEI    +P D E G  KG+AYI+F D  + SKALE
Sbjct  415  VKGFDSSLEESKIRESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFSKALE  474

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYVDEAKP+
Sbjct  475  LSGSDLGGYNLYVDEAKPK  493



>gb|EAZ05877.1| hypothetical protein OsI_28114 [Oryza sativa Indica Group]
Length=572

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 92/139 (66%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNS----GAFDNssqrqsrggGESTTVF  595
            SE A KALEL+G DL GR V+LDLA ERGAYTP+S    G+F   ++        S ++F
Sbjct  361  SEEAKKALELHGCDLDGRPVRLDLAHERGAYTPHSRNDTGSFQKQNRGS------SQSIF  414

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  E  IR +LEGHF  CGEI    +P D E G  KG+AYI+F D  + SKALE
Sbjct  415  VKGFDSSLEESKIRESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFSKALE  474

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYVDEAKP+
Sbjct  475  LSGSDLGGYNLYVDEAKPK  493



>emb|CAA61298.1| nuM1 [Medicago sativa]
Length=635

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA  ALE+NGQ+LL R ++LDLA+ERGA+TPN+   +++   QS G G+S TVFVRGF
Sbjct  426  AEAAQSALEMNGQELLHRALRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGF  482

Query  582  DKNDTEDNIRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            DKN  ED IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ 
Sbjct  483  DKNLGEDEIRAKLMEHFGGTCGEPTRVSIPKDYESGYSKGFAYMDFKDSDSFSKALELHE  542

Query  408  SQLGHSSLYVDEAKPRN  358
            S+L    L VDEAKPR+
Sbjct  543  SELDGYQLSVDEAKPRD  559


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = -2

Query  711  RDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  532
            +DV++  A + G   PN+ A  N +         S T+FV     N + D  RS +E  F
Sbjct  348  KDVEMVDAGKSGKKAPNTPATPNETSG-------SKTLFVG----NLSFDVKRSDIENFF  396

Query  531  GSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  361
              C E+   R+ +D +G  KG  ++EFA  +A   ALE+N  +L H +L +D A+ R
Sbjct  397  QGCVEVVDVRLASDGDGVFKGFGHVEFATAEAAQSALEMNGQELLHRALRLDLARER  453



>gb|KDP43309.1| hypothetical protein JCGZ_24230 [Jatropha curcas]
Length=743

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            A  AL+LNGQ L GR+V+LDLA+ERG    YTP SG  +NSSQ+  RG  +  T+FVRGF
Sbjct  533  AQNALKLNGQALNGREVRLDLARERGERAPYTPYSGKENNSSQKGGRG--QGQTIFVRGF  590

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK   E+ IRS+LE HF  CGEI    IPTD E G IKGMAY+EF D++A +KALEL+ S
Sbjct  591  DKFLGENEIRSSLEEHFQDCGEITRLSIPTDYESGAIKGMAYLEFKDSEAFNKALELSGS  650

Query  405  QLGHSSLYVDEAKPR  361
            QLG   L V+EAKPR
Sbjct  651  QLGDQYLTVEEAKPR  665



>ref|XP_008350969.1| PREDICTED: nucleolin 2-like [Malus domestica]
Length=268

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 7/140 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAK---ERGAYTPNSGAFDNssqrqsrggGESTTVFV  592
            +EAA KALELNG DLLGRD++LDLA+   ERGAYTP +G   NS Q+  R    S T+FV
Sbjct  67   AEAARKALELNGLDLLGRDIRLDLARERGERGAYTP-TGRESNSYQKGPRSA--SKTIFV  123

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD++  ED IRS+L+  F SCGEI    IP D E G  KGMAY++F+D  + +KALE 
Sbjct  124  RGFDRSLGEDEIRSSLQEAFSSCGEITRVSIPKDYETGASKGMAYMDFSDATSFNKALEF  183

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N  + G   L V+EAKP+ D
Sbjct  184  NGHEFGDGYLQVEEAKPKGD  203



>ref|XP_006592048.1| PREDICTED: nucleolin 2-like isoform X3 [Glycine max]
Length=585

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = -2

Query  741  LELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  562
            L LNGQ L  R+++LDLA+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED
Sbjct  372  LGLNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGED  429

Query  561  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  385
             IR +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L
Sbjct  430  EIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTL  489

Query  384  YVDEAKPRND  355
             VDEAKPR++
Sbjct  490  TVDEAKPRDN  499



>ref|XP_006592047.1| PREDICTED: nucleolin 2-like isoform X2 [Glycine max]
Length=666

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = -2

Query  741  LELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  562
            L LNGQ L  R+++LDLA+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED
Sbjct  453  LGLNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGED  510

Query  561  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  385
             IR +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L
Sbjct  511  EIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTL  570

Query  384  YVDEAKPRND  355
             VDEAKPR++
Sbjct  571  TVDEAKPRDN  580



>ref|XP_003540672.1| PREDICTED: nucleolin 2-like isoform X1 [Glycine max]
Length=744

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = -2

Query  741  LELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  562
            L LNGQ L  R+++LDLA+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED
Sbjct  531  LGLNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGED  588

Query  561  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  385
             IR +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L
Sbjct  589  EIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTL  648

Query  384  YVDEAKPRND  355
             VDEAKPR++
Sbjct  649  TVDEAKPRDN  658



>gb|KHN05443.1| Protein gar2 [Glycine soja]
Length=790

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = -2

Query  741  LELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  562
            L LNGQ L  R+++LDLA+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED
Sbjct  531  LGLNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGED  588

Query  561  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  385
             IR +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L
Sbjct  589  EIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTL  648

Query  384  YVDEAKPRND  355
             VDEAKPR++
Sbjct  649  TVDEAKPRDN  658



>ref|XP_002527136.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF35238.1| nucleic acid binding protein, putative [Ricinus communis]
Length=642

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 96/140 (69%), Gaps = 8/140 (6%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVR  589
            EAA +AL+LNGQ L GR+V+LDLA+ERG    YTP SG  DNS Q+  R   ++  +FVR
Sbjct  438  EAAHEALKLNGQSLNGREVRLDLARERGERAPYTPYSGK-DNSFQKGGRS--QTQKIFVR  494

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFDK   ED IR++L  HF +CGEI    +PTD E G IKGMAY+EF D    +KALE N
Sbjct  495  GFDKFLGEDEIRNSLGEHFKTCGEITRISLPTDYETGAIKGMAYVEFQDATGFNKALEFN  554

Query  411  NSQLGHSSLYVDEAK-PRND  355
             SQLG   L V+EAK PRND
Sbjct  555  GSQLGDQYLTVEEAKPPRND  574



>ref|XP_008360013.1| PREDICTED: nucleolin 2-like [Malus domestica]
Length=626

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAK---ERGAYTPNSGAFDNssqrqsrggGESTTVFV  592
            +EAA KALELNG DLLGRD++LDLA+   ERGAYTP +G   NS Q+  RG   S T+FV
Sbjct  463  AEAAKKALELNGLDLLGRDIRLDLARERGERGAYTP-TGRESNSYQKGPRGA--SKTIFV  519

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD++  ED IRS+L+  F SCGEI    IP D E G  KGMAY++F+D  + +KALE 
Sbjct  520  RGFDRSLGEDEIRSSLQEAFSSCGEITRVSIPKDYETGASKGMAYMDFSDATSFNKALEF  579

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N  + G   L V+EAKP+ D
Sbjct  580  NGHEFGDXYLQVEEAKPKGD  599



>ref|XP_008389084.1| PREDICTED: nucleolin 2-like [Malus domestica]
Length=664

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 7/140 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAK---ERGAYTPNSGAFDNssqrqsrggGESTTVFV  592
            +EAA KALELNG DLLGRD++LDLA+   ERGAYTP +G   NS Q+  R    S T+FV
Sbjct  463  AEAAXKALELNGLDLLGRDIRLDLARERGERGAYTP-TGRESNSYQKGPRXA--SKTIFV  519

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD++  ED IRS+L+  F SCGEI    IP D E G  KGMAY++F+D  + +KALE 
Sbjct  520  RGFDRSLGEDEIRSSLQEAFSSCGEITRVSIPKDYETGASKGMAYMDFSDATSFNKALEF  579

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N  + G   L V+EAKP+ D
Sbjct  580  NGHEFGDGYLQVEEAKPKGD  599



>ref|XP_008340448.1| PREDICTED: nucleolin 1-like [Malus domestica]
Length=450

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALE NG +LLGRDV+LDLA+ERG   AYTP +G+  NS Q+  RG   S T+F+
Sbjct  259  AEEAKKALEFNGSELLGRDVRLDLARERGEKGAYTP-TGSESNSHQKGPRGA--SKTIFI  315

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD +  ED IRS+L+  F SCGEI    IP D E G  KGMAY++F D D+ +KAL L
Sbjct  316  RGFDSSLGEDEIRSSLQEVFSSCGEITRVSIPKDYETGASKGMAYMDFTDADSFTKALGL  375

Query  414  NNSQLGHSSLYVDEAKPRND  355
            + S+ G S L V+EAKP+ D
Sbjct  376  DGSEFGDSYLKVEEAKPKGD  395



>ref|XP_009351719.1| PREDICTED: nucleolin 1 [Pyrus x bretschneideri]
Length=456

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALE NG +LLGRDVKLDLA+ERG   AYTP +G+  NS Q+  RG   S T+F+
Sbjct  263  AEEAKKALEFNGLELLGRDVKLDLARERGEKGAYTP-TGSESNSYQKGPRGA--SKTIFI  319

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD +  ED IRS+L+  F SCGEI    IP D E G  KGMAY++F D D+ +KAL L
Sbjct  320  RGFDSSLGEDEIRSSLQEVFSSCGEITRVSIPKDYETGASKGMAYMDFTDADSFNKALGL  379

Query  414  NNSQLGHSSLYVDEAKPRND  355
            + S+ G S L V+EAKP+ D
Sbjct  380  DGSEFGDSYLKVEEAKPKGD  399



>ref|XP_006836341.1| hypothetical protein AMTR_s00092p00090110 [Amborella trichopoda]
 gb|ERM99194.1| hypothetical protein AMTR_s00092p00090110 [Amborella trichopoda]
Length=662

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 9/136 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL+LNG+DLLGR V+LD+A ERG  TP +G  +NS Q+   G G  +T++V+GFD
Sbjct  454  EAAQKALKLNGKDLLGRPVRLDVAGERGPRTPGTG--ENSFQKTKGGYGGGSTIYVKGFD  511

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGY----IKGMAYIEFADNDAMSKALELN  412
            K+   D IRS+LE HFG CGEI    IP D   Y     KG+AY++F+D++A+SKALELN
Sbjct  512  KSQDFDQIRSSLEEHFGQCGEITRLAIPKD---YDLDAPKGIAYMDFSDSNALSKALELN  568

Query  411  NSQLGHSSLYVDEAKP  364
             S LG  SL V+EA P
Sbjct  569  GSDLGGYSLTVEEAMP  584



>tpg|DAA49685.1| TPA: putative nucleolin-like family protein [Zea mays]
Length=196

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = -2

Query  717  LGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEG  538
            +GR +++D+A ERGAYTP+SG   ++   +        TVF++GFD +  ED IR+ALE 
Sbjct  1    MGRPLRIDMATERGAYTPSSGK--DNGSFKKFAPRSGNTVFIKGFDTSGGEDQIRTALEE  58

Query  537  HFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  361
            HFGSCG+I    IP D + G  KGMAY++F D D+++KA ELN + LG  SLYVDEAKPR
Sbjct  59   HFGSCGDITRISIPKDYDTGVSKGMAYMDFKDPDSLNKAYELNGTDLGGYSLYVDEAKPR  118

Query  360  ND  355
             D
Sbjct  119  PD  120



>ref|XP_011070700.1| PREDICTED: nucleolin 2-like [Sesamum indicum]
Length=770

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 16/134 (12%)
 Frame = -2

Query  762  SEAAAKAL-ELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KAL ELNG+DLLGR V+L      G  TP+   F    +       +  T+FVRG
Sbjct  583  AEAAEKALRELNGEDLLGRAVRL------GKDTPS---FQRGGRT------QGQTIFVRG  627

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  406
            F+K D ED IRS+LE HFGSCGEI    IPTD +G +KGMAYIEF +++A ++ALELN S
Sbjct  628  FNKYDGEDQIRSSLEEHFGSCGEIARVSIPTDQDGGVKGMAYIEFKESNAFNQALELNGS  687

Query  405  QLGHSSLYVDEAKP  364
            + G  +L VDEAKP
Sbjct  688  EFGDGTLQVDEAKP  701



>emb|CDP16867.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKAL-ELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KA+ ELNGQDLLGR +K+D+A+ERG+ TP SG   + S  Q   G +  T+FVRG
Sbjct  509  AEAAQKAVNELNGQDLLGRTLKVDIARERGSNTPQSG--KDRSSFQKGFGSQGPTIFVRG  566

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  406
            F+ N  E+ I+ AL  HF SCGEI    +P    G +KG AYI F+DNDA++KALE +NS
Sbjct  567  FESNVDENEIKGALREHFESCGEITRISLPRGDNG-LKGFAYIGFSDNDAINKALEYDNS  625

Query  405  QLGHSSLYVDEAKPRND  355
            +   S+L V+EA+PR D
Sbjct  626  EFKESTLTVEEARPRGD  642



>ref|XP_007131647.1| hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris]
 gb|ESW03641.1| hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris]
Length=693

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAK--ERGAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            EAA KALELNG +L  R ++LD A+  +R ++TPNS     ++  Q  G G+S T+FVRG
Sbjct  480  EAAQKALELNGHELHNRPLRLDSARVRDRSSFTPNSSN--WNNSSQKSGRGQSQTLFVRG  537

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            FDK+  ED IRS+LE HFGSCGE+    IP D E G +KG AY++F+D D +SKALEL+ 
Sbjct  538  FDKSLGEDEIRSSLEEHFGSCGEVTRVSIPKDYETGAVKGFAYMDFSDADGISKALELHE  597

Query  408  SQLGHSSLYVDEAKPRND  355
            ++LG  +L VDEAKPR++
Sbjct  598  TELGGYTLSVDEAKPRDN  615


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            RS +E  F  CGE+   R+ TD +G  KG  ++EFA  +A  KALELN  +L +  L +D
Sbjct  442  RSDVEDFFKDCGEVVDVRLATDEDGRFKGFGHVEFATVEAAQKALELNGHELHNRPLRLD  501

Query  375  EAKPRN  358
             A+ R+
Sbjct  502  SARVRD  507



>gb|KDO52763.1| hypothetical protein CISIN_1g045516mg, partial [Citrus sinensis]
Length=675

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KA+ELNGQ L  R ++LD A+ERGAYTP SG  +++S ++   G  + T+F++GFD
Sbjct  468  EDAHKAIELNGQMLGNRAIRLDFARERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFD  527

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED +R++LE HFGSCGEI    +P D + G +KG+AY++F D D+ +KALE++ ++
Sbjct  528  SSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTE  587

Query  402  LGHSSLYVDEAK  367
            +G  SL VDEAK
Sbjct  588  IGGYSLVVDEAK  599



>ref|XP_006484546.1| PREDICTED: nucleolin 2-like [Citrus sinensis]
Length=686

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KA+ELNGQ L  R ++LD A+ERGAYTP SG  +++S ++   G  + T+F++GFD
Sbjct  479  EDAHKAIELNGQMLGNRAIRLDFARERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFD  538

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED +R++LE HFGSCGEI    +P D + G +KG+AY++F D D+ +KALE++ ++
Sbjct  539  SSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTE  598

Query  402  LGHSSLYVDEAK  367
            +G  SL VDEAK
Sbjct  599  IGGYSLVVDEAK  610



>gb|AFW61036.1| putative nucleolin-like family protein [Zea mays]
Length=262

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -2

Query  726  QDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  547
            ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IRS+
Sbjct  60   KELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIRSS  116

Query  546  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYVDE  373
            LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYVDE
Sbjct  117  LEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYVDE  176

Query  372  AKP  364
            AKP
Sbjct  177  AKP  179



>ref|XP_006437567.1| hypothetical protein CICLE_v10030875mg [Citrus clementina]
 gb|ESR50807.1| hypothetical protein CICLE_v10030875mg [Citrus clementina]
Length=686

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KA+ELNGQ L  R ++LD A+ERGAYTP SG  + +S ++   G  + T+F++GFD
Sbjct  479  EDAHKAIELNGQMLGNRAIRLDFARERGAYTPYSGGNEGNSFQKGGRGQAAHTIFIKGFD  538

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED +R++LE HFGSCGEI    +P D + G +KG+AY++F D D+ +KALE++ ++
Sbjct  539  SSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTE  598

Query  402  LGHSSLYVDEAK  367
            +G  SL VDEAK
Sbjct  599  IGGYSLVVDEAK  610



>ref|XP_003573379.1| PREDICTED: nucleolin 1 [Brachypodium distachyon]
Length=606

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 89/138 (64%), Gaps = 11/138 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNS---GAFDNssqrqsrggGESTTVFV  592
            +E A K LELNGQ+L+GR V+LDLA ERGA TP     G+F   S         S +VFV
Sbjct  391  AEDAKKGLELNGQELMGRAVRLDLALERGA-TPRPRDGGSFQKPSGGS------SLSVFV  443

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD +  ED IRS+LE HF  CGEI    +P D E G  KG+AY++F D  + SKALEL
Sbjct  444  KGFDSSQQEDKIRSSLEQHFSKCGEITRVSVPMDYESGESKGIAYMDFTDESSFSKALEL  503

Query  414  NNSQLGHSSLYVDEAKPR  361
            + S LG  +LYV EAKP+
Sbjct  504  SGSDLGGYNLYVAEAKPK  521



>ref|NP_001132813.1| uncharacterized protein LOC100194303 [Zea mays]
 gb|ACF81816.1| unknown [Zea mays]
Length=303

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -2

Query  726  QDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  547
            ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IRS+
Sbjct  60   KELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIRSS  116

Query  546  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYVDE  373
            LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYVDE
Sbjct  117  LEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYVDE  176

Query  372  AKP  364
            AKP
Sbjct  177  AKP  179



>gb|ACN25922.1| unknown [Zea mays]
Length=383

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -2

Query  726  QDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  547
            ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IRS+
Sbjct  181  KELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIRSS  237

Query  546  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYVDE  373
            LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYVDE
Sbjct  238  LEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYVDE  297

Query  372  AKP  364
            AKP
Sbjct  298  AKP  300



>gb|AFW61035.1| putative nucleolin-like family protein [Zea mays]
Length=654

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 5/125 (4%)
 Frame = -2

Query  732  NGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  553
              ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  450  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  506

Query  552  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  379
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  507  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  566

Query  378  DEAKP  364
            DEAKP
Sbjct  567  DEAKP  571



>ref|XP_008676638.1| PREDICTED: uncharacterized protein LOC100194303 isoform X2 [Zea 
mays]
 gb|AFW61033.1| putative nucleolin-like family protein [Zea mays]
Length=659

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 5/125 (4%)
 Frame = -2

Query  732  NGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  553
              ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  455  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  511

Query  552  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  379
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  512  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  571

Query  378  DEAKP  364
            DEAKP
Sbjct  572  DEAKP  576



>gb|AFW61032.1| putative nucleolin-like family protein [Zea mays]
Length=699

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 5/125 (4%)
 Frame = -2

Query  732  NGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  553
              ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  454  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  510

Query  552  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  379
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  511  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  570

Query  378  DEAKP  364
            DEAKP
Sbjct  571  DEAKP  575



>ref|XP_006306519.1| hypothetical protein CARUB_v10012524mg [Capsella rubella]
 gb|EOA39417.1| hypothetical protein CARUB_v10012524mg [Capsella rubella]
Length=535

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 93/140 (66%), Gaps = 10/140 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALEL+G+ LLGR+++LD+A+ERG   A+TP SG F +          +  TVFV
Sbjct  328  AEDAQKALELHGRPLLGREIRLDVAQERGERPAFTPQSGNFKSGGGGGG----DGQTVFV  383

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD + +E++I+ AL  HF SCGEI    +PTD E G  KG+AY++F++     KALEL
Sbjct  384  KGFDSSQSEEDIKQALREHFASCGEITRVSVPTDRETGASKGIAYVDFSEGK--EKALEL  441

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N S +G   L VDE +PR++
Sbjct  442  NGSDMGGWGLVVDEPRPRDN  461



>ref|XP_008676637.1| PREDICTED: uncharacterized protein LOC100194303 isoform X1 [Zea 
mays]
 gb|AFW61034.1| putative nucleolin-like family protein [Zea mays]
Length=700

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 5/125 (4%)
 Frame = -2

Query  732  NGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  553
              ++L GR+V+LD AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  455  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  511

Query  552  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  379
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  512  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  571

Query  378  DEAKP  364
            DEAKP
Sbjct  572  DEAKP  576



>ref|XP_010500433.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=543

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 9/140 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALEL+G+ LLGR+++LD+A+ERG   A+TP SG  +N       G G+  TVFV
Sbjct  339  AEEAQKALELHGRPLLGREIRLDIAQERGERPAFTPQSGG-NNFRSGGGGGDGQ--TVFV  395

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD   +E++I+ AL  HFGSCGEI    +PTD E G  KG+AY+EF   +   KALEL
Sbjct  396  KGFDSAQSEEDIKHALREHFGSCGEITRVSVPTDRETGASKGIAYVEF--TEGKEKALEL  453

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N S +G   L VDE +PR++
Sbjct  454  NGSDMGGWGLVVDEPRPRDN  473



>ref|XP_010479318.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=554

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 96/139 (69%), Gaps = 10/139 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALEL+G+ LLGR+++LD+A+ERG   A+TP SG     +  +S GGG+  TVFV
Sbjct  346  AEEAQKALELHGRPLLGREIRLDIAQERGERPAFTPQSGG----NNFRSGGGGDGQTVFV  401

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD   +E++I+ AL  HFGSCGEI    +PTD E G  KG+AY+EF  ++   KALEL
Sbjct  402  KGFDSAQSEEDIKHALREHFGSCGEITRVSVPTDRETGASKGIAYVEF--SEGKEKALEL  459

Query  414  NNSQLGHSSLYVDEAKPRN  358
            N S +G   L VDE +PR+
Sbjct  460  NGSDMGGWGLVVDEPRPRD  478



>ref|XP_010461727.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=543

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 94/140 (67%), Gaps = 11/140 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALEL+G+ LLGR+++LD+A+ERG   A+TP SG           GGG+  TVFV
Sbjct  346  AEEAQKALELHGRPLLGREIRLDIAQERGERPAFTPQSGG-----NNFRSGGGDGQTVFV  400

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD + +E++I+ AL  HFGSCGEI    +PT+ E G  KG+AY+EF   +   KALEL
Sbjct  401  KGFDSSQSEEDIKHALREHFGSCGEITRVSVPTERETGASKGIAYVEF--TEGKEKALEL  458

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N S +G   L VDE +PR++
Sbjct  459  NGSDMGGWGLVVDEPRPRDN  478



>dbj|BAK07329.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKERGA---YTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KAL+ LNG DL+GR V+LDLA ERGA    T + G+F   S         S +VF
Sbjct  26   AEDAQKALDALNGGDLIGRPVRLDLAAERGASALRTRDGGSFGKPSGG------PSLSVF  79

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  ED IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKALE
Sbjct  80   VKGFDSSQQEDAIRSSLQEHFSKCGEITRVSVPMDHENGASKGIAYMDFTDESSFSKALE  139

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYV EAKP+
Sbjct  140  LSGSDLGGCNLYVAEAKPK  158



>ref|XP_010066989.1| PREDICTED: nucleolin 2 isoform X4 [Eucalyptus grandis]
Length=656

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+E NG+ L  R +++ LA ERGAYTP SG  +     Q  GGG++ TVFV+G 
Sbjct  437  AEAAQKAVEYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGL  493

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN +
Sbjct  494  DKSIGEDQLRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGT  553

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L VDEA+PR++
Sbjct  554  ELGGYPLAVDEARPRDN  570



>gb|KCW65048.1| hypothetical protein EUGRSUZ_G02571 [Eucalyptus grandis]
Length=651

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+E NG+ L  R +++ LA ERGAYTP SG  +     Q  GGG++ TVFV+G 
Sbjct  476  AEAAQKAVEYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGL  532

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN +
Sbjct  533  DKSIGEDQLRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGT  592

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L VDEA+PR++
Sbjct  593  ELGGYPLAVDEARPRDN  609



>gb|KFK36056.1| hypothetical protein AALP_AA4G072000 [Arabis alpina]
Length=536

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 87/146 (60%), Gaps = 21/146 (14%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNS------GAFDNssqrqsrggGE  610
            SE A KA  LNG+ LLGRD++LD+A ERG   AYTP S      G FD           E
Sbjct  344  SEDATKAFNLNGKPLLGRDIRLDMANERGERPAYTPQSNARSGGGGFD-----------E  392

Query  609  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAM  433
              TVFV+GFD +  ED+I++AL  HF SCGEI    +P D E G  KG+AYI+F+     
Sbjct  393  KPTVFVKGFDSSLAEDDIKNALGEHFASCGEITRVSVPIDRETGASKGIAYIDFSQVSEK  452

Query  432  SKALELNNSQLGHSSLYVDEAKPRND  355
             KA EL+ S LG  SL VDE +P+ D
Sbjct  453  EKAFELDGSDLGGYSLKVDEPRPKAD  478



>ref|XP_010066987.1| PREDICTED: nucleolin 1 isoform X2 [Eucalyptus grandis]
Length=700

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+E NG+ L  R +++ LA ERGAYTP SG  +     Q  GGG++ TVFV+G 
Sbjct  481  AEAAQKAVEYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGL  537

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN +
Sbjct  538  DKSIGEDQLRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGT  597

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L VDEA+PR++
Sbjct  598  ELGGYPLAVDEARPRDN  614



>gb|KCW65047.1| hypothetical protein EUGRSUZ_G02571 [Eucalyptus grandis]
Length=711

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+E NG+ L  R +++ LA ERGAYTP SG  +     Q  GGG++ TVFV+G 
Sbjct  492  AEAAQKAVEYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGL  548

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN +
Sbjct  549  DKSIGEDQLRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGT  608

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L VDEA+PR++
Sbjct  609  ELGGYPLAVDEARPRDN  625



>ref|XP_010066988.1| PREDICTED: nucleolin 2 isoform X3 [Eucalyptus grandis]
Length=695

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+E NG+ L  R +++ LA ERGAYTP SG  +     Q  GGG++ TVFV+G 
Sbjct  476  AEAAQKAVEYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGL  532

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN +
Sbjct  533  DKSIGEDQLRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGT  592

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L VDEA+PR++
Sbjct  593  ELGGYPLAVDEARPRDN  609



>ref|XP_010066986.1| PREDICTED: nucleolin 2 isoform X1 [Eucalyptus grandis]
Length=732

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+E NG+ L  R +++ LA ERGAYTP SG  +     Q  GGG++ TVFV+G 
Sbjct  513  AEAAQKAVEYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGL  569

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  ED +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN +
Sbjct  570  DKSIGEDQLRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGT  629

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L VDEA+PR++
Sbjct  630  ELGGYPLAVDEARPRDN  646



>ref|XP_002891463.1| hypothetical protein ARALYDRAFT_474037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67722.1| hypothetical protein ARALYDRAFT_474037 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 14/143 (10%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG------AYTPNSGAFDNssqrqsrggGESTT  601
            SE A KALE +G+ LLGR+++LD+A+ERG      AYTP SG + +          +   
Sbjct  345  SEEAQKALEFHGRPLLGREIRLDIAQERGERGERPAYTPQSGNYKSGGDGG-----DEKK  399

Query  600  VFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKA  424
            VFV+GFD + +ED+IR+AL  HF SCGEIK   +P D + G  KG+AY+ F+  +   KA
Sbjct  400  VFVKGFDSSLSEDDIRNALTEHFSSCGEIKSVSVPMDRDTGNSKGIAYVAFS--EGKEKA  457

Query  423  LELNNSQLGHSSLYVDEAKPRND  355
            LELN S +G  SL VDE +PR++
Sbjct  458  LELNGSDMGGWSLVVDEPRPRDN  480



>ref|XP_006406587.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
 gb|ESQ48040.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
Length=378

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 6/140 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGA--YTP-NSGAFDNssqrqsrggGESTTVFV  592
            +EAA KALELNG+ LLGRDV+LD A E+ A   TP +S A  N        G +S T+FV
Sbjct  179  AEAAQKALELNGKPLLGRDVRLDTANEKRASNTTPRSSNAARNYQSSDKGQGSQSKTIFV  238

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD +  E  I+SAL  HF +CGEI    IPTDPE G I+G A+I+    D ++KALEL
Sbjct  239  RGFDSSLGEHEIKSALRDHFSACGEITRIAIPTDPETGAIRGNAFIDL--KDGLNKALEL  296

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N S++G  ++ V +A PR +
Sbjct  297  NGSEVGGRNIMVSKALPRGE  316



>ref|XP_006406586.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
 gb|ESQ48039.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
Length=347

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 6/140 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGA--YTP-NSGAFDNssqrqsrggGESTTVFV  592
            +EAA KALELNG+ LLGRDV+LD A E+ A   TP +S A  N        G +S T+FV
Sbjct  148  AEAAQKALELNGKPLLGRDVRLDTANEKRASNTTPRSSNAARNYQSSDKGQGSQSKTIFV  207

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            RGFD +  E  I+SAL  HF +CGEI    IPTDPE G I+G A+I+    D ++KALEL
Sbjct  208  RGFDSSLGEHEIKSALRDHFSACGEITRIAIPTDPETGAIRGNAFIDL--KDGLNKALEL  265

Query  414  NNSQLGHSSLYVDEAKPRND  355
            N S++G  ++ V +A PR +
Sbjct  266  NGSEVGGRNIMVSKALPRGE  285



>ref|XP_011465351.1| PREDICTED: nucleolin 1-like isoform X7 [Fragaria vesca subsp. 
vesca]
Length=564

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  362  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  419

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  420  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  479

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  480  LDGSDLGNGYCLNVQPAKPK  499



>ref|XP_004301800.1| PREDICTED: nucleolin 1-like isoform X4 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  376  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  433

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  434  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  493

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  494  LDGSDLGNGYCLNVQPAKPK  513



>ref|XP_011465350.1| PREDICTED: nucleolin 1-like isoform X6 [Fragaria vesca subsp. 
vesca]
Length=565

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  363  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  420

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  421  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  480

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  481  LDGSDLGNGYCLNVQPAKPK  500



>ref|XP_011465348.1| PREDICTED: nucleolin 1-like isoform X3 [Fragaria vesca subsp. 
vesca]
Length=598

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  396  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  453

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  454  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  513

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  514  LDGSDLGNGYCLNVQPAKPK  533



>ref|XP_011465349.1| PREDICTED: nucleolin 1-like isoform X5 [Fragaria vesca subsp. 
vesca]
Length=567

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  365  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  422

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  423  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  482

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  483  LDGSDLGNGYCLNVQPAKPK  502



>ref|XP_011465347.1| PREDICTED: nucleolin 1-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=606

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  404  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  461

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  462  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  521

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  522  LDGSDLGNGYCLNVQPAKPK  541



>ref|XP_011465346.1| PREDICTED: nucleolin 1-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=620

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKE---RGAYTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KALE LNG DL G  V+LDLA E   RGAYTP+SG        Q  G G+S T+F
Sbjct  418  AEEAQKALEELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIF  475

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            VRGFD    ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA E
Sbjct  476  VRGFDTTQGEDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFE  535

Query  417  LNNSQLGHS-SLYVDEAKPR  361
            L+ S LG+   L V  AKP+
Sbjct  536  LDGSDLGNGYCLNVQPAKPK  555



>ref|XP_002445177.1| hypothetical protein SORBIDRAFT_07g005510 [Sorghum bicolor]
 gb|EES14672.1| hypothetical protein SORBIDRAFT_07g005510 [Sorghum bicolor]
Length=647

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 90/140 (64%), Gaps = 7/140 (5%)
 Frame = -2

Query  762  SEAAAKAL-ELNGQDLLGRDVKLDLAKE-RGAYTPNSGAFDNssqrqsrggGESTTVFVR  589
            +EAA KA  E    +L GR+V+LD AK  R   TP SG   N    Q    G S ++FVR
Sbjct  430  AEAAEKAFKEKQSTELQGREVRLDFAKGGRNTQTPRSG---NDGSFQKPARGTSNSIFVR  486

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFDK  +ED IRSAL+ HF  CG+I    IPTD E G IKGMAY++F D D++SKA+EL+
Sbjct  487  GFDKELSEDEIRSALQEHFKKCGDITRVSIPTDYESGAIKGMAYMDFKDQDSVSKAIELS  546

Query  411  NSQLGHS-SLYVDEAKPRND  355
             + +G    LYVDEAKP+ D
Sbjct  547  GTDIGGGYELYVDEAKPKGD  566



>ref|XP_008461860.1| PREDICTED: nucleolin 1 isoform X2 [Cucumis melo]
Length=658

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KALELNG+ LL R+V+LD+A+E+GAYTP     +NS Q+  RG   S TVFVRGFD
Sbjct  448  EVAKKALELNGELLLNREVRLDMAREKGAYTPYDRERNNSFQKGGRG--PSQTVFVRGFD  505

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            ++  ED IRSAL+ HFG+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+
Sbjct  506  RSSGEDEIRSALQEHFGACGDITRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSE  565

Query  402  LGHSSLYVDEAKP  364
            L  + L V+EAKP
Sbjct  566  LHGNYLTVEEAKP  578



>dbj|BAK02407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKERGA---YTPNSGAFDNssqrqsrggGESTTVF  595
            +E A KAL+ LNG DL+GR V+LDLA ERGA    T + G+F   S         S +VF
Sbjct  356  AEDAQKALDALNGGDLIGRPVRLDLAAERGASALRTRDGGSFGKPSGG------PSLSVF  409

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  ED IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKALE
Sbjct  410  VKGFDSSQQEDAIRSSLQEHFSKCGEITRVSVPMDHENGASKGIAYMDFTDESSFSKALE  469

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYV EAKP+
Sbjct  470  LSGSDLGGCNLYVAEAKPK  488



>ref|XP_004172525.1| PREDICTED: uncharacterized protein LOC101223830, partial [Cucumis 
sativus]
Length=500

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KALELNG+ LL R+V+LD+A+E+G+YTP      N+S ++   G  S TVFVRGFD
Sbjct  290  EVAKKALELNGELLLNREVRLDMAREKGSYTPYDSRERNNSFQKGGRGP-SQTVFVRGFD  348

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            ++  ED IRSAL+ HFG+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+
Sbjct  349  RSLGEDEIRSALQDHFGACGDINRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSE  408

Query  402  LGHSSLYVDEAKP  364
            L  + L VDEAKP
Sbjct  409  LHGNYLTVDEAKP  421



>gb|EMT20945.1| Nucleolin [Aegilops tauschii]
Length=560

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 88/139 (63%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKERGAYTPNS---GAFDNssqrqsrggGESTTVF  595
            +E A KAL+ LNG DL+GR V+LD+A ERGA  P +   G+F   S         S +VF
Sbjct  357  AEDAQKALDSLNGGDLMGRPVRLDMAAERGASAPRTRDGGSFGKPSGG------PSLSVF  410

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  ED IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKAL 
Sbjct  411  VKGFDSSQQEDAIRSSLQEHFSKCGEITRVSVPMDYENGASKGIAYMDFTDESSFSKALA  470

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYV EAKP+
Sbjct  471  LSGSDLGGCNLYVAEAKPK  489



>ref|XP_008461859.1| PREDICTED: nucleolin 1 isoform X1 [Cucumis melo]
Length=659

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KALELNG+ LL R+V+LD+A+E+GAYTP      N+S ++   G  S TVFVRGFD
Sbjct  448  EVAKKALELNGELLLNREVRLDMAREKGAYTPYDSRERNNSFQKGGRG-PSQTVFVRGFD  506

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            ++  ED IRSAL+ HFG+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+
Sbjct  507  RSSGEDEIRSALQEHFGACGDITRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSE  566

Query  402  LGHSSLYVDEAKP  364
            L  + L V+EAKP
Sbjct  567  LHGNYLTVEEAKP  579



>gb|EMS57596.1| Nucleolin [Triticum urartu]
Length=793

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 90/139 (65%), Gaps = 12/139 (9%)
 Frame = -2

Query  762  SEAAAKALE-LNGQDLLGRDVKLDLAKERGAYTPNS---GAFDNssqrqsrggGESTTVF  595
            +E A KAL+ LNG DL+GR V+LD+A ERGA TP +   G+F   S         S +VF
Sbjct  579  AEDAQKALDSLNGGDLMGRPVRLDMAAERGA-TPRTRDGGSFGKPSGG------PSLSVF  631

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  ED IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKALE
Sbjct  632  VKGFDSSQQEDAIRSSLQEHFSKCGEITRVSVPMDYENGASKGIAYMDFTDESSFSKALE  691

Query  417  LNNSQLGHSSLYVDEAKPR  361
            L+ S LG  +LYV EAKP+
Sbjct  692  LSGSDLGGCNLYVAEAKPK  710



>ref|XP_009144995.1| PREDICTED: nucleolin 1-like [Brassica rapa]
 emb|CDY60074.1| BnaA05g36400D [Brassica napus]
Length=440

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 89/139 (64%), Gaps = 10/139 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALEL+G  +LGRD++LD+A+ERG   AYTP SGA          GGG   +VFV
Sbjct  248  AEQAQKALELHGTSMLGRDIRLDVAQERGERPAYTPQSGA----GGNFRSGGGGGQSVFV  303

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD +  E++I+SAL  HF SCGEI    +P D E G  KG+AY++F   D   KA EL
Sbjct  304  KGFDSSLPEEDIKSALSAHFASCGEITRVSVPCDRETGASKGIAYLDF--KDGTDKAFEL  361

Query  414  NNSQLGHSSLYVDEAKPRN  358
            N S +G  S+ VD+ + ++
Sbjct  362  NGSDMGGWSIVVDQPREKS  380



>ref|XP_004148591.1| PREDICTED: uncharacterized protein LOC101206235 [Cucumis sativus]
Length=737

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = -2

Query  711  RDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  532
            R+V+LD+A+E+G+YTP      N+S ++   G  S TVFVRGFD++  ED IRSAL+ HF
Sbjct  543  REVRLDMAREKGSYTPYDSRERNNSFQKGGRG-PSQTVFVRGFDRSLGEDEIRSALQDHF  601

Query  531  GSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  364
            G+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+L  + L VDEAKP
Sbjct  602  GACGDINRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSELHGNYLTVDEAKP  658



>emb|CDY65178.1| BnaCnng45920D [Brassica napus]
Length=482

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 12/138 (9%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALEL+G  +LGRD++LD+A+ERG   AYTP SGA  N             ++FV
Sbjct  286  AEQAQKALELHGTSMLGRDIRLDVAQERGERPAYTPQSGAGGNFRSSGGG----GQSIFV  341

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD +  E++I+SAL  HF SCG+I    +P D E G  KG+AY++F   D   KA EL
Sbjct  342  KGFDSSLPEEDIKSALSAHFASCGDITRVSVPCDRETGASKGIAYLDF--KDGTDKAFEL  399

Query  414  NNSQLGHSSLYVDEAKPR  361
            N S +G  S+ VD+  PR
Sbjct  400  NGSDMGGWSIVVDQ--PR  415



>gb|KJB49997.1| hypothetical protein B456_008G149100, partial [Gossypium raimondii]
Length=296

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R V+LDLA+ERGAYTP+S   +NS Q+  RG     T++VRGF
Sbjct  173  AEAAQKALELNGEYLMNRAVRLDLARERGAYTPHSSNGNNSFQKGGRGNVR--TIYVRGF  230

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKAL  421
            D++  +D I+++L+ HFG CGEI    IP D E G +KG AY++F D D+ +KAL
Sbjct  231  DQSLGQDEIKNSLKEHFGPCGEISRVAIPVDWETGGVKGYAYLDFNDGDSFNKAL  285



>gb|KJB49998.1| hypothetical protein B456_008G149100, partial [Gossypium raimondii]
Length=294

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R V+LDLA+ERGAYTP+S   +NS Q+  RG     T++VRGF
Sbjct  171  AEAAQKALELNGEYLMNRAVRLDLARERGAYTPHSSNGNNSFQKGGRGNVR--TIYVRGF  228

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKAL  421
            D++  +D I+++L+ HFG CGEI    IP D E G +KG AY++F D D+ +KAL
Sbjct  229  DQSLGQDEIKNSLKEHFGPCGEISRVAIPVDWETGGVKGYAYLDFNDGDSFNKAL  283



>gb|KJB49999.1| hypothetical protein B456_008G149100, partial [Gossypium raimondii]
Length=304

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALELNG+ L+ R V+LDLA+ERGAYTP+S   +NS Q+  RG     T++VRGF
Sbjct  181  AEAAQKALELNGEYLMNRAVRLDLARERGAYTPHSSNGNNSFQKGGRGNVR--TIYVRGF  238

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKAL  421
            D++  +D I+++L+ HFG CGEI    IP D E G +KG AY++F D D+ +KAL
Sbjct  239  DQSLGQDEIKNSLKEHFGPCGEISRVAIPVDWETGGVKGYAYLDFNDGDSFNKAL  293



>ref|XP_006393330.1| hypothetical protein EUTSA_v10011361mg [Eutrema salsugineum]
 gb|ESQ30616.1| hypothetical protein EUTSA_v10011361mg [Eutrema salsugineum]
Length=556

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFV  592
            +E A KALE +G+ LLGRD++LD+A+ERG   AYTP SG    + +     GG+  T+FV
Sbjct  353  AEEAQKALEFHGRPLLGRDIRLDVAQERGERPAYTPQSGNAGGNFRSGGGDGGQ--TIFV  410

Query  591  RGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALEL  415
            +GFD +  E++I+SAL  HF SCGEI    +P D E G  KG+AYI+F   +   KA EL
Sbjct  411  KGFDSSLPEEDIKSALSEHFASCGEITRVSVPMDRETGASKGIAYIQF--QETAEKAFEL  468

Query  414  NNSQLGHSSLYVDEAKPRND  355
             +  +G  +L VDEAKPR +
Sbjct  469  TD--MGGWNLVVDEAKPREN  486



>ref|XP_009107584.1| PREDICTED: nucleolin 1-like [Brassica rapa]
Length=583

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 90/140 (64%), Gaps = 10/140 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AY-TPNSGAFDNssqrqsrggGESTTVF  595
            SE A KALELNG+ LLGRD++LD+A ERG   AY TP SG  +  S      G +   +F
Sbjct  376  SEDAQKALELNGRALLGRDIRLDMAAERGDRPAYNTPQSGGGNFRSGGGGGEGQK---IF  432

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  E++IR AL  HF SCGEI    IP D E G  +G+AYI+F   +   KA +
Sbjct  433  VKGFDSSLPEEDIRQALTQHFASCGEITRVSIPMDRETGASRGIAYIDF--KEGAEKAYD  490

Query  417  LNNSQLGHSSLYVDEAKPRN  358
            LN ++LG  ++ VDEAKPR+
Sbjct  491  LNGTELGGWNIVVDEAKPRD  510



>gb|KFK39211.1| hypothetical protein AALP_AA3G213800 [Arabis alpina]
Length=543

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 84/139 (60%), Gaps = 6/139 (4%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAY--TP-NSGAFDNssqrqsrggGESTTVFVR  589
            EAA KALEL+G++LL R ++LD A E+  +  TP N     N    +   G +S T++V+
Sbjct  353  EAAKKALELHGKELLHRPIRLDFANEKKVFNTTPRNRNDSSNYQSTRRGEGSQSQTIYVK  412

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E   R AL  HF SCGEI    +P D E G I+GMAYI+F   D   KALELN
Sbjct  413  GFDNSLGEREARDALREHFSSCGEISRIAVPNDRETGVIRGMAYIDF--KDGFDKALELN  470

Query  411  NSQLGHSSLYVDEAKPRND  355
             S+LG   + V+EA PR D
Sbjct  471  GSKLGGRKIVVNEAAPRGD  489



>gb|KFK39212.1| hypothetical protein AALP_AA3G213800 [Arabis alpina]
Length=544

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 84/139 (60%), Gaps = 6/139 (4%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAY--TP-NSGAFDNssqrqsrggGESTTVFVR  589
            EAA KALEL+G++LL R ++LD A E+  +  TP N     N    +   G +S T++V+
Sbjct  354  EAAKKALELHGKELLHRPIRLDFANEKKVFNTTPRNRNDSSNYQSTRRGEGSQSQTIYVK  413

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E   R AL  HF SCGEI    +P D E G I+GMAYI+F   D   KALELN
Sbjct  414  GFDNSLGEREARDALREHFSSCGEISRIAVPNDRETGVIRGMAYIDF--KDGFDKALELN  471

Query  411  NSQLGHSSLYVDEAKPRND  355
             S+LG   + V+EA PR D
Sbjct  472  GSKLGGRKIVVNEAAPRGD  490



>emb|CDX77274.1| BnaC08g03190D [Brassica napus]
Length=579

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 90/140 (64%), Gaps = 12/140 (9%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AY-TPNSGAFDNssqrqsrggGESTTVF  595
            SE A KALEL+G+ LLGRD++LDLA ERG   AY TP SG           GGGE   +F
Sbjct  381  SEDAQKALELHGRALLGRDIRLDLAAERGDRPAYNTPQSGG-----GNFRSGGGEGQKIF  435

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE  418
            V+GFD +  E++IR AL  HF SCGEI    +P D E G  +G+AYI+F   +   KA +
Sbjct  436  VKGFDSSLPEEDIRQALTQHFASCGEITRVSLPMDRETGASRGIAYIDF--KEGAEKAYD  493

Query  417  LNNSQLGHSSLYVDEAKPRN  358
            LN ++LG  ++ VDEAKPR+
Sbjct  494  LNGTELGGWNIVVDEAKPRD  513



>ref|XP_006605422.1| PREDICTED: nucleolin 2-like isoform X3 [Glycine max]
 ref|XP_006605423.1| PREDICTED: nucleolin 2-like isoform X4 [Glycine max]
 ref|XP_006605424.1| PREDICTED: nucleolin 2-like isoform X5 [Glycine max]
 ref|XP_006605425.1| PREDICTED: nucleolin 2-like isoform X6 [Glycine max]
 ref|XP_006605426.1| PREDICTED: nucleolin 2-like isoform X7 [Glycine max]
Length=730

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  530  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  587

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  588  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  647

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  648  ELGGFPLRVEKAKPRRD  664


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  219  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  277



>ref|XP_006605428.1| PREDICTED: nucleolin 2-like isoform X9 [Glycine max]
Length=699

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  499  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  556

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  557  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  616

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  617  ELGGFPLRVEKAKPRRD  633


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  188  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  246



>ref|XP_006605427.1| PREDICTED: nucleolin 2-like isoform X8 [Glycine max]
Length=702

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  502  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  559

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  560  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  619

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  620  ELGGFPLRVEKAKPRRD  636


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  191  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  249



>ref|XP_006605429.1| PREDICTED: nucleolin 2-like isoform X10 [Glycine max]
Length=694

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  494  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  551

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  552  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  611

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  612  ELGGFPLRVEKAKPRRD  628


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  183  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  241



>ref|XP_006605438.1| PREDICTED: nucleolin 2-like isoform X19 [Glycine max]
 ref|XP_006605439.1| PREDICTED: nucleolin 2-like isoform X20 [Glycine max]
 ref|XP_006605440.1| PREDICTED: nucleolin 2-like isoform X21 [Glycine max]
Length=690

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  490  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  547

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  548  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  607

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  608  ELGGFPLRVEKAKPRRD  624


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  179  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  237



>ref|XP_006605420.1| PREDICTED: nucleolin 2-like isoform X1 [Glycine max]
Length=737

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  537  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  594

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  595  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  654

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  655  ELGGFPLRVEKAKPRRD  671


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  226  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  284



>ref|XP_006605421.1| PREDICTED: nucleolin 2-like isoform X2 [Glycine max]
Length=734

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  534  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  591

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  592  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  651

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  652  ELGGFPLRVEKAKPRRD  668


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  223  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  281



>ref|XP_006605441.1| PREDICTED: nucleolin 2-like isoform X22 [Glycine max]
Length=672

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  472  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  529

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  530  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  589

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  590  ELGGFPLRVEKAKPRRD  606



>ref|XP_006605430.1| PREDICTED: nucleolin 2-like isoform X11 [Glycine max]
 ref|XP_006605431.1| PREDICTED: nucleolin 2-like isoform X12 [Glycine max]
 ref|XP_006605432.1| PREDICTED: nucleolin 2-like isoform X13 [Glycine max]
 ref|XP_006605433.1| PREDICTED: nucleolin 2-like isoform X14 [Glycine max]
 ref|XP_006605434.1| PREDICTED: nucleolin 2-like isoform X15 [Glycine max]
 ref|XP_006605435.1| PREDICTED: nucleolin 2-like isoform X16 [Glycine max]
 ref|XP_006605436.1| PREDICTED: nucleolin 2-like isoform X17 [Glycine max]
 ref|XP_006605437.1| PREDICTED: nucleolin 2-like isoform X18 [Glycine max]
Length=690

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  490  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGF  547

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ +
Sbjct  548  DSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQN  607

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR D
Sbjct  608  ELGGFPLRVEKAKPRRD  624


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  179  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  237



>ref|XP_010466013.1| PREDICTED: nucleolin 2-like isoform X12 [Camelina sativa]
Length=1010

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
            ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  860  ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  919

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  920  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  977

Query  411  NSQLGHSSLYVDEAKPR  361
             S++    + V EA+PR
Sbjct  978  GSEIRGWKIVVQEARPR  994



>ref|XP_010466011.1| PREDICTED: nucleolin 2-like isoform X10 [Camelina sativa]
Length=1045

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  895   ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  954

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  955   GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1012

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1013  GSEIRGWKIVVQEARPR  1029



>ref|XP_010466007.1| PREDICTED: nucleolin 2-like isoform X7 [Camelina sativa]
Length=1100

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  950   ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1009

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1010  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1067

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1068  GSEIRGWKIVVQEARPR  1084



>ref|XP_010466010.1| PREDICTED: nucleolin 2-like isoform X9 [Camelina sativa]
Length=1070

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  920   ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  979

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  980   GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1037

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1038  GSEIRGWKIVVQEARPR  1054



>ref|XP_010466008.1| PREDICTED: nucleolin 2-like isoform X8 [Camelina sativa]
Length=1099

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  949   ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1008

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1009  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1066

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1067  GSEIRGWKIVVQEARPR  1083



>ref|XP_010466000.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010466001.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010466002.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Camelina 
sativa]
Length=1160

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  1010  ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1069

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1070  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1127

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1128  GSEIRGWKIVVQEARPR  1144



>ref|XP_010466006.1| PREDICTED: nucleolin 2-like isoform X6 [Camelina sativa]
Length=1129

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  979   ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1038

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1039  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1096

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1097  GSEIRGWKIVVQEARPR  1113



>ref|XP_010466005.1| PREDICTED: nucleolin 2-like isoform X5 [Camelina sativa]
Length=1133

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  983   ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1042

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1043  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1100

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1101  GSEIRGWKIVVQEARPR  1117



>ref|XP_006587954.1| PREDICTED: nucleolin 1-like [Glycine max]
Length=378

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  179  AEAAKKALELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERD--QSPTVFVTGF  236

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + I+++LE HFGSCGEI+   IPT    G +KG A++ F D  ++ KAL L+ +
Sbjct  237  DSSLPAEKIKASLEEHFGSCGEIQRISIPTFHDSGAVKGFAHLGFKDVVSVRKALHLDQN  296

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR +
Sbjct  297  ELGGFHLRVEKAKPRRE  313


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 78/173 (45%), Gaps = 41/173 (24%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPN----SGAFDNssqrqsrggGEST---  604
            +EAA KALELN    LGR V + +AK +G YT N    S +F  S Q +     ES+   
Sbjct  40   TEAAQKALELNNTVYLGRRVGVFIAKGKGEYTSNRSNWSKSFHQSEQTKPIKSTESSEYC  99

Query  603  ------------------------------TVFVRGFDKNDTEDNIRSALEGHFGSCGEI  514
                                          T++V    KN +    R+ +E  F  CG+I
Sbjct  100  EEEVEGKASNSSWESSKRVATLKEQNAPSKTIYV----KNLSYRVERADMENLFKECGKI  155

Query  513  KGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPRND  355
                +  +P+G + G   +EFA  +A  KALEL+N++L    + VD A+ + +
Sbjct  156  VDVHLHRNPDGRLNGFGQVEFATAEAAKKALELHNTELLRRPIGVDLAEEKGE  208



>ref|XP_010466004.1| PREDICTED: dentin sialophosphoprotein-like isoform X4 [Camelina 
sativa]
Length=1153

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  1003  ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1062

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1063  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1120

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1121  GSEIRGWKIVVQEARPR  1137



>ref|XP_010466003.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Camelina 
sativa]
Length=1159

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = -2

Query  762   SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
             ++AA KAL+LNG+ LLGR V LDLA ER  Y TP +S A DN      RGG     +FV+
Sbjct  1009  ADAAHKALQLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVK  1068

Query  588   GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
             GFD +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  1069  GFDYSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  1126

Query  411   NSQLGHSSLYVDEAKPR  361
              S++    + V EA+PR
Sbjct  1127  GSEIRGWKIVVQEARPR  1143



>ref|NP_175322.1| nucleolin like 1 [Arabidopsis thaliana]
 sp|Q9FVQ1.1|NUCL1_ARATH RecName: Full=Nucleolin 1; AltName: Full=Protein NUCLEOLIN LIKE 
1; Short=AtNUC-L1; AltName: Full=Protein PARALLEL 1; Short=AtPARL1 
[Arabidopsis thaliana]
 gb|AAG29744.1|AC084414_12 nuM1 protein, putative [Arabidopsis thaliana]
 gb|AAO64195.1| putative nucleolin [Arabidopsis thaliana]
 gb|AEE32367.1| nucleolin like 1 [Arabidopsis thaliana]
Length=557

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 15/141 (11%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG------AYTPNSGAFDNssqrqsrggGESTT  601
            SE A KALE +G+ LLGR+++LD+A+ERG      A+TP SG F +          +   
Sbjct  348  SEEAQKALEFHGRPLLGREIRLDIAQERGERGERPAFTPQSGNFRSGGDGG-----DEKK  402

Query  600  VFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKA  424
            +FV+GFD + +ED+I++ L  HF SCGEIK   +P D + G  KG+AY+EF+  +   KA
Sbjct  403  IFVKGFDASLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFS--EGKEKA  460

Query  423  LELNNSQLGHS-SLYVDEAKP  364
            LELN S +G    L VDE +P
Sbjct  461  LELNGSDMGGGFYLVVDEPRP  481



>emb|CDX93706.1| BnaA06g03420D [Brassica napus]
Length=501

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 10/137 (7%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            A KALE +G+ LLGR+++LD+A+ERG   AYTP SG           GGG    VFV+GF
Sbjct  320  AQKALEFHGRPLLGRELRLDVAQERGERPAYTPQSGT----GNNSRSGGGGGQEVFVKGF  375

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S
Sbjct  376  DSSLAPNDIKSALTEHFASCGEITRVSVPVDRETGGSRGIAYVEF--KEGTEKAFELNGS  433

Query  405  QLGHSSLYVDEAKPRND  355
             +G  +L VD+ +P+ +
Sbjct  434  DMGGWNLVVDQPRPKEN  450



>ref|XP_009148215.1| PREDICTED: nucleolin 1-like [Brassica rapa]
Length=811

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (63%), Gaps = 10/137 (7%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            A KALE +G+ LLGR+++LD+A+ERG   AYTP SG  +NS      G      VFV+GF
Sbjct  631  AQKALEFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNSRSGGGGGQE----VFVKGF  686

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S
Sbjct  687  DSSLAPNDIKSALTEHFASCGEITRVSVPVDRETGGSRGIAYVEF--KEGTEKAFELNGS  744

Query  405  QLGHSSLYVDEAKPRND  355
             +G  +L VD+ +P+ +
Sbjct  745  DMGGWNLVVDQPRPKEN  761



>emb|CDX93704.1| BnaA06g03440D [Brassica napus]
Length=682

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 10/135 (7%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            A KALE +G+ LLGR+++LD+A+ERG   AYTP SG  +NS      G      VFV+GF
Sbjct  493  AQKALEFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNSRSGGGGGQE----VFVKGF  548

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S
Sbjct  549  DSSLAPNDIKSALTEHFASCGEITRVSVPVDRETGGSRGIAYVEF--KEGTEKAFELNGS  606

Query  405  QLGHSSLYVDEAKPR  361
             +G  +L VD+ +P+
Sbjct  607  DMGGWNLVVDQPRPK  621



>ref|XP_002983635.1| hypothetical protein SELMODRAFT_234317 [Selaginella moellendorffii]
 gb|EFJ15131.1| hypothetical protein SELMODRAFT_234317 [Selaginella moellendorffii]
Length=573

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = -2

Query  756  AAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGEST--TVFVRGF  583
            AA KAL  +GQD+ GR +  DLA  RG  TP SG   +       G  +++  TVFV+GF
Sbjct  367  AAQKALNKSGQDMGGRRIYCDLANPRG--TPASGPKRDRPSPGFNGNRKTSGNTVFVKGF  424

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK   ED+IR +L  HF SCG I+  +IPTD E G IKG AYIEF+ + A +KA EL+ S
Sbjct  425  DKYQEEDSIRDSLTKHFKSCGTIERVKIPTDRETGNIKGFAYIEFSTDGAPAKAKELHGS  484

Query  405  QLGHSSLYVDEA  370
             L  S+L VD+A
Sbjct  485  DLDGSNLVVDDA  496



>emb|CDY59893.1| BnaC06g40890D [Brassica napus]
Length=511

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 82/136 (60%), Gaps = 12/136 (9%)
 Frame = -2

Query  753  AAKALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            A KALE +G+ LLGR+++LD+A+ERG   AYTP SG  +N              VFV+GF
Sbjct  327  AQKALEFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNFRSGGG----GGEEVFVKGF  382

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +   ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S
Sbjct  383  DSSLPPNDIKSALREHFASCGEITRVSVPIDRETGGSRGIAYVEF--KEGTKKAFELNGS  440

Query  405  QLGHSSLYVDEAKPRN  358
             +G  ++ VD+  PR 
Sbjct  441  DMGGWNIVVDQ--PRQ  454



>gb|KHN29567.1| Polyadenylate-binding protein, cytoplasmic and nuclear [Glycine 
soja]
Length=623

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL+  +LL R + +DLA+E+G YT +   + NS Q+  R   +S TVFV GF
Sbjct  424  AEAAKKALELHNTELLRRPMGVDLAEEKGEYTYSRSNWSNSFQKCERD--QSPTVFVTGF  481

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELNNS  406
            D +   + I+++LE HFGSCGEI+   IPT    G +KG A++ F D  ++ KAL L+ +
Sbjct  482  DSSLPAEKIKASLEEHFGSCGEIQRISIPTFHDSGAVKGFAHLGFKDVVSVRKALHLDQN  541

Query  405  QLGHSSLYVDEAKPRND  355
            +LG   L V++AKPR +
Sbjct  542  ELGGFHLRVEKAKPRRE  558


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 78/173 (45%), Gaps = 41/173 (24%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPN----SGAFDNssqrqsrggGEST---  604
            +EAA KALELN    LGR V + +AK +G YT N    S +F  S Q +     ES+   
Sbjct  285  TEAAQKALELNNTVYLGRRVGVFIAKGKGEYTSNRSNWSKSFHQSEQTKPIKSTESSEYC  344

Query  603  ------------------------------TVFVRGFDKNDTEDNIRSALEGHFGSCGEI  514
                                          T++V    KN +    R+ +E  F  CG+I
Sbjct  345  EEEVEGKASNSSWESSKRVATLKEQNAPSKTIYV----KNLSYRVERADMENLFKECGKI  400

Query  513  KGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPRND  355
                +  +P+G + G   +EFA  +A  KALEL+N++L    + VD A+ + +
Sbjct  401  VDVHLHRNPDGRLNGFGQVEFATAEAAKKALELHNTELLRRPMGVDLAEEKGE  453



>ref|XP_009145877.1| PREDICTED: nucleolin 2-like [Brassica rapa]
Length=598

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL+LNG+ LLGR ++L  A  + A   +S A  N    +   G +  T+FV  FD
Sbjct  416  EAAQKALKLNGKQLLGRTIRLSDANAKPAPR-SSNADGNFQSNRKGEGSQVKTIFVSRFD  474

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+  E ++R AL GHF  CGEI    +P D E G  +GMAY++  + D   KALELN S+
Sbjct  475  KSVAESDMRCALRGHFSDCGEITRISLPCDQETGATRGMAYLDLKEEDGFKKALELNGSE  534

Query  402  LGHSSLYVDEAKPR  361
            LG   + V E KPR
Sbjct  535  LGGWKILVLEGKPR  548



>ref|XP_002990577.1| hypothetical protein SELMODRAFT_448081 [Selaginella moellendorffii]
 gb|EFJ08454.1| hypothetical protein SELMODRAFT_448081 [Selaginella moellendorffii]
Length=602

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = -2

Query  756  AAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGEST--TVFVRGF  583
            AA KAL  +GQD+ GR +  DLA  RG  TP SG   +       G  +++  TVFV+GF
Sbjct  396  AAQKALNKSGQDMGGRRIYCDLANPRG--TPASGPKRDRPSPGFNGNRKTSGNTVFVKGF  453

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK   ED+IR +L  HF SCG I+  +IPTD E G IKG AYIEF+ + A +KA EL+ S
Sbjct  454  DKYQEEDSIRESLTKHFKSCGTIERVKIPTDRETGNIKGFAYIEFSTDGAPAKAKELHGS  513

Query  405  QLGHSSLYVDEA  370
             L   +L VD+A
Sbjct  514  DLDGCNLVVDDA  525



>ref|XP_010507220.1| PREDICTED: nucleolin 2-like isoform X2 [Camelina sativa]
Length=657

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 5/139 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVR  589
            ++AA KAL+LNG+ LLGR V LDLA ER  Y TP  S A DN      RGG     +FV+
Sbjct  507  ADAAHKALQLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVK  566

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GF  +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  567  GFYSSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  624

Query  411  NSQLGHSSLYVDEAKPRND  355
             S++    + V EA+PR +
Sbjct  625  GSEIRGWKIVVQEARPRGE  643



>ref|XP_010507230.1| PREDICTED: nucleolin 2-like isoform X4 [Camelina sativa]
Length=650

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 5/139 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVR  589
            ++AA KAL+LNG+ LLGR V LDLA ER  Y TP  S A DN      RGG     +FV+
Sbjct  500  ADAAHKALQLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVK  559

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GF  +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  560  GFYSSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  617

Query  411  NSQLGHSSLYVDEAKPRND  355
             S++    + V EA+PR +
Sbjct  618  GSEIRGWKIVVQEARPRGE  636



>ref|XP_010507224.1| PREDICTED: nucleolin 2-like isoform X3 [Camelina sativa]
Length=656

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 5/139 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVR  589
            ++AA KAL+LNG+ LLGR V LDLA ER  Y TP  S A DN      RGG     +FV+
Sbjct  506  ADAAHKALQLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVK  565

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GF  +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  566  GFYSSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  623

Query  411  NSQLGHSSLYVDEAKPRND  355
             S++    + V EA+PR +
Sbjct  624  GSEIRGWKIVVQEARPRGE  642



>ref|XP_002885266.1| hypothetical protein ARALYDRAFT_479366 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61525.1| hypothetical protein ARALYDRAFT_479366 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 83/135 (61%), Gaps = 11/135 (8%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KALELNG+ LLGRDV+LDLA ERG    N G        +   G +S T+FVRGF+
Sbjct  364  EEAQKALELNGKMLLGRDVRLDLANERGQRNSNPG--------RKGEGSQSRTIFVRGFN  415

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED I+  L   F +CGE+    +PTD E G  +G+AYI+        +AL+L  S+
Sbjct  416  SSLGEDEIKKELRSLFSNCGEVTRVHVPTDRETGACRGLAYIDL--TSGFDEALQLRGSE  473

Query  402  LGHSSLYVDEAKPRN  358
            +G  +++V+E++PR+
Sbjct  474  IGGWNIHVEESRPRD  488



>ref|XP_010507217.1| PREDICTED: nucleolin 2-like isoform X1 [Camelina sativa]
Length=680

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 5/139 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVR  589
            ++AA KAL+LNG+ LLGR V LDLA ER  Y TP  S A DN      RGG     +FV+
Sbjct  530  ADAAHKALQLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVK  589

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GF  +  E  IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN
Sbjct  590  GFYSSLDETEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLN  647

Query  411  NSQLGHSSLYVDEAKPRND  355
             S++    + V EA+PR +
Sbjct  648  GSEIRGWKIVVQEARPRGE  666



>ref|XP_010507033.1| PREDICTED: nucleolin 2-like isoform X3 [Camelina sativa]
Length=633

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 83/136 (61%), Gaps = 9/136 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+ELNG+ LLGRDV+LDLA E G  TP S             G +   ++VRGF
Sbjct  440  AEAAQKAMELNGKPLLGRDVRLDLANEIGNRTPRSNPV------SYGVGSQFRKLYVRGF  493

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S
Sbjct  494  DTSLGEDELKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGS  551

Query  405  QLGHSSLYVDEAKPRN  358
            ++G   L V+EA+PR+
Sbjct  552  EMGGGFLTVEEARPRD  567



>ref|XP_010487806.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=639

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVR  589
            ++AA K+L+LNG+ LLGR V  DLA ER  Y TP +S + DN      RGG     +FV+
Sbjct  489  ADAAHKSLQLNGKSLLGRIVYFDLACERVVYNTPRSSNSGDNYQSGGIRGGSRGQRIFVK  548

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E  IR AL  HF +CGE+    IPT+ E G IKG+A+I+    D  +KAL+LN
Sbjct  549  GFDSSLDETEIRRALRTHFSTCGEVAWISIPTNRETGAIKGIAFIDL--KDGFTKALQLN  606

Query  411  NSQLGHSSLYVDEAKPRND  355
             S++    + V EA+PR +
Sbjct  607  GSEIRGWKIVVQEARPRGE  625



>ref|XP_010507028.1| PREDICTED: nucleolin 2-like isoform X1 [Camelina sativa]
Length=686

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 83/136 (61%), Gaps = 9/136 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+ELNG+ LLGRDV+LDLA E G  TP S             G +   ++VRGF
Sbjct  493  AEAAQKAMELNGKPLLGRDVRLDLANEIGNRTPRSNPV------SYGVGSQFRKLYVRGF  546

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S
Sbjct  547  DTSLGEDELKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGS  604

Query  405  QLGHSSLYVDEAKPRN  358
            ++G   L V+EA+PR+
Sbjct  605  EMGGGFLTVEEARPRD  620



>ref|XP_010507032.1| PREDICTED: nucleolin 2-like isoform X2 [Camelina sativa]
Length=685

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 83/136 (61%), Gaps = 9/136 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+ELNG+ LLGRDV+LDLA E G  TP S             G +   ++VRGF
Sbjct  492  AEAAQKAMELNGKPLLGRDVRLDLANEIGNRTPRSNPV------SYGVGSQFRKLYVRGF  545

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S
Sbjct  546  DTSLGEDELKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGS  603

Query  405  QLGHSSLYVDEAKPRN  358
            ++G   L V+EA+PR+
Sbjct  604  EMGGGFLTVEEARPRD  619



>ref|XP_010465970.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=642

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 8/136 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+ELNG+ LLGRDV+LDLA E G  TP S     S+      G +   ++VRGF
Sbjct  443  AEAAQKAMELNGKPLLGRDVRLDLANEMGNRTPRS-----SNPVSYGVGSQFRKLYVRGF  497

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S
Sbjct  498  DTSLGEDELKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGS  555

Query  405  QLGHSSLYVDEAKPRN  358
            ++G   L V+EA+PR+
Sbjct  556  EMGGGFLTVEEARPRD  571



>dbj|BAB02219.1| unnamed protein product [Arabidopsis thaliana]
Length=610

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 85/135 (63%), Gaps = 10/135 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KALE+NG+ LLGRDV+LDLA ERG  TP      NS+  +   G +S T++VRGF 
Sbjct  409  EEAQKALEMNGKLLLGRDVRLDLANERG--TPR-----NSNPGRKGEGSQSRTIYVRGFS  461

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED I+  L  HF  CGE+    +PTD E G  +G AYI+        +AL+L+ S+
Sbjct  462  SSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDL--TSGFDEALQLSGSE  519

Query  402  LGHSSLYVDEAKPRN  358
            +G  +++V+E++PR+
Sbjct  520  IGGGNIHVEESRPRD  534



>ref|NP_188491.1| protein NUCLEOLIN LIKE 2 [Arabidopsis thaliana]
 sp|Q1PEP5.1|NUCL2_ARATH RecName: Full=Nucleolin 2; AltName: Full=Protein NUCLEOLIN LIKE 
2; Short=AtNUC-L2; AltName: Full=Protein PARALLEL LIKE 1; 
Short=AtPARLL1 [Arabidopsis thaliana]
 gb|ABE65946.1| nucleolin [Arabidopsis thaliana]
 gb|AEE76122.1| nucleolin like 2 [Arabidopsis thaliana]
Length=636

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 85/135 (63%), Gaps = 10/135 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E A KALE+NG+ LLGRDV+LDLA ERG  TP      NS+  +   G +S T++VRGF 
Sbjct  435  EEAQKALEMNGKLLLGRDVRLDLANERG--TPR-----NSNPGRKGEGSQSRTIYVRGFS  487

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED I+  L  HF  CGE+    +PTD E G  +G AYI+        +AL+L+ S+
Sbjct  488  SSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDL--TSGFDEALQLSGSE  545

Query  402  LGHSSLYVDEAKPRN  358
            +G  +++V+E++PR+
Sbjct  546  IGGGNIHVEESRPRD  560



>ref|XP_010489916.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=780

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 83/136 (61%), Gaps = 8/136 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KA+ELNG  LLGRDV+LDLA E G  TP S      +      G +   ++VRGF
Sbjct  581  AEAAQKAMELNGNPLLGRDVRLDLANEMGHRTPRSS-----NPVSYGVGSQFRKLYVRGF  635

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  ED ++ A   HF +CGE+    +PTD E G ++GMAYI+        +AL+L+ S
Sbjct  636  DTSLGEDELKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYIDM--KSGFDEALQLSGS  693

Query  405  QLGHSSLYVDEAKPRN  358
            ++G   L V+EA+PR+
Sbjct  694  EMGGGFLTVEEARPRD  709



>gb|KGN58514.1| hypothetical protein Csa_3G653460 [Cucumis sativus]
Length=690

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 92/136 (68%), Gaps = 14/136 (10%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggG---ESTTVFVR  589
            E A KALELNG+ LL R+V+LD+A+E+G+YTP    +D+  +  S   G    S TVFVR
Sbjct  486  EVAKKALELNGELLLNREVRLDMAREKGSYTP----YDSRERNNSFQKGGRGPSQTVFVR  541

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD++  ED      E HFG+CG+I    IP D E G +KGMAY++F D+D+ +KALELN
Sbjct  542  GFDRSLGED------EDHFGACGDINRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELN  595

Query  411  NSQLGHSSLYVDEAKP  364
             S+L  + L VDEAKP
Sbjct  596  GSELHGNYLTVDEAKP  611



>ref|XP_009145876.1| PREDICTED: nucleolin 2-like [Brassica rapa]
Length=278

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 83/134 (62%), Gaps = 17/134 (13%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL+LNG+ LLGR++ LD A  + A  P +                  T+FV GF+
Sbjct  132  EAAQKALKLNGEPLLGRNILLDFANTKPAPRPQNLV---------------KTIFVTGFN  176

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+ +ED +++AL  HF +CGEIK   +P   E G  KG+AY++F++ D  +KA+ELN S+
Sbjct  177  KSLSEDEMKTALRAHFSACGEIKRISLPYYQETGDSKGVAYLDFSE-DGFNKAMELNGSE  235

Query  402  LGHSSLYVDEAKPR  361
            LG  ++ V EA+P+
Sbjct  236  LGGRNIVVIEARPK  249



>emb|CDX92252.1| BnaA05g21550D [Brassica napus]
Length=601

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 78/135 (58%), Gaps = 4/135 (3%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFD-NssqrqsrggGESTTVFVRGF  583
            EAA KAL LNG+ LLGR ++L  A  + A  P S   D N    +   G +  T+FV  F
Sbjct  415  EAAQKALNLNGKQLLGRTIRLSDANAKPA--PRSSNADGNFQSNRKGEGSQVKTIFVSRF  472

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            DK+  E ++R AL GHF  CGEI    +P D E G  +GMAY++  + D  +KAL LN S
Sbjct  473  DKSVAESDMRCALRGHFSDCGEITRISLPCDQETGATRGMAYLDLKEEDGFNKALGLNGS  532

Query  405  QLGHSSLYVDEAKPR  361
            +LG   + V E KPR
Sbjct  533  ELGGWKILVLEGKPR  547



>gb|EAY95603.1| hypothetical protein OsI_17455 [Oryza sativa Indica Group]
Length=667

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 77/137 (56%), Gaps = 30/137 (22%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KALEL G DL+GR V+LDLA+ERGAYTP SG  DNSS ++        T+F++GF
Sbjct  486  AEAAKKALELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGF  543

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +     IR++LE HFGSCGEI    IP D E G  KG                     
Sbjct  544  DTSLDIHQIRNSLEEHFGSCGEITRVSIPKDYETGASKG---------------------  582

Query  405  QLGHSSLYVDEAKPRND  355
                  LYVDEA+PR D
Sbjct  583  ------LYVDEARPRPD  593



>emb|CDX92253.1| BnaA05g21540D [Brassica napus]
Length=282

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 17/134 (13%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KAL+LNG+ LLGR++ LD A  + A  P +                  T+FV GF+
Sbjct  136  EAAQKALKLNGEPLLGRNILLDFANAKPAPRPRNLV---------------KTIFVTGFN  180

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+ +ED +++AL  HF +CGEIK   +P   E G  KG+AY++F + D  +KA+ELN S+
Sbjct  181  KSLSEDEMKTALRAHFSACGEIKRISLPYYQETGDSKGVAYLDFGE-DGFNKAMELNGSE  239

Query  402  LGHSSLYVDEAKPR  361
            +G  ++ V EA+P+
Sbjct  240  VGGRNIVVIEARPK  253



>ref|XP_001773240.1| predicted protein [Physcomitrella patens]
 gb|EDQ61930.1| predicted protein [Physcomitrella patens]
Length=799

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSG---AFDNssqrqsrggGESTTVFVR  589
            E A  AL  +GQ++ GR++  DLA+ERGA TP  G   +   +   +    G   T +VR
Sbjct  371  EGAQNALLKSGQNVEGREIWCDLARERGAATPGGGKDWSQTPNGGTRGGRSGGGQTAYVR  430

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFDK   E+ IRS L   F  CG +   RIPTD E G IKG AY+EF   D ++KA EL+
Sbjct  431  GFDKFQDEETIRSGLTKLFSDCGTVLNVRIPTDRESGQIKGFAYVEFGSKDEVNKAFELD  490

Query  411  NSQLGHSSLYVDEA  370
             S     SL V+EA
Sbjct  491  GSDFNGRSLVVNEA  504



>emb|CDX99339.1| BnaC05g34540D [Brassica napus]
Length=586

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 17/134 (13%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KA++LNG+ LLGR++ LD A  + A  P +                  T+FV GF+
Sbjct  447  EAAQKAMKLNGKPLLGRNILLDFANAKPAPRPRNLV---------------KTIFVTGFN  491

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K+ +ED +++AL  HF  CGEIK   +P   E G  KG+AY++F++ D  +KA+ELN S+
Sbjct  492  KSLSEDEMKTALRAHFSDCGEIKRISLPYYQETGDSKGVAYLDFSE-DGFNKAMELNGSE  550

Query  402  LGHSSLYVDEAKPR  361
            LG  ++ V EA+P+
Sbjct  551  LGGRNIVVIEARPK  564


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 5/134 (4%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EA  KAL+LNG+ LLGR +KLD   +  A  P S   D + QR      +  T+ V+   
Sbjct  152  EAVQKALKLNGKPLLGRKIKLDDFNKNPA--PRSSNADGNFQRGEGS--QVKTILVKKNG  207

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
            K   ED +++AL  HF +CGEI    IP D + G  KGMA++ F + D  +KALELN S+
Sbjct  208  KYVGEDEMKTALRDHFSACGEITRFAIPCDQDTGATKGMAFLGFINEDGFNKALELNGSE  267

Query  402  LGHSSLYVDEAKPR  361
            LG  ++ V EA  R
Sbjct  268  LGGRNIVVTEASTR  281



>ref|XP_006297116.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30014.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=596

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 82/135 (61%), Gaps = 8/135 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E A KALELNG+ LLGRDV+LDLA E    TP S     S+  +   G +S  +FV GF
Sbjct  403  AEVARKALELNGRSLLGRDVRLDLANESARNTPRS-----SNPGRIAEGSQSRKLFVNGF  457

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            + +  ED ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S
Sbjct  458  NSSLGEDELKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGS  515

Query  405  QLGHSSLYVDEAKPR  361
             +G  ++ V+EA+PR
Sbjct  516  DIGGRNITVEEARPR  530



>ref|XP_006297117.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30015.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=634

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E A KALELNG+ LLGRDV+LDLA E    TP S      +  +   G +S  +FV GF
Sbjct  441  AEVARKALELNGRSLLGRDVRLDLANESARNTPRSS-----NPGRIAEGSQSRKLFVNGF  495

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            + +  ED ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S
Sbjct  496  NSSLGEDELKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGS  553

Query  405  QLGHSSLYVDEAKPR  361
             +G  ++ V+EA+PR
Sbjct  554  DIGGRNITVEEARPR  568



>ref|XP_006297118.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30016.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=660

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E A KALELNG+ LLGRDV+LDLA E    TP S      +  +   G +S  +FV GF
Sbjct  467  AEVARKALELNGRSLLGRDVRLDLANESARNTPRSS-----NPGRIAEGSQSRKLFVNGF  521

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            + +  ED ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S
Sbjct  522  NSSLGEDELKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGS  579

Query  405  QLGHSSLYVDEAKPR  361
             +G  ++ V+EA+PR
Sbjct  580  DIGGRNITVEEARPR  594



>ref|XP_006297119.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30017.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=686

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E A KALELNG+ LLGRDV+LDLA E    TP S      +  +   G +S  +FV GF
Sbjct  493  AEVARKALELNGRSLLGRDVRLDLANESARNTPRSS-----NPGRIAEGSQSRKLFVNGF  547

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            + +  ED ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S
Sbjct  548  NSSLGEDELKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGS  605

Query  405  QLGHSSLYVDEAKPR  361
             +G  ++ V+EA+PR
Sbjct  606  DIGGRNITVEEARPR  620



>ref|XP_007156397.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28391.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=664

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL L+  +L GR ++++LA+E+ +Y+ +   + NS         +S  V+V+GF
Sbjct  496  AEAAQKALVLDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGF  546

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  E+ I++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +
Sbjct  547  DCSLMEEEIKANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQT  606

Query  405  QLGHSSLYVDEAKPRND  355
            ++G  +L V++A+ R D
Sbjct  607  EIGGYTLLVEKARARRD  623


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN++L    + + 
Sbjct  175  RADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNTELLRCRIRIG  234

Query  375  EAKPR  361
             A  R
Sbjct  235  VAPAR  239



>ref|XP_007156396.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28390.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=676

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL L+  +L GR ++++LA+E+ +Y+ +   + NS         +S  V+V+GF
Sbjct  496  AEAAQKALVLDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGF  546

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  E+ I++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +
Sbjct  547  DCSLMEEEIKANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQT  606

Query  405  QLGHSSLYVDEAKPRND  355
            ++G  +L V++A+ R D
Sbjct  607  EIGGYTLLVEKARARRD  623


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  406
            + KN +    R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN+
Sbjct  165  YTKNLSYSVERADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNT  224

Query  405  QLGHSSLYVDEAKPR  361
            +L    + +  A  R
Sbjct  225  ELLRCRIRIGVAPAR  239



>ref|XP_007156398.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28392.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=800

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL L+  +L GR ++++LA+E+ +Y+ +   + NS         +S  V+V+GF
Sbjct  632  AEAAQKALVLDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGF  682

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  E+ I++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +
Sbjct  683  DCSLMEEEIKANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQT  742

Query  405  QLGHSSLYVDEAKPRND  355
            ++G  +L V++A+ R D
Sbjct  743  EIGGYTLLVEKARARRD  759


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 76/170 (45%), Gaps = 41/170 (24%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG-  586
            +EAA KALEL+     GR + + LA+E+G Y  N  +F N S   ++   E    F R  
Sbjct  355  TEAAQKALELDNTKWFGRWISVVLAQEKGEYASNR-SFSNWSNSFNKC--ERIEPFKRTG  411

Query  585  ---FDKNDTEDNI----------------------------------RSALEGHFGSCGE  517
               + + DTE  +                                  ++ +E  F  CGE
Sbjct  412  SSEYCEEDTEGKVLKDPWKSSSWLATMKEENASSKTIYVKNLSYRVEQADVEFFFKECGE  471

Query  516  IKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAK  367
            I   R+  D EG +KG  +IEFA  +A  KALEL+N++L    + V+ A+
Sbjct  472  IIDVRLHRDNEGRLKGFGHIEFATAEAALKALELDNTELLRRCIGVEIAR  521


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  555  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  376
            R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN++L    + + 
Sbjct  175  RADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNTELLRCRIRIG  234

Query  375  EAKPR  361
             A  R
Sbjct  235  VAPAR  239



>ref|XP_007156395.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28389.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=812

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL L+  +L GR ++++LA+E+ +Y+ +   + NS         +S  V+V+GF
Sbjct  632  AEAAQKALVLDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGF  682

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
            D +  E+ I++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +
Sbjct  683  DCSLMEEEIKANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQT  742

Query  405  QLGHSSLYVDEAKPRND  355
            ++G  +L V++A+ R D
Sbjct  743  EIGGYTLLVEKARARRD  759


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 76/170 (45%), Gaps = 41/170 (24%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG-  586
            +EAA KALEL+     GR + + LA+E+G Y  N  +F N S   ++   E    F R  
Sbjct  355  TEAAQKALELDNTKWFGRWISVVLAQEKGEYASNR-SFSNWSNSFNKC--ERIEPFKRTG  411

Query  585  ---FDKNDTEDNI----------------------------------RSALEGHFGSCGE  517
               + + DTE  +                                  ++ +E  F  CGE
Sbjct  412  SSEYCEEDTEGKVLKDPWKSSSWLATMKEENASSKTIYVKNLSYRVEQADVEFFFKECGE  471

Query  516  IKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAK  367
            I   R+  D EG +KG  +IEFA  +A  KALEL+N++L    + V+ A+
Sbjct  472  IIDVRLHRDNEGRLKGFGHIEFATAEAALKALELDNTELLRRCIGVEIAR  521


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  406
            + KN +    R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN+
Sbjct  165  YTKNLSYSVERADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNT  224

Query  405  QLGHSSLYVDEAKPR  361
            +L    + +  A  R
Sbjct  225  ELLRCRIRIGVAPAR  239



>emb|CDX99340.1| BnaC05g34550D [Brassica napus]
Length=625

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -2

Query  762  SEAAAKALEL-NGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRG  586
            +EAA KAL+L NG+ LLGR ++L  A  + A   +S A  N    +   G +  T+FV  
Sbjct  427  AEAALKALKLMNGKPLLGRTIRLSDANAKPAPR-SSNADGNFQSNRKGEGSQVKTIFVSK  485

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN  409
            FDK+  E ++  AL  HF  CGEI    +P D E G  +GMAY++F + D  +KALELN 
Sbjct  486  FDKSVAERDMICALREHFSDCGEITRISLPCDQETGATRGMAYLDFINEDGFNKALELNG  545

Query  408  SQLGHSSLYVDEAKPR  361
            S+LG  ++ V E KPR
Sbjct  546  SELGGWNILVLEGKPR  561



>ref|XP_001757595.1| predicted protein [Physcomitrella patens]
 gb|EDQ77652.1| predicted protein [Physcomitrella patens]
Length=455

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 84/156 (54%), Gaps = 27/156 (17%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGA-----FDNssqrqsrggGES-TTV  598
            EAA KAL+ +GQ+L GRD+  DLA+E+G+ TP   A      D S+   + G   S  T 
Sbjct  223  EAAQKALQKSGQNLEGRDIFCDLAREKGS-TPGGAASLISMLDFSANGATPGRAGSDKTA  281

Query  597  FVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKG----------------  469
            +VRGFDK   ED+IRS L   F  CGE+   RIPTD E G IKG                
Sbjct  282  YVRGFDKYQDEDSIRSGLTEFFSDCGEVLNVRIPTDRESGEIKGYVTVPCAASSGFDGLE  341

Query  468  ---MAYIEFADNDAMSKALELNNSQLGHSSLYVDEA  370
                AY+EF+  D +SKA E++ S     SL V+EA
Sbjct  342  STRFAYVEFSSKDQLSKATEMDGSDYNGRSLVVNEA  377



>ref|XP_011396887.1| Protein gar2 [Auxenochlorella protothecoides]
 gb|KFM24009.1| Protein gar2 [Auxenochlorella protothecoides]
Length=283

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 10/120 (8%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E AAKA+ L+GQ+L GR+V ++   ER   TP    F            E  T+FV+GFD
Sbjct  151  EGAAKAITLSGQELAGREVYIESTTEREQRTPGQDRF---------AASEGQTLFVKGFD  201

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED++R+AL   FG+ GE+   R+PTD E G ++G+ ++EF+ ++A + A+EL+ ++
Sbjct  202  SSLGEDDVRAALTEAFGAYGEVTNVRLPTDRETGSMRGIGFVEFSTSEAKNAAIELDGAE  261



>ref|XP_001769822.1| predicted protein [Physcomitrella patens]
 gb|EDQ65384.1| predicted protein [Physcomitrella patens]
Length=505

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 70/132 (53%), Gaps = 21/132 (16%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL  +GQ + GR++  DLA+ERGA TP  G              + +  +   F
Sbjct  314  AEAAQKALSKSGQTVEGREIWCDLARERGAATPGGG-------------KDWSQTYAFYF  360

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
                   +IRS L   FG CG +   RIPTD E G IKG AY+EF   D M+KA EL+ S
Sbjct  361  -------SIRSNLTEFFGECGNVVNVRIPTDRETGQIKGFAYVEFGSKDEMTKAFELDGS  413

Query  405  QLGHSSLYVDEA  370
                 SL V+EA
Sbjct  414  DFNGRSLVVNEA  425



>ref|XP_004513591.1| PREDICTED: RNA-binding protein 28-like isoform X3 [Cicer arietinum]
Length=618

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 10/137 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGEST---TVFVR  589
            EA  KALEL+ ++L+ R +K+  A + G        F N S   S   GE+    TVFV 
Sbjct  438  EATEKALELDHRELMNRPIKVGTASKEGE------CFHNRSLSISFQKGENLHPLTVFVI  491

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E+ I+++L+ HF  CGEI    +P  P+ G +KG A+++F D D   KAL+L+
Sbjct  492  GFDTSIAEEKIKASLKRHFSPCGEITRISLPRFPDSGTVKGFAHLDFKDVDGYKKALQLD  551

Query  411  NSQLGHSSLYVDEAKPR  361
             + +G   L V++AKPR
Sbjct  552  QTAIGDYWLSVEKAKPR  568


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 71/159 (45%), Gaps = 34/159 (21%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KALEL+  +LL R +K+ +A E+  Y P   +F            +S TV  +GFD
Sbjct  190  EAAQKALELDNTELLRRRIKVGIALEKNEYAPYGSSFPKGGNL------QSHTV--KGFD  241

Query  579  KNDTEDNIRSA--------------------------LEGHFGSCGEIKGTRIPTDPEGY  478
             +  E+  +S                           +E  F  CGEI   R+ +D EG 
Sbjct  242  TSLVENKPKSPATPNESLAASKTIYVRNLSYIVERTDMENLFKGCGEIVDIRLHSDREGR  301

Query  477  IKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  361
             KG  +++FA  +A  KAL L+N +    ++ V  A  R
Sbjct  302  FKGFGHVQFATAEAAQKALALDNVEFFKRNIIVGIASER  340


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = -2

Query  609  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  430
            S T++VR    N +    R+ +E  F  CGE+   R  TD EG  +G  +IEF   +A  
Sbjct  138  SKTIYVR----NLSYSVERADMENLFKDCGELVAVRFNTDREGRFRGFGHIEFGTEEAAQ  193

Query  429  KALELNNSQLGHSSLYVDEAKPRND  355
            KALEL+N++L    + V  A  +N+
Sbjct  194  KALELDNTELLRRRIKVGIALEKNE  218



>ref|XP_004513589.1| PREDICTED: RNA-binding protein 28-like isoform X1 [Cicer arietinum]
Length=631

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 10/137 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGEST---TVFVR  589
            EA  KALEL+ ++L+ R +K+  A + G        F N S   S   GE+    TVFV 
Sbjct  451  EATEKALELDHRELMNRPIKVGTASKEGE------CFHNRSLSISFQKGENLHPLTVFVI  504

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E+ I+++L+ HF  CGEI    +P  P+ G +KG A+++F D D   KAL+L+
Sbjct  505  GFDTSIAEEKIKASLKRHFSPCGEITRISLPRFPDSGTVKGFAHLDFKDVDGYKKALQLD  564

Query  411  NSQLGHSSLYVDEAKPR  361
             + +G   L V++AKPR
Sbjct  565  QTAIGDYWLSVEKAKPR  581


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 71/159 (45%), Gaps = 34/159 (21%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KALEL+  +LL R +K+ +A E+  Y P   +F            +S TV  +GFD
Sbjct  190  EAAQKALELDNTELLRRRIKVGIALEKNEYAPYGSSFPKGGNL------QSHTV--KGFD  241

Query  579  KNDTEDNIRSA--------------------------LEGHFGSCGEIKGTRIPTDPEGY  478
             +  E+  +S                           +E  F  CGEI   R+ +D EG 
Sbjct  242  TSLVENKPKSPATPNESLAASKTIYVRNLSYIVERTDMENLFKGCGEIVDIRLHSDREGR  301

Query  477  IKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  361
             KG  +++FA  +A  KAL L+N +    ++ V  A  R
Sbjct  302  FKGFGHVQFATAEAAQKALALDNVEFFKRNIIVGIASER  340


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = -2

Query  609  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  430
            S T++VR    +      R+ +E  F  CGE+   R  TD EG  +G  +IEF   +A  
Sbjct  138  SKTIYVRNLSYSVE----RADMENLFKDCGELVAVRFNTDREGRFRGFGHIEFGTEEAAQ  193

Query  429  KALELNNSQLGHSSLYVDEAKPRND  355
            KALEL+N++L    + V  A  +N+
Sbjct  194  KALELDNTELLRRRIKVGIALEKNE  218



>ref|XP_004513590.1| PREDICTED: RNA-binding protein 28-like isoform X2 [Cicer arietinum]
Length=628

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 10/137 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGEST---TVFVR  589
            EA  KALEL+ ++L+ R +K+  A + G        F N S   S   GE+    TVFV 
Sbjct  448  EATEKALELDHRELMNRPIKVGTASKEGE------CFHNRSLSISFQKGENLHPLTVFVI  501

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELN  412
            GFD +  E+ I+++L+ HF  CGEI    +P  P+ G +KG A+++F D D   KAL+L+
Sbjct  502  GFDTSIAEEKIKASLKRHFSPCGEITRISLPRFPDSGTVKGFAHLDFKDVDGYKKALQLD  561

Query  411  NSQLGHSSLYVDEAKPR  361
             + +G   L V++AKPR
Sbjct  562  QTAIGDYWLSVEKAKPR  578


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 71/159 (45%), Gaps = 34/159 (21%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KALEL+  +LL R +K+ +A E+  Y P   +F            +S TV  +GFD
Sbjct  187  EAAQKALELDNTELLRRRIKVGIALEKNEYAPYGSSFPKGGNL------QSHTV--KGFD  238

Query  579  KNDTEDNIRSA--------------------------LEGHFGSCGEIKGTRIPTDPEGY  478
             +  E+  +S                           +E  F  CGEI   R+ +D EG 
Sbjct  239  TSLVENKPKSPATPNESLAASKTIYVRNLSYIVERTDMENLFKGCGEIVDIRLHSDREGR  298

Query  477  IKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  361
             KG  +++FA  +A  KAL L+N +    ++ V  A  R
Sbjct  299  FKGFGHVQFATAEAAQKALALDNVEFFKRNIIVGIASER  337


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = -2

Query  609  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  430
            S T++VR    +      R+ +E  F  CGE+   R  TD EG  +G  +IEF   +A  
Sbjct  135  SKTIYVRNLSYSVE----RADMENLFKDCGELVAVRFNTDREGRFRGFGHIEFGTEEAAQ  190

Query  429  KALELNNSQLGHSSLYVDEAKPRND  355
            KALEL+N++L    + V  A  +N+
Sbjct  191  KALELDNTELLRRRIKVGIALEKNE  215



>gb|KEH40855.1| RNA recognition motif [Medicago truncatula]
Length=668

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 74/137 (54%), Gaps = 4/137 (3%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +EAA KAL+L+      R +K+ +A   G   PN      S   Q     +  TVFV GF
Sbjct  491  TEAAEKALQLDHTKFANRPIKVGIAPGEGECFPNRSL---SISFQKGESFQPLTVFVIGF  547

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELNNS  406
            D +  E+ I+++L+ HF  CGEI    +P     G IKG A+++F D D   KAL+L+ +
Sbjct  548  DTSVAEEKIKASLKAHFSPCGEITRISLPRYHDSGNIKGFAHLDFKDIDGYKKALQLDQT  607

Query  405  QLGHSSLYVDEAKPRND  355
             +G   L V +AKPR D
Sbjct  608  AIGDYWLSVVKAKPRRD  624


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 67/157 (43%), Gaps = 33/157 (21%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPN---------------------SGAFD  646
            +EAA KAL+L+  +LL R +++D+A E+  Y P                       G  D
Sbjct  212  AEAAKKALKLDSTELLNRRMRVDIAIEKSGYPPCRSNLSSSVHTGGNLQSHPHTVKGVVD  271

Query  645  --------NssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTD  490
                     S    +     S T++VR           RS +E  F  CGEI   R+ TD
Sbjct  272  ASIVENKPKSPATPNETNVASKTIYVRNLSYTVE----RSDMENIFKDCGEIVDIRLHTD  327

Query  489  PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  379
             EG  KG A+++FA  DA  KAL  N     +  ++V
Sbjct  328  REGKFKGHAHVQFATADAAQKALVFNKKVFYNRLMFV  364



>ref|XP_005849687.1| hypothetical protein CHLNCDRAFT_143267 [Chlorella variabilis]
 gb|EFN57585.1| hypothetical protein CHLNCDRAFT_143267 [Chlorella variabilis]
Length=521

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            E AAKA  L+G+ L+ R++ ++   ER   TP    F            + TT+FV+G+D
Sbjct  311  EGAAKATALSGESLMDRELYIESTTERQQRTPGENRF---------ATSDGTTIFVKGYD  361

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  403
             +  ED +R  L   FG  G +   R+PTD + G +KG+ +IEF   DA  KA+EL+ S+
Sbjct  362  SSLGEDEVRRQLTEAFGEVGAVVSVRLPTDRDTGELKGIGFIEFESTDAKHKAVELDGSE  421

Query  402  LGHSSLYVD  376
            +    + VD
Sbjct  422  VAGGWIKVD  430



>gb|KHM99054.1| Protein gar2 [Glycine soja]
Length=736

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  612  ESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDA  436
            +S TVFV GFD +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  +
Sbjct  537  QSPTVFVTGFDSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVS  596

Query  435  MSKALELNNSQLGHSSLYVDEAKPRND  355
            + KAL L+ ++LG   L V++AKPR D
Sbjct  597  VRKALHLDQNELGGFPLRVEKAKPRRD  623



>emb|CDY16474.1| BnaA08g02930D [Brassica napus]
Length=484

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 8/105 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERG---AY-TPNSGAFDNssqrqsrggGESTTVF  595
            SE A KALELNG+ LLGRD++LD+A ERG   AY TP SG  +  S      G +   +F
Sbjct  270  SEDAQKALELNGRALLGRDIRLDMAAERGDRPAYNTPQSGGGNFRSGGGGGEGQK---IF  326

Query  594  VRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMA  463
            V+GFD +  E++IR AL  HF SCGEI    IP D E G  +G A
Sbjct  327  VKGFDSSLPEEDIRQALTQHFASCGEITRVSIPMDRETGASRGKA  371



>gb|AAF69708.1|AC016041_13 F27J15.29 [Arabidopsis thaliana]
Length=193

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  600  VFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKA  424
            +FV+GFD + +ED+I++ L  HF SCGEIK   +P D + G  KG+AY+EF+  +   KA
Sbjct  47   IFVKGFDASLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFS--EGKEKA  104

Query  423  LELNNSQLGHS-SLYVDEAKP  364
            LELN S +G    L VDE +P
Sbjct  105  LELNGSDMGGGFYLVVDEPRP  125



>gb|EPX72616.1| gar2 [Schizosaccharomyces octosporus yFS286]
Length=481

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -2

Query  759  EAAAKALELNGQ-DLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            EA  KA E++GQ ++ GR V LD++  R +  P       + +   +    S TVFV   
Sbjct  305  EAVKKACEVSGQKEIDGRAVNLDVSAPRPS-NPQPYGQQRAGKFGDQLSAPSDTVFVGNL  363

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
              N TED++ SA    F +CGEI+  R+PTDP+ G +KG  Y+ F+D D+  + +E+N  
Sbjct  364  SFNVTEDDVGSA----FATCGEIQSVRLPTDPQSGRLKGFGYVTFSDIDSAKRCVEMNGH  419

Query  405  QLGHSSLYVDEAKPRN  358
             +      +D + PR 
Sbjct  420  FITGRPCRLDFSTPRT  435



>emb|CAA39224.1| glycine-rich protein [Solanum lycopersicum]
Length=129

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -2

Query  495  TDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSLYVDEAKPRND  355
            TDPEGYIKGMAYIEFA  D DA++KALEL+ S++G  SL V EAKPR D
Sbjct  1    TDPEGYIKGMAYIEFANGDADALNKALELDGSEVGGFSLNVQEAKPRGD  49



>ref|XP_002171551.1| hypothetical protein SJAG_00259 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB05258.1| hypothetical protein SJAG_00259 [Schizosaccharomyces japonicus 
yFS275]
Length=449

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 6/135 (4%)
 Frame = -2

Query  759  EAAAKALELNGQ-DLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            EAA  A+ +NGQ ++ GR V LD++  R A   N  A   +S    +    S TVF+   
Sbjct  258  EAAKAAVAVNGQKEIDGRMVNLDISTPRPAQNNNGFAQQRASNFGDKQSPPSDTVFIGNL  317

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDP-EGYIKGMAYIEFADNDAMSKALELNNS  406
              N TED++R+A    F SCGEI+  R+PTD   G  KG  Y+ F   DA  + +E+N  
Sbjct  318  SFNATEDDVRNA----FSSCGEIQSVRLPTDMNSGRPKGFGYVTFDSIDAAKQCVEMNGH  373

Query  405  QLGHSSLYVDEAKPR  361
             +      +D + PR
Sbjct  374  FIAGRPCRLDFSTPR  388



>ref|XP_010491460.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=278

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 7/126 (6%)
 Frame = -2

Query  747  KALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDK  577
            K LELNG D+ G +V +D    +G   A+ P + AF    + QS+   +STT FV GFD 
Sbjct  38   KVLELNGSDVGGWNVVVDALPNQGPDSAFCPKAAAF----RAQSKRKNQSTTFFVSGFDT  93

Query  576  NDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLG  397
            +  E  I S+L   F SCGEI G  +     G +K  A+I      A  KAL+LN S  G
Sbjct  94   SLPEAYIESSLSKCFSSCGEITGISLCRGVGGVLKSSAFIYILGEGASEKALKLNGSDAG  153

Query  396  HSSLYV  379
               + V
Sbjct  154  GWKVSV  159



>emb|CCG81513.1| Gar2 [Taphrina deformans PYCC 5710]
Length=498

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 72/137 (53%), Gaps = 9/137 (7%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E+A KALE++GQ++ GR V +D++  R A   N+ A    S         S+ VF+   
Sbjct  299  AESAKKALEMSGQEIDGRPVNIDISTPRPAQNNNNRA----SAHGDVQSPPSSVVFIGNL  354

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
                 E+ +  A    FG CGEI+  R+PTD E G  KG  Y++F+  D     + +N  
Sbjct  355  SFEADENAVYEA----FGECGEIQSVRLPTDRETGAAKGFGYVQFSSVDGAKAMVAMNGH  410

Query  405  QLGHSSLYVDEAKPRND  355
             +G   + +D ++PR+D
Sbjct  411  YVGGRPVRLDFSQPRDD  427



>tpg|DAA38878.1| TPA: putative nucleolin-like family protein [Zea mays]
Length=431

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -2

Query  726  QDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  547
            ++L GR+V+ D AK R    P +G   N    Q    G   ++F+RGFDKN +ED I+S+
Sbjct  348  KELHGREVRHDFAKGRSTQNPRNG---NDGSFQKAARGNKNSIFIRGFDKNLSEDEIQSS  404

Query  546  LEGHFGSCGEIKGTRIPTDPE-GYIKG  469
            LE HF  CGE+    IPTD E G IKG
Sbjct  405  LEQHFSDCGEMTRVSIPTDHESGAIKG  431



>ref|XP_009544258.1| hypothetical protein HETIRDRAFT_314076, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW84609.1| hypothetical protein HETIRDRAFT_314076, partial [Heterobasidion 
irregulare TC 32-1]
Length=257

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 75/139 (54%), Gaps = 11/139 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGEST-TVFVRG  586
            +EA   AL+LNG+++ GR V +D  K  G     S + DN ++         T T+FV  
Sbjct  51   AEAVESALKLNGKEIDGRPVNID--KSHGV--DKSTSRDNRAKTFGDSTSPPTSTLFVGN  106

Query  585  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE-LN  412
               + TED    AL   F   GE+K  R+PTD E G +KG  Y+EF D ++  KALE LN
Sbjct  107  LSYDATED----ALWEVFAEYGEVKSIRVPTDRETGKVKGFGYVEFTDLESSKKALEALN  162

Query  411  NSQLGHSSLYVDEAKPRND  355
               +   ++ +D ++PR+D
Sbjct  163  GQDIAGRNVRLDYSQPRDD  181



>ref|NP_593531.1| nucleolar protein required for rRNA processing [Schizosaccharomyces 
pombe 972h-]
 sp|P41891.2|GAR2_SCHPO RecName: Full=Protein gar2 [Schizosaccharomyces pombe 972h-]
 emb|CAB86413.1| nucleolar protein required for rRNA processing [Schizosaccharomyces 
pombe]
Length=500

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 6/123 (5%)
 Frame = -2

Query  726  QDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  547
            +++ GR V LDL+  R A  P   A   +     +    S TVFV     N TED++ +A
Sbjct  327  KEIDGRMVNLDLSNPRPA-NPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNATEDDLSTA  385

Query  546  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEA  370
                FG CG+I+  R+PTDP+ G +KG  Y+ F+D D+  K +E+N   +      +D +
Sbjct  386  ----FGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAGRPCRLDFS  441

Query  369  KPR  361
             PR
Sbjct  442  TPR  444



>ref|XP_010423112.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=139

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 61/126 (48%), Gaps = 7/126 (6%)
 Frame = -2

Query  747  KALELNGQDLLGRDVKLDLAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDK  577
            K LELNG D+ G +V +     +G   A+ P + AF      QS+   +STT  V GFD 
Sbjct  12   KVLELNGSDVGGWNVVVHALPNQGPDSAFCPKAAAFR----AQSKRKNQSTTFLVSGFDT  67

Query  576  NDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLG  397
            +  E  I  +L   F SCGEI G  +     G +K  A+I      A  KAL+LN S  G
Sbjct  68   SLPEAYIERSLSKCFSSCGEITGISLTRGVGGVLKSYAFISILGEGASEKALKLNGSDAG  127

Query  396  HSSLYV  379
               + V
Sbjct  128  GWKVSV  133



>emb|CAA88179.1| gar2 [Schizosaccharomyces pombe]
Length=500

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 6/123 (5%)
 Frame = -2

Query  726  QDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  547
            +++ GR V LDL   R A  P   A   +     +    S TVFV     N TED++ +A
Sbjct  327  KEIDGRMVNLDLPNPRPA-NPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNATEDDLSTA  385

Query  546  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEA  370
                FG CG+I+  R+PTDP+ G +KG  Y+ F+D D+  K +E+N   +      +D +
Sbjct  386  ----FGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAGRPCRLDFS  441

Query  369  KPR  361
             PR
Sbjct  442  TPR  444



>emb|CDJ36172.1| nucleolar phosphoprotein nucleolin, putative [Eimeria mitis]
Length=777

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 8/136 (6%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGE---STTVFVR  589
            EAAAKA+E N  +  GR ++++L+ +R          +  +        +   S  + +R
Sbjct  579  EAAAKAVEFNQTEYEGRTLRINLSADRQQQQQGDRKHEGKNGAPRDDRPKADPSNQIVLR  638

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELN  412
                + TED IR      FG CGEI+  RIP  +  G  +G A++EF   D+ +KALE N
Sbjct  639  NLSFDTTEDTIRET----FGECGEIRAVRIPVFEDSGKPRGQAFLEFDSVDSATKALEFN  694

Query  411  NSQLGHSSLYVDEAKP  364
            N++L   +++V  A P
Sbjct  695  NTELDGRTIWVAYALP  710



>gb|KFK23930.1| hypothetical protein AALP_AAs47265U000100 [Arabis alpina]
Length=234

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 13/107 (12%)
 Frame = -2

Query  684  ERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGT  505
            +R   TP SG   N          +  T+ V+GFD +  ED+I+ AL  +F SCGEI   
Sbjct  103  KRATSTPQSGIGGN----------DDQTIIVKGFDSSLPEDDIKMALSKYFSSCGEITSV  152

Query  504  RIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAK  367
             +PT+ E G + G AYIE    + + KAL+LN + L   +L V++A+
Sbjct  153  VVPTNSETGAVIGCAYIEL--KEGIEKALKLNGNYLRGWNLLVEKAR  197



>emb|CDJ60925.1| nucleolar phosphoprotein nucleolin, putative [Eimeria maxima]
Length=777

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 8/136 (6%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGE---STTVFVR  589
            EAAAKA+E N  +  GR ++++L+ +R          +  +        +   S  + +R
Sbjct  579  EAAAKAVEFNQTEYEGRTLRINLSADRQQQQQGERRHEGKNGAPREDRPKADPSNQIVLR  638

Query  588  GFDKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELN  412
                + TED IR      FG CGEI+  RIP  +  G  +G A++EF   D+ +KALE N
Sbjct  639  NLSFDTTEDTIRET----FGECGEIRAVRIPVFEDSGKPRGQAFLEFDSVDSATKALEFN  694

Query  411  NSQLGHSSLYVDEAKP  364
            N++L   +++V  A P
Sbjct  695  NTELDGRTIWVAYALP  710



>gb|ESA01445.1| hypothetical protein GLOINDRAFT_68561 [Rhizophagus irregularis 
DAOM 181602]
Length=286

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 73/137 (53%), Gaps = 11/137 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E A  A++  G ++ GR + +DLA ++      +G+F   S         S T+F+   
Sbjct  93   AEGANNAVKFAGGEIDGRAINVDLADQK------TGSFKKKSNFSKGTSEVSNTLFIGNL  146

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
              N  ED I       FG+ G+I   R+PT  + G +KG  Y+EFAD +A  KA+EL+ +
Sbjct  147  SFNVIEDEIWET----FGNYGQIVAVRLPTHEDTGKLKGYGYVEFADTNAAQKAMELHGT  202

Query  405  QLGHSSLYVDEAKPRND  355
            ++G  ++ +D ++ + D
Sbjct  203  EIGGRAVRLDFSEGKRD  219



>gb|KFK41492.1| hypothetical protein AALP_AA2G137300 [Arabis alpina]
Length=317

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -2

Query  603  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  427
            T+  + FD    ED+I+ AL  HF SCGEI    +PTDP+ G  KG AYI+    + + K
Sbjct  237  TIIAKEFDYWLPEDDIKKALSKHFTSCGEITSVVVPTDPKTGATKGYAYIQI--KEGVEK  294

Query  426  ALELNNSQLGHSSLYVD  376
            AL+LN S++G  +L V+
Sbjct  295  ALKLNGSEMGGCNLVVE  311



>gb|KIJ32303.1| hypothetical protein M422DRAFT_184633, partial [Sphaerobolus 
stellatus SS14]
Length=225

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 71/138 (51%), Gaps = 12/138 (9%)
 Frame = -2

Query  759  EAAAKALE-LNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            E A  ALE L G+++ GR VKLDL+  R   TPN  A   + Q        S T+FV   
Sbjct  51   ELALTALEQLQGKEIDGRAVKLDLSTPR---TPNPVA--RAKQFGDVPSEPSPTLFVGNI  105

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALE-LNN  409
              N  ED     L  HFG+ G +   R+PTD E G  KG AY+EF D     KALE    
Sbjct  106  SWNTNED----MLWEHFGTYGAVSSVRVPTDRETGKPKGFAYVEFGDVGTAKKALEGSTG  161

Query  408  SQLGHSSLYVDEAKPRND  355
            + +   ++ +D ++PR++
Sbjct  162  ADIDGRNIRLDYSQPRDN  179



>gb|KFK41567.1| hypothetical protein AALP_AA2G146000 [Arabis alpina]
Length=259

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 13/106 (12%)
 Frame = -2

Query  684  ERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGT  505
            +R AYTP SG   N          +  T+ V+GFD +  E +I+S L  +F  CGEI   
Sbjct  117  KRTAYTPQSGIGGN----------DDQTIIVKGFDSSLHEGDIKSELNKYFSLCGEITSV  166

Query  504  RIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEA  370
             +PTD E G + G AYIE    + + KAL+LN S L    L V++ 
Sbjct  167  VVPTDTETGAVIGCAYIEL--KEGVEKALKLNGSYLKGWKLVVEKV  210



>emb|CDJ50319.1| nucleolar phosphoprotein nucleolin, putative [Eimeria brunetti]
Length=779

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 71/142 (50%), Gaps = 19/142 (13%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTP---------NSGAFDNssqrqsrggGES  607
            EAAAKA+E N  +  GR ++++L+ +R              N    D+  +        S
Sbjct  580  EAAAKAVEFNQTEYEGRTLRINLSADRQQQQQQGDRKHEGKNGAPRDDRPKAD-----PS  634

Query  606  TTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMS  430
              + +R    + TED +R      FG CGEI+  RIP  +  G  +G A++EF   D+ +
Sbjct  635  NQIVLRNLSFDTTEDTLRET----FGECGEIRAVRIPVFEDSGKPRGQAFLEFDSVDSAT  690

Query  429  KALELNNSQLGHSSLYVDEAKP  364
            KALE NN++L   +++V  A P
Sbjct  691  KALEFNNTELDGRTIWVAYALP  712



>ref|XP_001837329.1| single-stranded DNA binding protein [Coprinopsis cinerea okayama7#130]
 gb|EAU84946.1| single-stranded DNA binding protein [Coprinopsis cinerea okayama7#130]
Length=569

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 10/137 (7%)
 Frame = -2

Query  759  EAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFD  580
            EAA KALELNG+++  R +K+D++  R    P++     +          S T+FV    
Sbjct  379  EAAQKALELNGKEIDNRPIKVDISTPR---NPDAARQKRAQTFGDVTSPPSNTLFVGNLS  435

Query  579  KNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNN-S  406
             N +ED++ S L   +G    +K  R+PTD E G  KG  Y+EF D +   KA E NN +
Sbjct  436  FNTSEDSVWS-LFNDYG----VKSVRLPTDRESGRPKGFGYVEFEDVEGAKKAFEANNGA  490

Query  405  QLGHSSLYVDEAKPRND  355
             L    + +D ++PR++
Sbjct  491  DLDGRPIRLDYSQPRDN  507



>gb|EXX76493.1| Nsr1p [Rhizophagus irregularis DAOM 197198w]
Length=514

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 73/137 (53%), Gaps = 11/137 (8%)
 Frame = -2

Query  762  SEAAAKALELNGQDLLGRDVKLDLAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGF  583
            +E A  A++  G ++ GR + +DLA ++      +G+F   S         S T+F+   
Sbjct  321  AEGANNAVKFAGGEIDGRAINVDLADQK------TGSFKKKSNFSKGTSEVSNTLFIGNL  374

Query  582  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  406
              N  ED I       FG+ G+I   R+PT  + G +KG  Y+EFAD +A  KA+EL+ +
Sbjct  375  SFNVIEDEIWET----FGNYGQIVAVRLPTHEDTGKLKGYGYVEFADTNAAQKAMELHGT  430

Query  405  QLGHSSLYVDEAKPRND  355
            ++G  ++ +D ++ + D
Sbjct  431  EIGGRAVRLDFSEGKRD  447



>ref|XP_010443562.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=229

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -2

Query  603  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  427
            T+FV+GFD + + D+I+SALE HFGSCGEI    +P + + G   G A+I+   NDA  K
Sbjct  86   TIFVKGFDCSLSRDDIKSALEKHFGSCGEISRIFVPFECQTGSPLGYAFIDLR-NDA-KK  143

Query  426  ALELNNSQLGHSSLYVDEAKPRND  355
            AL L+ S LG   L V  A  R +
Sbjct  144  ALTLDGSYLGSMKLEVVMANSRTE  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680