BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016G12

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361346.1|  PREDICTED: dentin sialophosphoprotein-like i...    227   5e-65   Solanum tuberosum [potatoes]
ref|XP_006361345.1|  PREDICTED: dentin sialophosphoprotein-like i...    227   5e-65   Solanum tuberosum [potatoes]
ref|XP_006361347.1|  PREDICTED: dentin sialophosphoprotein-like i...    226   5e-65   Solanum tuberosum [potatoes]
ref|XP_009599552.1|  PREDICTED: uncharacterized protein LOC104095...    226   8e-65   Nicotiana tomentosiformis
ref|XP_009599554.1|  PREDICTED: uncharacterized protein LOC104095...    226   8e-65   Nicotiana tomentosiformis
ref|XP_009599553.1|  PREDICTED: uncharacterized protein LOC104095...    226   8e-65   Nicotiana tomentosiformis
ref|XP_009757816.1|  PREDICTED: uncharacterized protein LOC104210...    224   5e-64   Nicotiana sylvestris
ref|XP_009757818.1|  PREDICTED: uncharacterized protein LOC104210...    223   7e-64   Nicotiana sylvestris
ref|XP_009757817.1|  PREDICTED: uncharacterized protein LOC104210...    223   7e-64   Nicotiana sylvestris
ref|XP_011072651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    222   3e-63   
ref|XP_010314322.1|  PREDICTED: uncharacterized protein LOC101258...    218   4e-62   Solanum lycopersicum
ref|XP_010314324.1|  PREDICTED: uncharacterized protein LOC101258...    218   4e-62   Solanum lycopersicum
ref|XP_004252392.1|  PREDICTED: uncharacterized protein LOC101258...    218   5e-62   Solanum lycopersicum
ref|XP_010314323.1|  PREDICTED: uncharacterized protein LOC101258...    218   5e-62   Solanum lycopersicum
ref|XP_010314325.1|  PREDICTED: uncharacterized protein LOC101258...    218   5e-62   Solanum lycopersicum
ref|XP_010654468.1|  PREDICTED: uncharacterized protein LOC100248...    215   7e-61   Vitis vinifera
ref|XP_010654472.1|  PREDICTED: uncharacterized protein LOC100248...    215   7e-61   Vitis vinifera
ref|XP_010654470.1|  PREDICTED: uncharacterized protein LOC100248...    215   8e-61   Vitis vinifera
ref|XP_010654469.1|  PREDICTED: uncharacterized protein LOC100248...    215   8e-61   Vitis vinifera
emb|CBI35892.3|  unnamed protein product                                214   1e-60   Vitis vinifera
emb|CAN69468.1|  hypothetical protein VITISV_042555                     214   2e-60   Vitis vinifera
gb|EYU21338.1|  hypothetical protein MIMGU_mgv1a001286mg                209   7e-59   Erythranthe guttata [common monkey flower]
emb|CDO97864.1|  unnamed protein product                                209   1e-58   Coffea canephora [robusta coffee]
ref|XP_008464007.1|  PREDICTED: uncharacterized protein LOC103501...    203   1e-56   Cucumis melo [Oriental melon]
ref|XP_008464006.1|  PREDICTED: uncharacterized protein LOC103501...    203   1e-56   
ref|XP_004163891.1|  PREDICTED: uncharacterized protein LOC101226902    202   3e-56   
ref|XP_006583149.1|  PREDICTED: dentin sialophosphoprotein-like i...    202   4e-56   Glycine max [soybeans]
ref|XP_006583148.1|  PREDICTED: dentin sialophosphoprotein-like i...    201   4e-56   Glycine max [soybeans]
ref|XP_003528451.1|  PREDICTED: dentin sialophosphoprotein-like i...    201   4e-56   Glycine max [soybeans]
ref|XP_010087685.1|  hypothetical protein L484_013447                   201   5e-56   
ref|XP_010273948.1|  PREDICTED: uncharacterized protein LOC104609...    201   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010273947.1|  PREDICTED: uncharacterized protein LOC104609...    201   7e-56   Nelumbo nucifera [Indian lotus]
ref|XP_007135474.1|  hypothetical protein PHAVU_010G132600g             200   1e-55   Phaseolus vulgaris [French bean]
gb|KGN59790.1|  hypothetical protein Csa_3G846060                       199   3e-55   Cucumis sativus [cucumbers]
ref|XP_002304144.2|  hypothetical protein POPTR_0003s06200g             199   4e-55   
ref|XP_006598817.1|  PREDICTED: putative uncharacterized protein ...    199   4e-55   Glycine max [soybeans]
gb|KHN39644.1|  hypothetical protein glysoja_020722                     199   5e-55   Glycine soja [wild soybean]
ref|XP_008391371.1|  PREDICTED: dentin sialophosphoprotein-like i...    198   9e-55   Malus domestica [apple tree]
ref|XP_008391372.1|  PREDICTED: chitinase-like protein PB1E7.04c ...    198   9e-55   Malus domestica [apple tree]
ref|XP_010062690.1|  PREDICTED: uncharacterized protein LOC104450...    194   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010062689.1|  PREDICTED: uncharacterized protein LOC104450...    194   2e-53   Eucalyptus grandis [rose gum]
gb|KHG27656.1|  ATP-dependent zinc metalloprotease FtsH                 194   3e-53   Gossypium arboreum [tree cotton]
gb|KJB70099.1|  hypothetical protein B456_011G058000                    194   3e-53   Gossypium raimondii
gb|KJB70100.1|  hypothetical protein B456_011G058000                    193   3e-53   Gossypium raimondii
gb|KJB70102.1|  hypothetical protein B456_011G058000                    193   3e-53   Gossypium raimondii
ref|XP_009339841.1|  PREDICTED: uncharacterized protein LOC103932...    193   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_009339833.1|  PREDICTED: uncharacterized protein LOC103932...    193   4e-53   Pyrus x bretschneideri [bai li]
gb|KJB70103.1|  hypothetical protein B456_011G058000                    193   4e-53   Gossypium raimondii
gb|KJB70104.1|  hypothetical protein B456_011G058000                    193   4e-53   Gossypium raimondii
ref|XP_009339824.1|  PREDICTED: uncharacterized protein LOC103932...    193   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_010261965.1|  PREDICTED: uncharacterized protein LOC104600...    192   7e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010261966.1|  PREDICTED: uncharacterized protein LOC104600...    192   8e-53   Nelumbo nucifera [Indian lotus]
ref|XP_007024586.1|  Uncharacterized protein isoform 3                  191   2e-52   
ref|XP_007024588.1|  Uncharacterized protein isoform 5                  191   2e-52   
ref|XP_007024589.1|  Uncharacterized protein isoform 6                  191   2e-52   
ref|XP_007024587.1|  Uncharacterized protein isoform 4                  191   2e-52   
ref|XP_007024585.1|  Uncharacterized protein isoform 2                  191   2e-52   
ref|XP_007024584.1|  Uncharacterized protein isoform 1                  191   3e-52   
ref|XP_011035693.1|  PREDICTED: uncharacterized protein LOC105133...    190   4e-52   Populus euphratica
ref|XP_011035692.1|  PREDICTED: uncharacterized protein LOC105133...    190   5e-52   Populus euphratica
ref|XP_002299597.2|  hydroxyproline-rich glycoprotein                   187   7e-51   Populus trichocarpa [western balsam poplar]
gb|KDO65081.1|  hypothetical protein CISIN_1g040475mg                   186   1e-50   Citrus sinensis [apfelsine]
ref|XP_006465941.1|  PREDICTED: dentin sialophosphoprotein-like         186   1e-50   Citrus sinensis [apfelsine]
ref|XP_006426627.1|  hypothetical protein CICLE_v10024871mg             186   1e-50   Citrus clementina [clementine]
ref|XP_006426626.1|  hypothetical protein CICLE_v10024871mg             186   1e-50   Citrus clementina [clementine]
ref|XP_008338697.1|  PREDICTED: cell wall protein RBR3-like isofo...    184   2e-50   
gb|KDP40717.1|  hypothetical protein JCGZ_24716                         185   4e-50   Jatropha curcas
ref|XP_009372374.1|  PREDICTED: uncharacterized protein LOC103961...    185   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_008338694.1|  PREDICTED: dentin sialophosphoprotein-like i...    185   4e-50   
ref|XP_008338696.1|  PREDICTED: dentin sialophosphoprotein-like i...    185   4e-50   
ref|XP_009372373.1|  PREDICTED: uncharacterized protein LOC103961...    185   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_008338695.1|  PREDICTED: dentin sialophosphoprotein-like i...    185   5e-50   
ref|XP_011467415.1|  PREDICTED: uncharacterized protein LOC101293...    184   2e-49   Fragaria vesca subsp. vesca
ref|XP_004303676.1|  PREDICTED: uncharacterized protein LOC101293...    184   2e-49   Fragaria vesca subsp. vesca
ref|XP_002521347.1|  conserved hypothetical protein                     181   1e-48   Ricinus communis
ref|XP_008228220.1|  PREDICTED: probable secreted beta-glucosidas...    179   4e-48   Prunus mume [ume]
ref|XP_008228218.1|  PREDICTED: probable GPI-anchored adhesin-lik...    179   4e-48   
ref|XP_008228221.1|  PREDICTED: probable GPI-anchored adhesin-lik...    179   4e-48   
ref|XP_008228219.1|  PREDICTED: probable secreted beta-glucosidas...    179   4e-48   
ref|XP_008228216.1|  PREDICTED: probable secreted beta-glucosidas...    179   5e-48   
ref|XP_008228217.1|  PREDICTED: probable secreted beta-glucosidas...    179   5e-48   Prunus mume [ume]
ref|XP_004510436.1|  PREDICTED: flocculation protein FLO11-like         179   7e-48   Cicer arietinum [garbanzo]
gb|KJB70101.1|  hypothetical protein B456_011G058000                    177   3e-47   Gossypium raimondii
gb|KEH18456.1|  plant/MDC16-11 protein                                  177   4e-47   Medicago truncatula
ref|XP_007214970.1|  hypothetical protein PRUPE_ppa001749mg             174   1e-46   
ref|XP_010932459.1|  PREDICTED: RNA polymerase II degradation fac...    169   1e-44   Elaeis guineensis
ref|XP_010932458.1|  PREDICTED: RNA polymerase II degradation fac...    170   2e-44   
ref|XP_010685333.1|  PREDICTED: uncharacterized protein LOC104899...    166   2e-43   
ref|XP_010685331.1|  PREDICTED: uncharacterized protein LOC104899...    166   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010685332.1|  PREDICTED: uncharacterized protein LOC104899...    166   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010542407.1|  PREDICTED: uncharacterized protein LOC104815...    165   7e-43   Tarenaya hassleriana [spider flower]
ref|XP_010487183.1|  PREDICTED: uncharacterized protein LOC104765...    163   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010487182.1|  PREDICTED: uncharacterized protein LOC104765...    163   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010465278.1|  PREDICTED: uncharacterized protein LOC104745...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010465277.1|  PREDICTED: uncharacterized protein LOC104745...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010465276.1|  PREDICTED: uncharacterized protein LOC104745...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010501510.1|  PREDICTED: uncharacterized protein LOC104778...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010501505.1|  PREDICTED: uncharacterized protein LOC104778...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010501517.1|  PREDICTED: uncharacterized protein LOC104778...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010501500.1|  PREDICTED: uncharacterized protein LOC104778...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010501523.1|  PREDICTED: uncharacterized protein LOC104778...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010542408.1|  PREDICTED: uncharacterized protein LOC104815...    159   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_010542405.1|  PREDICTED: uncharacterized protein LOC104815...    160   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_010542406.1|  PREDICTED: uncharacterized protein LOC104815...    160   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_008784271.1|  PREDICTED: uncharacterized protein LOC103703...    160   5e-41   Phoenix dactylifera
ref|XP_008784270.1|  PREDICTED: uncharacterized protein LOC103703...    159   6e-41   Phoenix dactylifera
ref|XP_010654471.1|  PREDICTED: uncharacterized protein LOC100248...    159   7e-41   Vitis vinifera
ref|XP_002885002.1|  hypothetical protein ARALYDRAFT_478805             158   2e-40   
emb|CDY33258.1|  BnaC01g37310D                                          156   7e-40   Brassica napus [oilseed rape]
ref|XP_009117284.1|  PREDICTED: uncharacterized protein LOC103842...    156   1e-39   Brassica rapa
emb|CDY39087.1|  BnaA01g29690D                                          154   4e-39   Brassica napus [oilseed rape]
ref|XP_006296970.1|  hypothetical protein CARUB_v10012965mg             154   6e-39   Capsella rubella
emb|CDY65326.1|  BnaCnng46620D                                          153   1e-38   Brassica napus [oilseed rape]
gb|AFK36533.1|  unknown                                                 142   1e-38   Lotus japonicus
ref|XP_008797695.1|  PREDICTED: uncharacterized protein LOC103712...    150   3e-38   Phoenix dactylifera
ref|XP_008797704.1|  PREDICTED: uncharacterized protein LOC103712...    150   3e-38   Phoenix dactylifera
ref|XP_008791894.1|  PREDICTED: uncharacterized protein LOC103708646    150   3e-38   
ref|XP_008797689.1|  PREDICTED: uncharacterized protein LOC103712...    150   4e-38   
ref|XP_008797682.1|  PREDICTED: uncharacterized protein LOC103712...    151   5e-38   Phoenix dactylifera
emb|CDX97535.1|  BnaA05g25440D                                          151   5e-38   
ref|XP_008797669.1|  PREDICTED: uncharacterized protein LOC103712...    151   6e-38   Phoenix dactylifera
ref|XP_008797675.1|  PREDICTED: uncharacterized protein LOC103712...    150   8e-38   Phoenix dactylifera
ref|XP_008797659.1|  PREDICTED: uncharacterized protein LOC103712...    151   8e-38   Phoenix dactylifera
ref|XP_009146424.1|  PREDICTED: uncharacterized protein LOC103870...    150   1e-37   Brassica rapa
ref|XP_009146423.1|  PREDICTED: uncharacterized protein LOC103870...    150   1e-37   Brassica rapa
ref|XP_009146425.1|  PREDICTED: uncharacterized protein LOC103870...    150   1e-37   Brassica rapa
ref|NP_001078149.1|  kinase-related protein                             149   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188015.2|  kinase-related protein                                149   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38756.1|  hypothetical protein AALP_AA3G156400                    147   1e-36   Arabis alpina [alpine rockcress]
gb|KFK38755.1|  hypothetical protein AALP_AA3G156400                    147   1e-36   Arabis alpina [alpine rockcress]
gb|KFK38754.1|  hypothetical protein AALP_AA3G156400                    147   1e-36   Arabis alpina [alpine rockcress]
ref|XP_010917134.1|  PREDICTED: eukaryotic translation initiation...    145   6e-36   
ref|XP_010917133.1|  PREDICTED: uncharacterized protein LOC105041...    145   9e-36   Elaeis guineensis
ref|XP_010917132.1|  PREDICTED: uncharacterized protein LOC105041...    145   9e-36   Elaeis guineensis
ref|XP_010936970.1|  PREDICTED: uncharacterized protein LOC105056...    144   1e-35   Elaeis guineensis
ref|XP_010936968.1|  PREDICTED: uncharacterized protein LOC105056...    144   1e-35   Elaeis guineensis
dbj|BAB02329.1|  unnamed protein product                                142   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391448.1|  PREDICTED: uncharacterized protein LOC103977608    142   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006392706.1|  hypothetical protein EUTSA_v10011240mg             139   8e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006392705.1|  hypothetical protein EUTSA_v10011240mg             139   9e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009146426.1|  PREDICTED: uncharacterized protein LOC103870...    137   5e-33   Brassica rapa
emb|CAN64817.1|  hypothetical protein VITISV_010669                     133   1e-32   Vitis vinifera
ref|XP_009117292.1|  PREDICTED: uncharacterized protein LOC103842...    135   2e-32   Brassica rapa
dbj|BAK02193.1|  predicted protein                                      131   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT03241.1|  hypothetical protein F775_28234                         130   1e-30   
gb|EMS49912.1|  hypothetical protein TRIUR3_09953                       130   1e-30   Triticum urartu
gb|AFW85388.1|  putative DUF1296 domain containing family protein       123   3e-30   
ref|XP_002436662.1|  hypothetical protein SORBIDRAFT_10g006740          129   3e-30   Sorghum bicolor [broomcorn]
ref|NP_001182930.1|  uncharacterized protein LOC100501220               123   5e-30   
ref|XP_010534929.1|  PREDICTED: uncharacterized protein LOC104810...    128   8e-30   Tarenaya hassleriana [spider flower]
ref|XP_010534930.1|  PREDICTED: uncharacterized protein LOC104810...    127   9e-30   Tarenaya hassleriana [spider flower]
gb|AFW85389.1|  putative DUF1296 domain containing family protein       124   2e-29   
ref|XP_006656745.1|  PREDICTED: uncharacterized protein LOC102709938    125   1e-28   
ref|XP_008658959.1|  PREDICTED: uncharacterized protein LOC100501...    124   2e-28   Zea mays [maize]
ref|XP_008658958.1|  PREDICTED: uncharacterized protein LOC100501...    124   2e-28   Zea mays [maize]
ref|XP_008658956.1|  PREDICTED: uncharacterized protein LOC100501...    124   2e-28   Zea mays [maize]
ref|XP_008658957.1|  PREDICTED: uncharacterized protein LOC100501...    124   2e-28   
ref|XP_008648067.1|  PREDICTED: uncharacterized protein LOC100382...    122   7e-28   Zea mays [maize]
ref|NP_001168331.1|  uncharacterized protein LOC100382099               122   8e-28   Zea mays [maize]
ref|XP_010227879.1|  PREDICTED: uncharacterized protein LOC100833...    120   4e-27   Brachypodium distachyon [annual false brome]
ref|XP_010227878.1|  PREDICTED: uncharacterized protein LOC100833...    120   5e-27   Brachypodium distachyon [annual false brome]
ref|XP_004964933.1|  PREDICTED: uncharacterized protein LOC101755...    119   8e-27   Setaria italica
ref|XP_004964934.1|  PREDICTED: uncharacterized protein LOC101755...    119   8e-27   Setaria italica
ref|XP_009393682.1|  PREDICTED: uncharacterized protein LOC103979312    117   2e-26   
gb|AAL68853.1|AF466199_12  gb protein                                   116   1e-25   Sorghum bicolor [broomcorn]
ref|XP_006849608.1|  hypothetical protein AMTR_s00024p00204950          114   5e-25   
gb|AAT08008.1|  unknown                                                 110   1e-23   Zea mays [maize]
ref|NP_001057094.1|  Os06g0206100                                       103   2e-21   
gb|EEE65290.1|  hypothetical protein OsJ_20522                          103   2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80202.1|  hypothetical protein OsI_22088                          103   3e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_009792824.1|  PREDICTED: uncharacterized protein LOC104239...  97.1    2e-20   Nicotiana sylvestris
ref|XP_009792827.1|  PREDICTED: uncharacterized protein LOC104239...  97.1    2e-20   Nicotiana sylvestris
ref|XP_009792829.1|  PREDICTED: uncharacterized protein LOC104239...  95.9    3e-20   Nicotiana sylvestris
ref|XP_009792828.1|  PREDICTED: uncharacterized protein LOC104239...  95.5    4e-20   Nicotiana sylvestris
ref|XP_004141213.1|  PREDICTED: uncharacterized protein LOC101203238  96.7    4e-19   
gb|AFW85390.1|  putative DUF1296 domain containing family protein     90.5    8e-18   
gb|AFW85392.1|  putative DUF1296 domain containing family protein     90.5    6e-17   
ref|XP_010228510.1|  PREDICTED: uncharacterized protein LOC100821...  90.1    8e-17   Brachypodium distachyon [annual false brome]
ref|XP_010228511.1|  PREDICTED: uncharacterized protein LOC100821...  89.7    8e-17   Brachypodium distachyon [annual false brome]
ref|XP_004984048.1|  PREDICTED: uncharacterized protein LOC101768...  87.4    5e-16   Setaria italica
ref|XP_004984047.1|  PREDICTED: uncharacterized protein LOC101768...  87.4    5e-16   Setaria italica
gb|AAO37496.1|  unknown protein, 5'-partial                           84.0    6e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050346.1|  Os03g0411000                                     84.3    6e-15   
gb|EAY90426.1|  hypothetical protein OsI_12013                        82.8    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006651495.1|  PREDICTED: uncharacterized protein LOC102714907  81.6    4e-14   
gb|EPS69389.1|  hypothetical protein M569_05380                       80.1    9e-14   Genlisea aurea
ref|XP_008783012.1|  PREDICTED: uncharacterized protein LOC103702...  78.6    4e-13   Phoenix dactylifera
ref|XP_010942574.1|  PREDICTED: uncharacterized protein LOC105060...  78.6    5e-13   
ref|XP_010942570.1|  PREDICTED: uncharacterized protein LOC105060...  78.2    5e-13   Elaeis guineensis
ref|XP_008797742.1|  PREDICTED: uncharacterized protein LOC103712...  75.1    6e-12   Phoenix dactylifera
ref|XP_008797740.1|  PREDICTED: uncharacterized protein LOC103712...  75.1    6e-12   Phoenix dactylifera
tpg|DAA45760.1|  TPA: hypothetical protein ZEAMMB73_654486            74.3    7e-12   
ref|XP_008783017.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    9e-12   Phoenix dactylifera
ref|XP_008783018.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    9e-12   Phoenix dactylifera
ref|XP_008783015.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    9e-12   Phoenix dactylifera
ref|XP_008783016.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    1e-11   Phoenix dactylifera
ref|XP_008783011.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    1e-11   Phoenix dactylifera
ref|XP_008783009.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    1e-11   Phoenix dactylifera
ref|XP_008783014.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    1e-11   Phoenix dactylifera
ref|XP_008783013.1|  PREDICTED: uncharacterized protein LOC103702...  74.3    1e-11   Phoenix dactylifera
ref|XP_010942572.1|  PREDICTED: uncharacterized protein LOC105060...  74.3    1e-11   Elaeis guineensis
ref|XP_010942575.1|  PREDICTED: uncharacterized protein LOC105060...  74.3    1e-11   Elaeis guineensis
tpg|DAA45759.1|  TPA: hypothetical protein ZEAMMB73_654486            73.9    1e-11   
ref|XP_010942569.1|  PREDICTED: uncharacterized protein LOC105060...  73.9    1e-11   Elaeis guineensis
ref|XP_010942571.1|  PREDICTED: uncharacterized protein LOC105060...  73.9    1e-11   Elaeis guineensis
ref|XP_010942576.1|  PREDICTED: uncharacterized protein LOC105060...  73.9    1e-11   Elaeis guineensis
ref|XP_008797743.1|  PREDICTED: uncharacterized protein LOC103712...  70.9    1e-10   Phoenix dactylifera
ref|XP_008797741.1|  PREDICTED: uncharacterized protein LOC103712...  70.5    1e-10   Phoenix dactylifera
ref|XP_008797739.1|  PREDICTED: uncharacterized protein LOC103712...  70.5    2e-10   Phoenix dactylifera
ref|XP_009412058.1|  PREDICTED: uncharacterized protein LOC103993639  70.5    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407930.1|  PREDICTED: uncharacterized protein LOC103990491  67.0    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929039.1|  PREDICTED: uncharacterized protein LOC105050...  66.6    3e-09   Elaeis guineensis
ref|XP_010929036.1|  PREDICTED: uncharacterized protein LOC105050...  66.6    3e-09   Elaeis guineensis
ref|XP_010929038.1|  PREDICTED: uncharacterized protein LOC105050...  66.6    3e-09   Elaeis guineensis
ref|XP_010929035.1|  PREDICTED: uncharacterized protein LOC105050...  66.6    3e-09   Elaeis guineensis
ref|XP_010088348.1|  hypothetical protein L484_004856                 63.9    7e-09   
ref|XP_009361529.1|  PREDICTED: uncharacterized protein LOC103951...  60.8    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009361530.1|  PREDICTED: mucin-12 isoform X2                   60.8    2e-07   
ref|XP_009391914.1|  PREDICTED: uncharacterized protein LOC103977...  60.8    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006575395.1|  PREDICTED: cell wall protein AWA1-like           60.1    4e-07   Glycine max [soybeans]
gb|KHN46209.1|  hypothetical protein glysoja_039933                   60.1    4e-07   Glycine soja [wild soybean]
gb|AES98495.2|  MLP3.11 protein                                       59.7    6e-07   Medicago truncatula
gb|KDP29958.1|  hypothetical protein JCGZ_18527                       59.3    6e-07   Jatropha curcas
ref|XP_008380020.1|  PREDICTED: flocculation protein FLO11-like i...  58.9    8e-07   
ref|XP_008380021.1|  PREDICTED: flocculation protein FLO11-like i...  58.9    9e-07   
ref|XP_008462126.1|  PREDICTED: flocculation protein FLO11            58.9    9e-07   Cucumis melo [Oriental melon]
ref|XP_008342252.1|  PREDICTED: flocculation protein FLO11-like i...  58.9    1e-06   
ref|XP_008342251.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  58.9    1e-06   
ref|XP_010252823.1|  PREDICTED: uncharacterized protein LOC104594...  58.9    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_007141366.1|  hypothetical protein PHAVU_008G189700g           58.9    1e-06   Phaseolus vulgaris [French bean]
ref|XP_010252820.1|  PREDICTED: uncharacterized protein LOC104594...  58.9    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010252821.1|  PREDICTED: uncharacterized protein LOC104594...  58.9    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010252822.1|  PREDICTED: uncharacterized protein LOC104594...  58.5    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_003615537.1|  hypothetical protein MTR_5g069290                57.8    3e-06   
ref|XP_010237341.1|  PREDICTED: uncharacterized protein LOC100835561  57.4    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_006660473.1|  PREDICTED: flocculation protein FLO11-like       56.6    6e-06   
gb|KHN40032.1|  hypothetical protein glysoja_009409                   56.6    6e-06   Glycine soja [wild soybean]
ref|XP_003544279.1|  PREDICTED: cell wall protein AWA1-like           56.2    7e-06   Glycine max [soybeans]
ref|XP_009391913.1|  PREDICTED: uncharacterized protein LOC103977...  56.2    8e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010245043.1|  PREDICTED: uncharacterized protein LOC104588...  56.2    8e-06   Nelumbo nucifera [Indian lotus]
gb|EEE69302.1|  hypothetical protein OsJ_28583                        56.2    8e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84205.1|  hypothetical protein OsI_30606                        56.2    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010245040.1|  PREDICTED: uncharacterized protein LOC104588...  56.2    8e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010942882.1|  PREDICTED: uncharacterized protein LOC105060...  55.8    9e-06   Elaeis guineensis
dbj|BAD29556.1|  hydroxyproline-rich glycoprotein family protein-...  55.8    9e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26073.1|  hypothetical protein F775_05710                       55.8    9e-06   
gb|EMS48403.1|  hypothetical protein TRIUR3_27107                     55.8    9e-06   Triticum urartu
ref|XP_010245041.1|  PREDICTED: uncharacterized protein LOC104588...  55.8    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010942881.1|  PREDICTED: uncharacterized protein LOC105060...  55.8    1e-05   Elaeis guineensis
ref|XP_010942880.1|  PREDICTED: uncharacterized protein LOC105060...  55.8    1e-05   Elaeis guineensis
ref|XP_010245042.1|  PREDICTED: RNA polymerase II degradation fac...  55.8    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010942883.1|  PREDICTED: uncharacterized protein LOC105060...  55.8    1e-05   
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           55.8    1e-05   Citrus clementina [clementine]
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           55.8    1e-05   Citrus clementina [clementine]
ref|XP_004502111.1|  PREDICTED: flocculation protein FLO11-like       55.1    2e-05   Cicer arietinum [garbanzo]
ref|XP_004490553.1|  PREDICTED: flocculation protein FLO11-like       54.7    2e-05   Cicer arietinum [garbanzo]
ref|XP_010657492.1|  PREDICTED: uncharacterized protein LOC100245...  54.7    3e-05   Vitis vinifera
ref|XP_010657491.1|  PREDICTED: uncharacterized protein LOC100245...  54.7    3e-05   Vitis vinifera
ref|XP_002267265.1|  PREDICTED: uncharacterized protein LOC100245...  54.7    3e-05   Vitis vinifera
ref|XP_007214926.1|  hypothetical protein PRUPE_ppa001246mg           54.3    3e-05   Prunus persica
ref|XP_004144622.1|  PREDICTED: uncharacterized protein LOC101212400  54.3    3e-05   Cucumis sativus [cucumbers]
ref|XP_008802665.1|  PREDICTED: flocculation protein FLO11-like i...  54.3    3e-05   
ref|XP_008802663.1|  PREDICTED: flocculation protein FLO11-like i...  54.3    3e-05   
ref|XP_004162890.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    3e-05   
ref|XP_008229781.1|  PREDICTED: cell wall protein AWA1 isoform X1     53.9    4e-05   Prunus mume [ume]
ref|XP_008229782.1|  PREDICTED: putative GPI-anchored protein PB1...  53.9    5e-05   Prunus mume [ume]
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  53.9    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  53.9    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  53.5    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_002320531.2|  hypothetical protein POPTR_0014s16780g           53.5    7e-05   
ref|XP_011007010.1|  PREDICTED: uncharacterized protein LOC105112...  53.1    9e-05   Populus euphratica
ref|XP_011007012.1|  PREDICTED: uncharacterized protein LOC105112...  52.8    1e-04   Populus euphratica
ref|XP_011008079.1|  PREDICTED: flocculation protein FLO11            52.8    1e-04   Populus euphratica
emb|CAN73914.1|  hypothetical protein VITISV_035233                   52.8    1e-04   Vitis vinifera
ref|XP_010644610.1|  PREDICTED: RNA polymerase II degradation fac...  52.4    1e-04   Vitis vinifera
ref|XP_010644609.1|  PREDICTED: RNA polymerase II degradation fac...  52.4    1e-04   Vitis vinifera
ref|XP_010644611.1|  PREDICTED: RNA polymerase II degradation fac...  52.4    1e-04   Vitis vinifera
ref|XP_002301574.2|  hypothetical protein POPTR_0002s22320g           52.4    2e-04   
ref|NP_001062710.2|  Os09g0261500                                     49.7    2e-04   
ref|XP_006857739.1|  hypothetical protein AMTR_s00061p00187940        52.0    2e-04   
gb|KJB81586.1|  hypothetical protein B456_013G150900                  51.6    3e-04   
ref|XP_002532215.1|  conserved hypothetical protein                   51.6    3e-04   
gb|AFB33599.1|  hypothetical protein 2_7918_01                        48.5    4e-04   
ref|XP_002964401.1|  hypothetical protein SELMODRAFT_438753           50.4    6e-04   
ref|XP_002967632.1|  hypothetical protein SELMODRAFT_440086           50.4    6e-04   



>ref|XP_006361346.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Solanum 
tuberosum]
Length=838

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  664  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNLYVPNPQ  723

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH AY+PSHSGHASFN  AAAAAA AQSSHMQ
Sbjct  724  AETSEMWMNPRDISTMQSGSYYSMSGQTPHAAYLPSHSGHASFN--AAAAAAAAQSSHMQ  781

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            FP  + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  782  FPGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  838



>ref|XP_006361345.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Solanum 
tuberosum]
Length=839

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  665  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNLYVPNPQ  724

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH AY+PSHSGHASFN  AAAAAA AQSSHMQ
Sbjct  725  AETSEMWMNPRDISTMQSGSYYSMSGQTPHAAYLPSHSGHASFN--AAAAAAAAQSSHMQ  782

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            FP  + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  783  FPGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  839



>ref|XP_006361347.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Solanum 
tuberosum]
Length=837

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  663  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNLYVPNPQ  722

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH AY+PSHSGHASFN  AAAAAA AQSSHMQ
Sbjct  723  AETSEMWMNPRDISTMQSGSYYSMSGQTPHAAYLPSHSGHASFN--AAAAAAAAQSSHMQ  780

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            FP  + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  781  FPGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  837



>ref|XP_009599552.1| PREDICTED: uncharacterized protein LOC104095192 isoform X1 [Nicotiana 
tomentosiformis]
Length=833

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 7/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  663  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNLYVPNPQ  722

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  LQ+GSY++M  QTPH  Y+PSHSGHASFN    AAAA AQSSHMQ
Sbjct  723  AETSEMWMNPRDISTLQSGSYYSMSGQTPHATYLPSHSGHASFN----AAAAAAQSSHMQ  778

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            +P  + PPQPT +ANPHHLG+      G    AAAAPG Q+GAYQQPQLGH+NWTGNF
Sbjct  779  YPGLYHPPQPTAMANPHHLGS---AMAGNVGMAAAAPGAQVGAYQQPQLGHMNWTGNF  833



>ref|XP_009599554.1| PREDICTED: uncharacterized protein LOC104095192 isoform X3 [Nicotiana 
tomentosiformis]
Length=831

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 7/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  661  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNLYVPNPQ  720

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  LQ+GSY++M  QTPH  Y+PSHSGHASFN    AAAA AQSSHMQ
Sbjct  721  AETSEMWMNPRDISTLQSGSYYSMSGQTPHATYLPSHSGHASFN----AAAAAAQSSHMQ  776

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            +P  + PPQPT +ANPHHLG+      G    AAAAPG Q+GAYQQPQLGH+NWTGNF
Sbjct  777  YPGLYHPPQPTAMANPHHLGS---AMAGNVGMAAAAPGAQVGAYQQPQLGHMNWTGNF  831



>ref|XP_009599553.1| PREDICTED: uncharacterized protein LOC104095192 isoform X2 [Nicotiana 
tomentosiformis]
Length=832

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 7/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  662  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNLYVPNPQ  721

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  LQ+GSY++M  QTPH  Y+PSHSGHASFN    AAAA AQSSHMQ
Sbjct  722  AETSEMWMNPRDISTLQSGSYYSMSGQTPHATYLPSHSGHASFN----AAAAAAQSSHMQ  777

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            +P  + PPQPT +ANPHHLG+      G    AAAAPG Q+GAYQQPQLGH+NWTGNF
Sbjct  778  YPGLYHPPQPTAMANPHHLGS---AMAGNVGMAAAAPGAQVGAYQQPQLGHMNWTGNF  832



>ref|XP_009757816.1| PREDICTED: uncharacterized protein LOC104210585 isoform X1 [Nicotiana 
sylvestris]
Length=834

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 143/178 (80%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGN YVPNPQ
Sbjct  665  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNHYVPNPQ  724

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  LQ+GSY++M  QTPH  Y+PSHSGHASFN     AAA  QSSHMQ
Sbjct  725  AETSEMWMNPRDISTLQSGSYYSMSGQTPHATYLPSHSGHASFN-----AAAAVQSSHMQ  779

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            +P  + PPQPT +ANPHHLG+      G    AAAAPG Q+GAYQQPQLGH+NWTGNF
Sbjct  780  YPGLYHPPQPTAMANPHHLGS---AMAGNVGMAAAAPGAQVGAYQQPQLGHMNWTGNF  834



>ref|XP_009757818.1| PREDICTED: uncharacterized protein LOC104210585 isoform X3 [Nicotiana 
sylvestris]
Length=832

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 143/178 (80%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGN YVPNPQ
Sbjct  663  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNHYVPNPQ  722

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  LQ+GSY++M  QTPH  Y+PSHSGHASFN     AAA  QSSHMQ
Sbjct  723  AETSEMWMNPRDISTLQSGSYYSMSGQTPHATYLPSHSGHASFN-----AAAAVQSSHMQ  777

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            +P  + PPQPT +ANPHHLG+      G    AAAAPG Q+GAYQQPQLGH+NWTGNF
Sbjct  778  YPGLYHPPQPTAMANPHHLGS---AMAGNVGMAAAAPGAQVGAYQQPQLGHMNWTGNF  832



>ref|XP_009757817.1| PREDICTED: uncharacterized protein LOC104210585 isoform X2 [Nicotiana 
sylvestris]
Length=833

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 143/178 (80%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL+DS+ +KYKDGN YVPNPQ
Sbjct  664  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLEDSSRMKYKDGNHYVPNPQ  723

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  LQ+GSY++M  QTPH  Y+PSHSGHASFN     AAA  QSSHMQ
Sbjct  724  AETSEMWMNPRDISTLQSGSYYSMSGQTPHATYLPSHSGHASFN-----AAAAVQSSHMQ  778

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            +P  + PPQPT +ANPHHLG+      G    AAAAPG Q+GAYQQPQLGH+NWTGNF
Sbjct  779  YPGLYHPPQPTAMANPHHLGS---AMAGNVGMAAAAPGAQVGAYQQPQLGHMNWTGNF  833



>ref|XP_011072651.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157853 
[Sesamum indicum]
Length=859

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 142/179 (79%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS TGFG+FT+ TGYA+N PGV+GSA G DDS+ LKYKD +LYVPNPQ
Sbjct  690  KYGIQQFKPVPTGSPTGFGNFTNPTGYAINTPGVVGSAGGHDDSSRLKYKD-SLYVPNPQ  748

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSEIWMN RD+  LQ+ SY+NMP QTPH AY+ SHSGHASFN       A AQSSHMQ
Sbjct  749  AETSEIWMNPRDLPGLQSASYYNMPGQTPHPAYLTSHSGHASFN-------AAAQSSHMQ  801

Query  285  FP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            FP +YHPPPQP PIA+PHHLG    G       AA APG Q+GAYQQPQLGHLNWTGNF
Sbjct  802  FPGMYHPPPQPAPIASPHHLG-PAIGGNVGVGVAAPAPGAQVGAYQQPQLGHLNWTGNF  859



>ref|XP_010314322.1| PREDICTED: uncharacterized protein LOC101258733 isoform X2 [Solanum 
lycopersicum]
Length=833

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL DS+ +KYKDGNLYVPNPQ
Sbjct  664  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLKDSSRMKYKDGNLYVPNPQ  723

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH  Y+PSHSGHASFNAAA        SSHMQ
Sbjct  724  AETSEMWMNPRDISIMQSGSYYSMSGQTPHATYLPSHSGHASFNAAAP-------SSHMQ  776

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F   + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  777  FSGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  833



>ref|XP_010314324.1| PREDICTED: uncharacterized protein LOC101258733 isoform X4 [Solanum 
lycopersicum]
Length=771

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL DS+ +KYKDGNLYVPNPQ
Sbjct  602  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLKDSSRMKYKDGNLYVPNPQ  661

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH  Y+PSHSGHASFNAAA        SSHMQ
Sbjct  662  AETSEMWMNPRDISIMQSGSYYSMSGQTPHATYLPSHSGHASFNAAAP-------SSHMQ  714

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F   + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  715  FSGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  771



>ref|XP_004252392.1| PREDICTED: uncharacterized protein LOC101258733 isoform X1 [Solanum 
lycopersicum]
Length=834

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL DS+ +KYKDGNLYVPNPQ
Sbjct  665  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLKDSSRMKYKDGNLYVPNPQ  724

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH  Y+PSHSGHASFNAAA        SSHMQ
Sbjct  725  AETSEMWMNPRDISIMQSGSYYSMSGQTPHATYLPSHSGHASFNAAAP-------SSHMQ  777

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F   + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  778  FSGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  834



>ref|XP_010314323.1| PREDICTED: uncharacterized protein LOC101258733 isoform X3 [Solanum 
lycopersicum]
Length=832

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL DS+ +KYKDGNLYVPNPQ
Sbjct  663  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLKDSSRMKYKDGNLYVPNPQ  722

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH  Y+PSHSGHASFNAAA        SSHMQ
Sbjct  723  AETSEMWMNPRDISIMQSGSYYSMSGQTPHATYLPSHSGHASFNAAAP-------SSHMQ  775

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F   + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  776  FSGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  832



>ref|XP_010314325.1| PREDICTED: uncharacterized protein LOC101258733 isoform X5 [Solanum 
lycopersicum]
Length=769

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +GFG+FTS TGYA+N PGVIGSA GL DS+ +KYKDGNLYVPNPQ
Sbjct  600  KYGIQQFKPVPTGSASGFGNFTSPTGYAINTPGVIGSATGLKDSSRMKYKDGNLYVPNPQ  659

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSE+WMN RD+  +Q+GSY++M  QTPH  Y+PSHSGHASFNAAA        SSHMQ
Sbjct  660  AETSEMWMNPRDISIMQSGSYYSMSGQTPHATYLPSHSGHASFNAAAP-------SSHMQ  712

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F   + PPQP  +ANPHH+G+           AAAAPG Q+GAYQQPQLGHLNWTGNF
Sbjct  713  FSGLYHPPQPAAMANPHHMGS-AMAGNVGVGMAAAAPGAQVGAYQQPQLGHLNWTGNF  769



>ref|XP_010654468.1| PREDICTED: uncharacterized protein LOC100248075 isoform X1 [Vitis 
vinifera]
Length=855

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ KPVP GS TGFG+FT+ TGYA+N PGV+GSA GL+DS+ LKYKDGN+YVPNPQ
Sbjct  681  KYGIQQLKPVPAGSPTGFGNFTNPTGYAINAPGVVGSATGLEDSSRLKYKDGNIYVPNPQ  740

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPSH+GHASFN    AAAA AQSSHM
Sbjct  741  AETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPSHTGHASFN----AAAAAAQSSHM  796

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +A+PHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  797  QFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAAAPGPQVGAYQQPQLGHLNWTTNF  855



>ref|XP_010654472.1| PREDICTED: uncharacterized protein LOC100248075 isoform X5 [Vitis 
vinifera]
Length=816

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ KPVP GS TGFG+FT+ TGYA+N PGV+GSA GL+DS+ LKYKDGN+YVPNPQ
Sbjct  642  KYGIQQLKPVPAGSPTGFGNFTNPTGYAINAPGVVGSATGLEDSSRLKYKDGNIYVPNPQ  701

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPSH+GHASFN    AAAA AQSSHM
Sbjct  702  AETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPSHTGHASFN----AAAAAAQSSHM  757

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +A+PHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  758  QFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAAAPGPQVGAYQQPQLGHLNWTTNF  816



>ref|XP_010654470.1| PREDICTED: uncharacterized protein LOC100248075 isoform X3 [Vitis 
vinifera]
Length=853

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ KPVP GS TGFG+FT+ TGYA+N PGV+GSA GL+DS+ LKYKDGN+YVPNPQ
Sbjct  679  KYGIQQLKPVPAGSPTGFGNFTNPTGYAINAPGVVGSATGLEDSSRLKYKDGNIYVPNPQ  738

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPSH+GHASFN    AAAA AQSSHM
Sbjct  739  AETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPSHTGHASFN----AAAAAAQSSHM  794

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +A+PHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  795  QFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAAAPGPQVGAYQQPQLGHLNWTTNF  853



>ref|XP_010654469.1| PREDICTED: uncharacterized protein LOC100248075 isoform X2 [Vitis 
vinifera]
Length=855

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ KPVP GS TGFG+FT+ TGYA+N PGV+GSA GL+DS+ LKYKDGN+YVPNPQ
Sbjct  681  KYGIQQLKPVPAGSPTGFGNFTNPTGYAINAPGVVGSATGLEDSSRLKYKDGNIYVPNPQ  740

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPSH+GHASFN    AAAA AQSSHM
Sbjct  741  AETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPSHTGHASFN----AAAAAAQSSHM  796

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +A+PHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  797  QFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAAAPGPQVGAYQQPQLGHLNWTTNF  855



>emb|CBI35892.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ KPVP GS TGFG+FT+ TGYA+N PGV+GSA GL+DS+ LKYKDGN+YVPNPQ
Sbjct  635  KYGIQQLKPVPAGSPTGFGNFTNPTGYAINAPGVVGSATGLEDSSRLKYKDGNIYVPNPQ  694

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPSH+GHASFN    AAAA AQSSHM
Sbjct  695  AETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPSHTGHASFN----AAAAAAQSSHM  750

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +A+PHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  751  QFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAAAPGPQVGAYQQPQLGHLNWTTNF  809



>emb|CAN69468.1| hypothetical protein VITISV_042555 [Vitis vinifera]
Length=914

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 145/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ KPVP GS TGFG+FT+ TGYA+N PGV+GSA GL+DS+ LKYKDGN+YVPNPQ
Sbjct  740  KYGIQQLKPVPAGSPTGFGNFTNPTGYAINAPGVVGSATGLEDSSRLKYKDGNIYVPNPQ  799

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPSH+GHASFN    AAAA AQSSHM
Sbjct  800  AETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPSHTGHASFN----AAAAAAQSSHM  855

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +A+PHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  856  QFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAAAPGPQVGAYQQPQLGHLNWTTNF  914



>gb|EYU21338.1| hypothetical protein MIMGU_mgv1a001286mg [Erythranthe guttata]
Length=847

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 12/179 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+ +GYA++ PG++ SA G DDS+ LKYKD NLYVPNPQ
Sbjct  680  KYGIQQFKPVPAGSATGFGNFTNQSGYAISTPGIVASAPGHDDSSRLKYKD-NLYVPNPQ  738

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
            AETSEIWMN RD+  +Q+ SY+NMP QTPH AY+ SHSGHASFN       A AQSSHMQ
Sbjct  739  AETSEIWMNPRDLSGMQSASYYNMPGQTPHPAYLTSHSGHASFN-------AAAQSSHMQ  791

Query  285  FP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            FP +YHP PQPT IA PHH+G       G    AA APG Q+GAYQQPQLGHLNW GNF
Sbjct  792  FPGMYHPSPQPTAIAGPHHMG---PSIGGNVGVAAPAPGAQVGAYQQPQLGHLNWNGNF  847



>emb|CDO97864.1| unnamed protein product [Coffea canephora]
Length=849

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS TGYA+N PGV+GSA GL+DS+ LKYKDGNLY PNPQ
Sbjct  680  KYGIQQFKPVPAGSPTGFGNFTSPTGYAVNAPGVVGSATGLEDSSRLKYKDGNLYAPNPQ  739

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPH-GAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETSEIWMN RD   LQ+ SY+NMP QTPH  AY+PSH+ HAS+N    AAAAVAQSSHM
Sbjct  740  VETSEIWMNPRD---LQSASYYNMPGQTPHAAAYLPSHTSHASYN----AAAAVAQSSHM  792

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  IANPHHLG       G    AAAAPG Q+GAYQ  QL HLNWTGNF
Sbjct  793  QFPGLYHPPPQPAAIANPHHLG---PAMGGNVGVAAAAPGGQVGAYQHSQLSHLNWTGNF  849



>ref|XP_008464007.1| PREDICTED: uncharacterized protein LOC103501996 isoform X2 [Cucumis 
melo]
Length=846

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP+P GS  GFG+F S  G+A+N PGV+GSA GL+DS+ +KYKDGNLYVPN Q
Sbjct  676  KYGIQQFKPLPAGSPAGFGNFNSPAGFAVNAPGVVGSATGLEDSSRIKYKDGNLYVPNAQ  735

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  LQ+  Y+NMP QTPHGAY+PSHSGHASF+      AAVAQS+HM
Sbjct  736  AETSEIWIQNPRDLPGLQSAPYYNMPGQTPHGAYLPSHSGHASFS------AAVAQSTHM  789

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHP PQP  I NPHH+G    G  G    AAA PG Q+G +QQPQLGHLNWT NF
Sbjct  790  QFPGLYHPTPQPAAIGNPHHMG---PGMGGNVGVAAATPGPQVGTFQQPQLGHLNWTTNF  846



>ref|XP_008464006.1| PREDICTED: uncharacterized protein LOC103501996 isoform X1 [Cucumis 
melo]
Length=850

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP+P GS  GFG+F S  G+A+N PGV+GSA GL+DS+ +KYKDGNLYVPN Q
Sbjct  680  KYGIQQFKPLPAGSPAGFGNFNSPAGFAVNAPGVVGSATGLEDSSRIKYKDGNLYVPNAQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  LQ+  Y+NMP QTPHGAY+PSHSGHASF+      AAVAQS+HM
Sbjct  740  AETSEIWIQNPRDLPGLQSAPYYNMPGQTPHGAYLPSHSGHASFS------AAVAQSTHM  793

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHP PQP  I NPHH+G    G  G    AAA PG Q+G +QQPQLGHLNWT NF
Sbjct  794  QFPGLYHPTPQPAAIGNPHHMG---PGMGGNVGVAAATPGPQVGTFQQPQLGHLNWTTNF  850



>ref|XP_004163891.1| PREDICTED: uncharacterized protein LOC101226902 [Cucumis sativus]
Length=846

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP+P GS  GFG+F S  G+A+N PGV+GSA GL+DS+ +KYKDGNLYVPN Q
Sbjct  676  KYGIQQFKPLPAGSPAGFGNFNSPAGFAVNAPGVVGSATGLEDSSRIKYKDGNLYVPNAQ  735

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  LQ+  Y+NMP QTPHGAY+PSH+GHASF+      AAVAQS+HM
Sbjct  736  AETSEIWIQNPRDLPGLQSAPYYNMPGQTPHGAYLPSHTGHASFS------AAVAQSTHM  789

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHP PQP  I NPHH+G    G  G    AAA PG Q+G +QQPQLGHLNWT NF
Sbjct  790  QFPGLYHPTPQPAAIGNPHHMG---PGMGGNVGVAAATPGPQVGTFQQPQLGHLNWTTNF  846



>ref|XP_006583149.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Glycine 
max]
Length=830

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+F + TGYAM  PGV+G A  L+DS+ +KYKD NLYVPNPQ
Sbjct  658  KYGVQQFKPVPAGSPTGFGNFANPTGYAMITPGVVGGATALEDSSRVKYKD-NLYVPNPQ  716

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  +Q+  Y+NMP QTPH AYMPSH+GHASFN      AA AQSSHM
Sbjct  717  AETSEIWLQNPRDLPGMQSTPYYNMPGQTPHAAYMPSHTGHASFN------AAAAQSSHM  770

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YH PPQP  +A+PHHLG    GN      AAAAPG Q+GAYQQPQLGH+NWT NF
Sbjct  771  QFPGMYHTPPQPAAMASPHHLGPPAIGNNVGVGVAAAAPGAQVGAYQQPQLGHINWTTNF  830



>ref|XP_006583148.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=855

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+F + TGYAM  PGV+G A  L+DS+ +KYKD NLYVPNPQ
Sbjct  683  KYGVQQFKPVPAGSPTGFGNFANPTGYAMITPGVVGGATALEDSSRVKYKD-NLYVPNPQ  741

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  +Q+  Y+NMP QTPH AYMPSH+GHASFN      AA AQSSHM
Sbjct  742  AETSEIWLQNPRDLPGMQSTPYYNMPGQTPHAAYMPSHTGHASFN------AAAAQSSHM  795

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YH PPQP  +A+PHHLG    GN      AAAAPG Q+GAYQQPQLGH+NWT NF
Sbjct  796  QFPGMYHTPPQPAAMASPHHLGPPAIGNNVGVGVAAAAPGAQVGAYQQPQLGHINWTTNF  855



>ref|XP_003528451.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 gb|KHN01390.1| hypothetical protein glysoja_009596 [Glycine soja]
Length=863

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+F + TGYAM  PGV+G A  L+DS+ +KYKD NLYVPNPQ
Sbjct  691  KYGVQQFKPVPAGSPTGFGNFANPTGYAMITPGVVGGATALEDSSRVKYKD-NLYVPNPQ  749

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  +Q+  Y+NMP QTPH AYMPSH+GHASFN      AA AQSSHM
Sbjct  750  AETSEIWLQNPRDLPGMQSTPYYNMPGQTPHAAYMPSHTGHASFN------AAAAQSSHM  803

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YH PPQP  +A+PHHLG    GN      AAAAPG Q+GAYQQPQLGH+NWT NF
Sbjct  804  QFPGMYHTPPQPAAMASPHHLGPPAIGNNVGVGVAAAAPGAQVGAYQQPQLGHINWTTNF  863



>ref|XP_010087685.1| hypothetical protein L484_013447 [Morus notabilis]
 gb|EXB29673.1| hypothetical protein L484_013447 [Morus notabilis]
Length=854

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+F++  GYA+N PGV+G A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  683  KYGVQQFKPVPAGNPTGFGNFSNPNGYAINTPGVVGGATGLEDSSRIKYKDGNLYVPNPQ  742

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R++  LQ+  Y+NMP Q+PH AY+PSH+GHAS+N      AA AQSSHM
Sbjct  743  AETSEMWIQNPRELPGLQSTPYYNMPGQSPHAAYLPSHTGHASYN------AAAAQSSHM  796

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  IANPHHLG    G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  797  QFPGLYHPPQPAAIANPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLGHLNWTTNF  854



>ref|XP_010273948.1| PREDICTED: uncharacterized protein LOC104609354 isoform X2 [Nelumbo 
nucifera]
Length=857

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG QQYKP+P GS TGFG++TS TGY +N PGVIG    L+DS  +KYKDGNLYVPNPQ
Sbjct  685  KYGNQQYKPMPAGSPTGFGNYTSLTGYTINAPGVIGGTTTLEDSNRIKYKDGNLYVPNPQ  744

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETSEIW+ A R+V  LQ+  Y+N+P Q PH AY+PSH+GHASFN     A +V+QS+HM
Sbjct  745  GETSEIWLQAPREVPGLQSSPYYNIPGQAPHAAYLPSHTGHASFN----TAPSVSQSTHM  800

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  IANPHH+   + G  G    AAA+PG Q+GAYQQPQLGHLNWT NF
Sbjct  801  QFPGMYHPPPQPAAIANPHHI---VHGMGGNVGVAAASPGAQVGAYQQPQLGHLNWTTNF  857



>ref|XP_010273947.1| PREDICTED: uncharacterized protein LOC104609354 isoform X1 [Nelumbo 
nucifera]
Length=873

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG QQYKP+P GS TGFG++TS TGY +N PGVIG    L+DS  +KYKDGNLYVPNPQ
Sbjct  701  KYGNQQYKPMPAGSPTGFGNYTSLTGYTINAPGVIGGTTTLEDSNRIKYKDGNLYVPNPQ  760

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETSEIW+ A R+V  LQ+  Y+N+P Q PH AY+PSH+GHASFN     A +V+QS+HM
Sbjct  761  GETSEIWLQAPREVPGLQSSPYYNIPGQAPHAAYLPSHTGHASFN----TAPSVSQSTHM  816

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  IANPHH+   + G  G    AAA+PG Q+GAYQQPQLGHLNWT NF
Sbjct  817  QFPGMYHPPPQPAAIANPHHI---VHGMGGNVGVAAASPGAQVGAYQQPQLGHLNWTTNF  873



>ref|XP_007135474.1| hypothetical protein PHAVU_010G132600g [Phaseolus vulgaris]
 gb|ESW07468.1| hypothetical protein PHAVU_010G132600g [Phaseolus vulgaris]
Length=864

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQYKPVP G+  GFG+F S  GYAM  PGV+G A  L+DS+ +KYKD NLYVPNPQ
Sbjct  692  KYGVQQYKPVPAGNPAGFGNFASPAGYAMITPGVVGGATALEDSSRVKYKD-NLYVPNPQ  750

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  +Q+  Y+NMP QTPH AYMPSH+GHASFN      AA AQSSHM
Sbjct  751  AETSEIWLQNPRDLPGMQSAPYYNMPGQTPHAAYMPSHTGHASFN------AAAAQSSHM  804

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YH PPQP  +A+PHHLG    GN      AAAAPG Q+GAYQQPQLGH+NWT NF
Sbjct  805  QFPGMYHTPPQPAAMASPHHLGPPSIGNNVGVGVAAAAPGAQVGAYQQPQLGHINWTTNF  864



>gb|KGN59790.1| hypothetical protein Csa_3G846060 [Cucumis sativus]
Length=855

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 142/186 (76%), Gaps = 14/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP+P GS  GFG+F S  G+A+N PGV+GSA GL+DS+ +KYKDGNLYVPN Q
Sbjct  676  KYGIQQFKPLPAGSPAGFGNFNSPAGFAVNAPGVVGSATGLEDSSRIKYKDGNLYVPNAQ  735

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD+  LQ+  Y+NMP QTPHGAY+PSH+GHASF+      AAVAQS+HM
Sbjct  736  AETSEIWIQNPRDLPGLQSAPYYNMPGQTPHGAYLPSHTGHASFS------AAVAQSTHM  789

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgm------aaaaapgtqlgAYQQPQLGHL  130
            QFP +YHP PQP  I NPHH+G  M GNVGV         AAA PG Q+G +QQPQLGHL
Sbjct  790  QFPGLYHPTPQPAAIGNPHHMGPGMGGNVGVAGGPPWGPGAAATPGPQVGTFQQPQLGHL  849

Query  129  NWTGNF  112
            NWT NF
Sbjct  850  NWTTNF  855



>ref|XP_002304144.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
 gb|EEE79123.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
Length=858

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 140/179 (78%), Gaps = 9/179 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q YKPVP+ +  GFG+FTS +GYA+N PGV+GSAAGL+D + +KYKDGN+YVPNPQ
Sbjct  688  KYGIQHYKPVPSSNPAGFGNFTSPSGYAINAPGVVGSAAGLEDPSRMKYKDGNIYVPNPQ  747

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AE+SEIW+ N RD+  LQ+  Y+N+P QT H AY+PSH+GHASFN      AA AQSSHM
Sbjct  748  AESSEIWIQNPRDLPGLQSSPYYNIPGQT-HAAYLPSHTGHASFN------AAAAQSSHM  800

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  +PPPQPT +A+PHHLG  + GN      A +APG Q+GAYQQPQLGHLNWT NF
Sbjct  801  QFPGLYPPPQPTAMASPHHLG-PVMGNNVGVGVAPSAPGAQVGAYQQPQLGHLNWTTNF  858



>ref|XP_006598817.1| PREDICTED: putative uncharacterized protein DDB_G0277255-like 
[Glycine max]
Length=852

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+F + TGYAM  PGV+G A  L+DS+ +KYKD NLYVPNPQ
Sbjct  680  KYGVQQFKPVPAGSPTGFGNFANPTGYAMITPGVVGGATALEDSSRVKYKD-NLYVPNPQ  738

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD   +Q+  Y+NMP QTPH AYMPSH+GHASFN       A AQSSHM
Sbjct  739  AETSEIWLQNPRDHPGMQSTPYYNMPGQTPHAAYMPSHTGHASFN------GATAQSSHM  792

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YH PPQP  +A+PHHLG    GN      AAAAPG Q+GAYQQPQLGH+NWT NF
Sbjct  793  QFPGMYHTPPQPAAMASPHHLGPPAIGNNVGVGVAAAAPGAQVGAYQQPQLGHINWTTNF  852



>gb|KHN39644.1| hypothetical protein glysoja_020722 [Glycine soja]
Length=860

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+F + TGYAM  PGV+G A  L+DS+ +KYKD NLYVPNPQ
Sbjct  688  KYGVQQFKPVPAGSPTGFGNFANPTGYAMITPGVVGGATALEDSSRVKYKD-NLYVPNPQ  746

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N RD   +Q+  Y+NMP QTPH AYMPSH+GHASFN       A AQSSHM
Sbjct  747  AETSEIWLQNPRDHPGMQSTPYYNMPGQTPHAAYMPSHTGHASFN------GATAQSSHM  800

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YH PPQP  +A+PHHLG    GN      AAAAPG Q+GAYQQPQLGH+NWT NF
Sbjct  801  QFPGMYHTPPQPAAMASPHHLGPPAIGNNVGVGVAAAAPGAQVGAYQQPQLGHINWTTNF  860



>ref|XP_008391371.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=898

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 135/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+FT+  GYAMN PGV+G A GL+DS+ +KYKDGNLY+PNPQ
Sbjct  727  KYGVQQFKPAPAGSPTGFGNFTNPNGYAMNAPGVVGGATGLEDSSRIKYKDGNLYIPNPQ  786

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQ+PHGAYMPSH+ HASFN      AA AQSSHM
Sbjct  787  AETSEIWIQNAREHPGMQSTPYYNMPAQSPHGAYMPSHATHASFN------AAAAQSSHM  840

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQPT I N HH+G    G       AAA+PG Q+GAYQQPQL H+NW  NF
Sbjct  841  QFPGLYHPPQPTAIPNAHHMG-PAMGGNVGVGVAAASPGAQVGAYQQPQLNHMNWQSNF  898



>ref|XP_008391372.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X2 [Malus 
domestica]
Length=894

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 135/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+FT+  GYAMN PGV+G A GL+DS+ +KYKDGNLY+PNPQ
Sbjct  723  KYGVQQFKPAPAGSPTGFGNFTNPNGYAMNAPGVVGGATGLEDSSRIKYKDGNLYIPNPQ  782

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQ+PHGAYMPSH+ HASFN      AA AQSSHM
Sbjct  783  AETSEIWIQNAREHPGMQSTPYYNMPAQSPHGAYMPSHATHASFN------AAAAQSSHM  836

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQPT I N HH+G    G       AAA+PG Q+GAYQQPQL H+NW  NF
Sbjct  837  QFPGLYHPPQPTAIPNAHHMG-PAMGGNVGVGVAAASPGAQVGAYQQPQLNHMNWQSNF  894



>ref|XP_010062690.1| PREDICTED: uncharacterized protein LOC104450008 isoform X2 [Eucalyptus 
grandis]
Length=863

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP  S TGFG+F S  GYA+N PGV+GSA GLD+S+ +KYKD NLYVP PQ
Sbjct  691  KYGVQQFKPVPAASPTGFGNFASPAGYAVNPPGVVGSATGLDESSRMKYKDNNLYVPTPQ  750

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+WM N R++  +Q+  Y+NM  QTPHGAY+PSH+GHASFN      AA AQSSHM
Sbjct  751  AETSEMWMQNPREIPGMQSTPYYNMTGQTPHGAYLPSHTGHASFN------AAAAQSSHM  804

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHP PQ   IAN HHL     G       AA AP  Q+GAYQQPQLGHLNWT NF
Sbjct  805  QFSGLYHPSPQAAAIANQHHL-NPSMGASLGVGVAAPAPVAQVGAYQQPQLGHLNWTTNF  863



>ref|XP_010062689.1| PREDICTED: uncharacterized protein LOC104450008 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69815.1| hypothetical protein EUGRSUZ_F03171 [Eucalyptus grandis]
Length=866

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP  S TGFG+F S  GYA+N PGV+GSA GLD+S+ +KYKD NLYVP PQ
Sbjct  694  KYGVQQFKPVPAASPTGFGNFASPAGYAVNPPGVVGSATGLDESSRMKYKDNNLYVPTPQ  753

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+WM N R++  +Q+  Y+NM  QTPHGAY+PSH+GHASFN      AA AQSSHM
Sbjct  754  AETSEMWMQNPREIPGMQSTPYYNMTGQTPHGAYLPSHTGHASFN------AAAAQSSHM  807

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHP PQ   IAN HHL     G       AA AP  Q+GAYQQPQLGHLNWT NF
Sbjct  808  QFSGLYHPSPQAAAIANQHHL-NPSMGASLGVGVAAPAPVAQVGAYQQPQLGHLNWTTNF  866



>gb|KHG27656.1| ATP-dependent zinc metalloprotease FtsH [Gossypium arboreum]
Length=853

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  683  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  742

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++WM N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HM
Sbjct  743  ADTSDLWMQNPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHM  794

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  795  QFSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  853



>gb|KJB70099.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=852

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  682  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  741

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++WM N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HM
Sbjct  742  ADTSDLWMQNPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHM  793

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  794  QFSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  852



>gb|KJB70100.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=853

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  683  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  742

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++WM N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HM
Sbjct  743  ADTSDLWMQNPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHM  794

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  795  QFSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  853



>gb|KJB70102.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=854

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  684  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  743

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++WM N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HM
Sbjct  744  ADTSDLWMQNPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHM  795

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  796  QFSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  854



>ref|XP_009339841.1| PREDICTED: uncharacterized protein LOC103932015 isoform X3 [Pyrus 
x bretschneideri]
Length=848

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  679  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINSPGV-GGATGLEDSSRIKYKDGNLYVPNPQ  737

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ +AR+   +Q+  Y+NMPAQ+PHGAYMPSH  HASFN       A AQSSHM
Sbjct  738  AETSEIWIQSAREHPGMQSTPYYNMPAQSPHGAYMPSHGAHASFN-------AAAQSSHM  790

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        A APG Q+GAYQQPQL HLNW  NF
Sbjct  791  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAVAPGAQVGAYQQPQLNHLNWQSNF  848



>ref|XP_009339833.1| PREDICTED: uncharacterized protein LOC103932015 isoform X2 [Pyrus 
x bretschneideri]
Length=875

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  706  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINSPGV-GGATGLEDSSRIKYKDGNLYVPNPQ  764

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ +AR+   +Q+  Y+NMPAQ+PHGAYMPSH  HASFN       A AQSSHM
Sbjct  765  AETSEIWIQSAREHPGMQSTPYYNMPAQSPHGAYMPSHGAHASFN-------AAAQSSHM  817

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        A APG Q+GAYQQPQL HLNW  NF
Sbjct  818  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAVAPGAQVGAYQQPQLNHLNWQSNF  875



>gb|KJB70103.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=775

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  605  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  664

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++WM N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HM
Sbjct  665  ADTSDLWMQNPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHM  716

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  717  QFSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  775



>gb|KJB70104.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=776

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  606  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  665

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++WM N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HM
Sbjct  666  ADTSDLWMQNPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHM  717

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  718  QFSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  776



>ref|XP_009339824.1| PREDICTED: uncharacterized protein LOC103932015 isoform X1 [Pyrus 
x bretschneideri]
Length=877

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  708  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINSPGV-GGATGLEDSSRIKYKDGNLYVPNPQ  766

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ +AR+   +Q+  Y+NMPAQ+PHGAYMPSH  HASFN       A AQSSHM
Sbjct  767  AETSEIWIQSAREHPGMQSTPYYNMPAQSPHGAYMPSHGAHASFN-------AAAQSSHM  819

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        A APG Q+GAYQQPQL HLNW  NF
Sbjct  820  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAVAPGAQVGAYQQPQLNHLNWQSNF  877



>ref|XP_010261965.1| PREDICTED: uncharacterized protein LOC104600611 isoform X1 [Nelumbo 
nucifera]
Length=851

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG QQYK +P GS TGFG++TS TGY +N PG IG A GL+DST +K+K+GNLYVPNPQ
Sbjct  681  KYGNQQYKSIPVGSPTGFGNYTSLTGYTINAPGAIGGATGLEDSTRIKFKEGNLYVPNPQ  740

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+   R++  +Q+  ++NM  Q PH AY+PSH+GHASFN      AA AQS+HM
Sbjct  741  AETSEIWIQTPREIPGMQSSPFYNMQGQAPHAAYLPSHTGHASFN------AATAQSTHM  794

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHP PQP  +ANPHH+   + G       AAA+PG Q+GAYQQPQLGH+NWT NF
Sbjct  795  QFPGLYHPTPQPAAVANPHHI---VPGIGSNVGVAAASPGAQVGAYQQPQLGHINWTTNF  851



>ref|XP_010261966.1| PREDICTED: uncharacterized protein LOC104600611 isoform X2 [Nelumbo 
nucifera]
Length=849

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG QQYK +P GS TGFG++TS TGY +N PG IG A GL+DST +K+K+GNLYVPNPQ
Sbjct  679  KYGNQQYKSIPVGSPTGFGNYTSLTGYTINAPGAIGGATGLEDSTRIKFKEGNLYVPNPQ  738

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+   R++  +Q+  ++NM  Q PH AY+PSH+GHASFN      AA AQS+HM
Sbjct  739  AETSEIWIQTPREIPGMQSSPFYNMQGQAPHAAYLPSHTGHASFN------AATAQSTHM  792

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHP PQP  +ANPHH+   + G       AAA+PG Q+GAYQQPQLGH+NWT NF
Sbjct  793  QFPGLYHPTPQPAAVANPHHI---VPGIGSNVGVAAASPGAQVGAYQQPQLGHINWTTNF  849



>ref|XP_007024586.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY27208.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=761

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS +GYA+N PGV+G+  GL+DS+ +KYKDGN+YVPN Q
Sbjct  592  KYGIQQFKPVPAGSPTGFGNFTSPSGYAINAPGVVGNPTGLEDSSRIKYKDGNIYVPNQQ  651

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++W+ N R++  LQ+  Y+NMP QTPHG YMPSH+GHASFN      AA AQSSHM
Sbjct  652  ADTSDLWIQNPRELPGLQSAPYYNMP-QTPHG-YMPSHTGHASFN------AAAAQSSHM  703

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +ANP HLG    G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  704  QFPGLYHPPPQPAAMANP-HLG-PAMGANVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  761



>ref|XP_007024588.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY27210.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=842

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS +GYA+N PGV+G+  GL+DS+ +KYKDGN+YVPN Q
Sbjct  673  KYGIQQFKPVPAGSPTGFGNFTSPSGYAINAPGVVGNPTGLEDSSRIKYKDGNIYVPNQQ  732

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++W+ N R++  LQ+  Y+NMP QTPHG YMPSH+GHASFN      AA AQSSHM
Sbjct  733  ADTSDLWIQNPRELPGLQSAPYYNMP-QTPHG-YMPSHTGHASFN------AAAAQSSHM  784

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +ANP HLG    G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  785  QFPGLYHPPPQPAAMANP-HLG-PAMGANVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  842



>ref|XP_007024589.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY27211.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=839

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS +GYA+N PGV+G+  GL+DS+ +KYKDGN+YVPN Q
Sbjct  670  KYGIQQFKPVPAGSPTGFGNFTSPSGYAINAPGVVGNPTGLEDSSRIKYKDGNIYVPNQQ  729

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++W+ N R++  LQ+  Y+NMP QTPHG YMPSH+GHASFN      AA AQSSHM
Sbjct  730  ADTSDLWIQNPRELPGLQSAPYYNMP-QTPHG-YMPSHTGHASFN------AAAAQSSHM  781

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +ANP HLG    G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  782  QFPGLYHPPPQPAAMANP-HLG-PAMGANVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  839



>ref|XP_007024587.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY27209.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=849

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS +GYA+N PGV+G+  GL+DS+ +KYKDGN+YVPN Q
Sbjct  680  KYGIQQFKPVPAGSPTGFGNFTSPSGYAINAPGVVGNPTGLEDSSRIKYKDGNIYVPNQQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++W+ N R++  LQ+  Y+NMP QTPHG YMPSH+GHASFN      AA AQSSHM
Sbjct  740  ADTSDLWIQNPRELPGLQSAPYYNMP-QTPHG-YMPSHTGHASFN------AAAAQSSHM  791

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +ANP HLG    G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  792  QFPGLYHPPPQPAAMANP-HLG-PAMGANVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  849



>ref|XP_007024585.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY27207.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=852

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS +GYA+N PGV+G+  GL+DS+ +KYKDGN+YVPN Q
Sbjct  683  KYGIQQFKPVPAGSPTGFGNFTSPSGYAINAPGVVGNPTGLEDSSRIKYKDGNIYVPNQQ  742

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++W+ N R++  LQ+  Y+NMP QTPHG YMPSH+GHASFN      AA AQSSHM
Sbjct  743  ADTSDLWIQNPRELPGLQSAPYYNMP-QTPHG-YMPSHTGHASFN------AAAAQSSHM  794

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +ANP HLG    G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  795  QFPGLYHPPPQPAAMANP-HLG-PAMGANVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  852



>ref|XP_007024584.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY27206.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=883

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FTS +GYA+N PGV+G+  GL+DS+ +KYKDGN+YVPN Q
Sbjct  714  KYGIQQFKPVPAGSPTGFGNFTSPSGYAINAPGVVGNPTGLEDSSRIKYKDGNIYVPNQQ  773

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS++W+ N R++  LQ+  Y+NMP QTPHG YMPSH+GHASFN      AA AQSSHM
Sbjct  774  ADTSDLWIQNPRELPGLQSAPYYNMP-QTPHG-YMPSHTGHASFN------AAAAQSSHM  825

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +YHPPPQP  +ANP HLG    G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  826  QFPGLYHPPPQPAAMANP-HLG-PAMGANVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  883



>ref|XP_011035693.1| PREDICTED: uncharacterized protein LOC105133406 isoform X2 [Populus 
euphratica]
Length=848

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 10/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q YKPVP  +  GFG+F S +GYA+N PGV+GSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  677  KYGIQHYKPVPGNNPAGFGNFVSPSGYAINAPGVVGSATGLEDSSRMKYKDGNLYVPNPQ  736

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AE SEIW+ N R++  +Q+  Y+NMP QT H AY+PSH+GHASFN      AA AQSSHM
Sbjct  737  AEASEIWIQNPREIPGMQSAPYYNMPGQT-HTAYLPSHTGHASFN------AAAAQSSHM  789

Query  288  QFPVYHPP-PQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  +PP PQPT +A+PHHL   + G       A +APG Q+GAYQQPQLGHLNWT NF
Sbjct  790  QFPGLYPPTPQPTAMASPHHL-GPVMGGNVGVGVAPSAPGAQVGAYQQPQLGHLNWTSNF  848



>ref|XP_011035692.1| PREDICTED: uncharacterized protein LOC105133406 isoform X1 [Populus 
euphratica]
Length=849

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 10/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q YKPVP  +  GFG+F S +GYA+N PGV+GSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  678  KYGIQHYKPVPGNNPAGFGNFVSPSGYAINAPGVVGSATGLEDSSRMKYKDGNLYVPNPQ  737

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AE SEIW+ N R++  +Q+  Y+NMP QT H AY+PSH+GHASFN      AA AQSSHM
Sbjct  738  AEASEIWIQNPREIPGMQSAPYYNMPGQT-HTAYLPSHTGHASFN------AAAAQSSHM  790

Query  288  QFPVYHPP-PQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  +PP PQPT +A+PHHL   + G       A +APG Q+GAYQQPQLGHLNWT NF
Sbjct  791  QFPGLYPPTPQPTAMASPHHL-GPVMGGNVGVGVAPSAPGAQVGAYQQPQLGHLNWTSNF  849



>ref|XP_002299597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE84402.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=854

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 134/180 (74%), Gaps = 10/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q YKPVP  +  GFG+F S +GYA+N PGV+GSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  683  KYGIQHYKPVPGNNPAGFGNFVSPSGYAINAPGVVGSATGLEDSSRMKYKDGNLYVPNPQ  742

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AE SEIW+ N R++  +Q+  Y+NMP QT H AY+PSH+GHASFN      AA AQSSHM
Sbjct  743  AEASEIWIQNPREIPGMQSAPYYNMPGQT-HTAYLPSHTGHASFN------AAAAQSSHM  795

Query  288  QFPVYHPP-PQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  +PP PQPT + +PHHL   + G       A +APG Q+GAYQQPQLGHLNWT NF
Sbjct  796  QFPGLYPPTPQPTAMPSPHHL-GPVMGGNVGVGVAPSAPGAQVGAYQQPQLGHLNWTTNF  854



>gb|KDO65081.1| hypothetical protein CISIN_1g040475mg [Citrus sinensis]
Length=861

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPT S TGFG+FTS  GYA+N P V+GS  GL+DS+ +KYKDGNLYV N Q
Sbjct  688  KYGIQQFKPVPTASPTGFGNFTSPAGYAINAPSVVGSVTGLEDSSRMKYKDGNLYVSNQQ  747

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH-GAYMPSHSGHASFNaaaaaaaavAQSSH  292
            A+TSE+W+ N R++  +Q+G Y+NMPAQTPH  AY+PSH+GHASFN      AAV QSSH
Sbjct  748  ADTSELWIHNPRELPGMQSGPYYNMPAQTPHAAAYLPSHAGHASFN------AAVPQSSH  801

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQFP +YHP  QP  +ANPHH+G    G         AAPG Q+GAYQQPQLG+ NW+ N
Sbjct  802  MQFPGMYHPTAQPPAMANPHHMG-PAMGGNVGVGVPPAAPGAQVGAYQQPQLGNFNWSPN  860

Query  114  F  112
            F
Sbjct  861  F  861



>ref|XP_006465941.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=862

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPT S TGFG+FTS  GYA+N P V+GS  GL+DS+ +KYKDGNLYV N Q
Sbjct  689  KYGIQQFKPVPTASPTGFGNFTSPAGYAINAPSVVGSVTGLEDSSRMKYKDGNLYVSNQQ  748

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH-GAYMPSHSGHASFNaaaaaaaavAQSSH  292
            A+TSE+W+ N R++  +Q+G Y+NMPAQTPH  AY+PSH+GHASFN      AAV QSSH
Sbjct  749  ADTSELWIHNPRELPGMQSGPYYNMPAQTPHAAAYLPSHAGHASFN------AAVPQSSH  802

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQFP +YHP  QP  +ANPHH+G    G         AAPG Q+GAYQQPQLG+ NW+ N
Sbjct  803  MQFPGMYHPTAQPPAMANPHHMG-PAMGGNVGVGVPPAAPGAQVGAYQQPQLGNFNWSPN  861

Query  114  F  112
            F
Sbjct  862  F  862



>ref|XP_006426627.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
 gb|ESR39867.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
Length=867

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPT S TGFG+FTS  GYA+N P V+GS  GL+DS+ +KYKDGNLYV N Q
Sbjct  694  KYGIQQFKPVPTASPTGFGNFTSPAGYAINAPSVVGSVTGLEDSSRMKYKDGNLYVSNQQ  753

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH-GAYMPSHSGHASFNaaaaaaaavAQSSH  292
            A+TSE+W+ N R++  +Q+G Y+NMPAQTPH  AY+PSH+GHASFN      AAV QSSH
Sbjct  754  ADTSELWIHNPRELPGMQSGPYYNMPAQTPHAAAYLPSHAGHASFN------AAVPQSSH  807

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQFP +YHP  QP  +ANPHH+G    G         AAPG Q+GAYQQPQLG+ NW+ N
Sbjct  808  MQFPGMYHPTAQPPAMANPHHMG-PAMGGNVGVGVPPAAPGAQVGAYQQPQLGNFNWSPN  866

Query  114  F  112
            F
Sbjct  867  F  867



>ref|XP_006426626.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
 gb|ESR39866.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
Length=866

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPT S TGFG+FTS  GYA+N P V+GS  GL+DS+ +KYKDGNLYV N Q
Sbjct  693  KYGIQQFKPVPTASPTGFGNFTSPAGYAINAPSVVGSVTGLEDSSRMKYKDGNLYVSNQQ  752

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH-GAYMPSHSGHASFNaaaaaaaavAQSSH  292
            A+TSE+W+ N R++  +Q+G Y+NMPAQTPH  AY+PSH+GHASFN      AAV QSSH
Sbjct  753  ADTSELWIHNPRELPGMQSGPYYNMPAQTPHAAAYLPSHAGHASFN------AAVPQSSH  806

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQFP +YHP  QP  +ANPHH+G    G         AAPG Q+GAYQQPQLG+ NW+ N
Sbjct  807  MQFPGMYHPTAQPPAMANPHHMG-PAMGGNVGVGVPPAAPGAQVGAYQQPQLGNFNWSPN  865

Query  114  F  112
            F
Sbjct  866  F  866



>ref|XP_008338697.1| PREDICTED: cell wall protein RBR3-like isoform X4 [Malus domestica]
Length=705

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 134/179 (75%), Gaps = 9/179 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G AAGL+DS+ +KYKDGNLYVPNPQ
Sbjct  535  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINAPGV-GGAAGLEDSSRIKYKDGNLYVPNPQ  593

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQTPHGAYMPSH  HASF       AA AQSSHM
Sbjct  594  AETSEIWIQNAREHPGMQSTPYYNMPAQTPHGAYMPSHGAHASF------NAAAAQSSHM  647

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        AAAPG Q+GAYQQPQL HLNW  NF
Sbjct  648  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAAAPGAQVGAYQQPQLNHLNWQSNF  705



>gb|KDP40717.1| hypothetical protein JCGZ_24716 [Jatropha curcas]
Length=866

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 133/180 (74%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP  S TGFG+FTS TGYA+N PGV+G+A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  693  KYGIQQFKPVPGSSPTGFGNFTSPTGYAINAPGVVGNATGLEDSSRIKYKDGNLYVPNPQ  752

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMP QTPH AY+PSH+GHASFN      AA AQSSHM
Sbjct  753  AETSEIWVQNPRELPGLQSAPYYNMPGQTPHAAYLPSHTGHASFN------AAAAQSSHM  806

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP +Y PPP         H    + G       AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  807  QFPGLYPPPPPTPAAMANPHHMGPVMGGNVGVGVAAAAPGAQVGAYQQPQLGHLNWTTNF  866



>ref|XP_009372374.1| PREDICTED: uncharacterized protein LOC103961534 isoform X2 [Pyrus 
x bretschneideri]
Length=896

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 133/179 (74%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+FT+  GYAMN PGV+G A GL+DS+ +KYKDGNLY+PNPQ
Sbjct  725  KYGVQQFKPAPAGSPTGFGNFTNPNGYAMNAPGVVGGATGLEDSSRIKYKDGNLYIPNPQ  784

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQ+PHGAYMPSH+ HAS        AA AQSSHM
Sbjct  785  AETSEIWIQNAREHPGMQSTPYYNMPAQSPHGAYMPSHAAHAS------FNAAAAQSSHM  838

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQPT I N HH+G    G       AAA+PG Q+GAYQQPQL H+NW  NF
Sbjct  839  QFPGLYHPPQPTAIPNAHHMG-PALGANVGVGVAAASPGAQVGAYQQPQLNHMNWQSNF  896



>ref|XP_008338694.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=876

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 133/179 (74%), Gaps = 9/179 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G AAGL+DS+ +KYKDGNLYVPNPQ
Sbjct  706  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINAPGV-GGAAGLEDSSRIKYKDGNLYVPNPQ  764

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQTPHGAYMPSH  HAS        AA AQSSHM
Sbjct  765  AETSEIWIQNAREHPGMQSTPYYNMPAQTPHGAYMPSHGAHAS------FNAAAAQSSHM  818

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        AAAPG Q+GAYQQPQL HLNW  NF
Sbjct  819  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAAAPGAQVGAYQQPQLNHLNWQSNF  876



>ref|XP_008338696.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Malus 
domestica]
Length=874

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 133/179 (74%), Gaps = 9/179 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G AAGL+DS+ +KYKDGNLYVPNPQ
Sbjct  704  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINAPGV-GGAAGLEDSSRIKYKDGNLYVPNPQ  762

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQTPHGAYMPSH  HAS        AA AQSSHM
Sbjct  763  AETSEIWIQNAREHPGMQSTPYYNMPAQTPHGAYMPSHGAHAS------FNAAAAQSSHM  816

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        AAAPG Q+GAYQQPQL HLNW  NF
Sbjct  817  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAAAPGAQVGAYQQPQLNHLNWQSNF  874



>ref|XP_009372373.1| PREDICTED: uncharacterized protein LOC103961534 isoform X1 [Pyrus 
x bretschneideri]
Length=900

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 133/179 (74%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+FT+  GYAMN PGV+G A GL+DS+ +KYKDGNLY+PNPQ
Sbjct  729  KYGVQQFKPAPAGSPTGFGNFTNPNGYAMNAPGVVGGATGLEDSSRIKYKDGNLYIPNPQ  788

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQ+PHGAYMPSH+ HAS        AA AQSSHM
Sbjct  789  AETSEIWIQNAREHPGMQSTPYYNMPAQSPHGAYMPSHAAHAS------FNAAAAQSSHM  842

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQPT I N HH+G    G       AAA+PG Q+GAYQQPQL H+NW  NF
Sbjct  843  QFPGLYHPPQPTAIPNAHHMG-PALGANVGVGVAAASPGAQVGAYQQPQLNHMNWQSNF  900



>ref|XP_008338695.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Malus 
domestica]
Length=875

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 133/179 (74%), Gaps = 9/179 (5%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+FT+  GYA+N PGV G AAGL+DS+ +KYKDGNLYVPNPQ
Sbjct  705  KYGVQQFKPVPAGSPTGFGNFTNPNGYAINAPGV-GGAAGLEDSSRIKYKDGNLYVPNPQ  763

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ NAR+   +Q+  Y+NMPAQTPHGAYMPSH  HAS        AA AQSSHM
Sbjct  764  AETSEIWIQNAREHPGMQSTPYYNMPAQTPHGAYMPSHGAHAS------FNAAAAQSSHM  817

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP+ I NPHH+G    G        AAAPG Q+GAYQQPQL HLNW  NF
Sbjct  818  QFPGLYHPPQPSAIPNPHHMG-PAMGGNVGVGVGAAAPGAQVGAYQQPQLNHLNWQSNF  875



>ref|XP_011467415.1| PREDICTED: uncharacterized protein LOC101293990 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=913

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPV  GS TGFG+FT+  GYAMN PGV+G A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  744  KYGVQQFKPV-AGSPTGFGNFTNPAGYAMNAPGVVGGATGLEDSSRMKYKDGNLYVPNPQ  802

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R+   +Q+  Y+NMP QTPH AYMPSH GHASFN      AA AQSSHM
Sbjct  803  AETSEIWIQNPREHPGMQSAPYYNMPGQTPHAAYMPSHGGHASFN------AAAAQSSHM  856

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            Q+P  + PPQP  +A+PHH+G   +    VG+  AAA        QQPQL H+NWT NF
Sbjct  857  QYPGMYHPPQPAAMASPHHMG--PAMPGNVGVGVAAAAPGAQAYQQQPQLNHMNWTTNF  913



>ref|XP_004303676.1| PREDICTED: uncharacterized protein LOC101293990 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=915

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPV  GS TGFG+FT+  GYAMN PGV+G A GL+DS+ +KYKDGNLYVPNPQ
Sbjct  746  KYGVQQFKPV-AGSPTGFGNFTNPAGYAMNAPGVVGGATGLEDSSRMKYKDGNLYVPNPQ  804

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R+   +Q+  Y+NMP QTPH AYMPSH GHASFN      AA AQSSHM
Sbjct  805  AETSEIWIQNPREHPGMQSAPYYNMPGQTPHAAYMPSHGGHASFN------AAAAQSSHM  858

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            Q+P  + PPQP  +A+PHH+G   +    VG+  AAA        QQPQL H+NWT NF
Sbjct  859  QYPGMYHPPQPAAMASPHHMG--PAMPGNVGVGVAAAAPGAQAYQQQPQLNHMNWTTNF  915



>ref|XP_002521347.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41015.1| conserved hypothetical protein [Ricinus communis]
Length=864

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 131/180 (73%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP  S TGFG+FTS TGYA+N PGV+GSA GL+DS+ +KYKDGNLYVPNPQ
Sbjct  691  KYGIQQFKPVPGSSPTGFGNFTSPTGYAINAPGVVGSATGLEDSSRMKYKDGNLYVPNPQ  750

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIW+ N R++  LQ+  Y+NMP Q+PH AY+PSH+GHASFN      AA AQSSHM
Sbjct  751  AETSEIWVQNPRELPGLQSAPYYNMPGQSPHAAYLPSHTGHASFN------AAAAQSSHM  804

Query  288  QFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF  +Y PPP         H    + G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  805  QFSGLYPPPPPTPAAMANPHHLGPVMGGNVGVGVAPAAPGAQVGAYQQPQLGHLNWTTNF  864



>ref|XP_008228220.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X5 
[Prunus mume]
Length=850

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYVPNPQ
Sbjct  679  KYGVQSFKPVPAGSPTGYGNFTNPNGYAINAPGVVGGASGLEDSSRIKYKDGNLYVPNPQ  738

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HASF       AA AQSSHM
Sbjct  739  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHASF------NAAAAQSSHM  792

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  793  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  850



>ref|XP_008228218.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Prunus mume]
Length=851

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYVPNPQ
Sbjct  680  KYGVQSFKPVPAGSPTGYGNFTNPNGYAINAPGVVGGASGLEDSSRIKYKDGNLYVPNPQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HASF       AA AQSSHM
Sbjct  740  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHASF------NAAAAQSSHM  793

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  794  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  851



>ref|XP_008228221.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X6 [Prunus mume]
Length=829

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYVPNPQ
Sbjct  658  KYGVQSFKPVPAGSPTGYGNFTNPNGYAINAPGVVGGASGLEDSSRIKYKDGNLYVPNPQ  717

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HASF       AA AQSSHM
Sbjct  718  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHASF------NAAAAQSSHM  771

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  772  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  829



>ref|XP_008228219.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X4 
[Prunus mume]
Length=851

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYVPNPQ
Sbjct  680  KYGVQSFKPVPAGSPTGYGNFTNPNGYAINAPGVVGGASGLEDSSRIKYKDGNLYVPNPQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HASF       AA AQSSHM
Sbjct  740  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHASF------NAAAAQSSHM  793

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  794  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  851



>ref|XP_008228216.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X1 
[Prunus mume]
Length=853

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYVPNPQ
Sbjct  682  KYGVQSFKPVPAGSPTGYGNFTNPNGYAINAPGVVGGASGLEDSSRIKYKDGNLYVPNPQ  741

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HASF       AA AQSSHM
Sbjct  742  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHASF------NAAAAQSSHM  795

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  796  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  853



>ref|XP_008228217.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X2 
[Prunus mume]
Length=852

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYVPNPQ
Sbjct  681  KYGVQSFKPVPAGSPTGYGNFTNPNGYAINAPGVVGGASGLEDSSRIKYKDGNLYVPNPQ  740

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HASF       AA AQSSHM
Sbjct  741  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHASF------NAAAAQSSHM  794

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  795  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  852



>ref|XP_004510436.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=889

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 132/181 (73%), Gaps = 11/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP GS TGFG+F + T YAM  PGV+G A+ L+DS+ +KYKD NLYVPNPQ
Sbjct  717  KYGVQQFKPVPAGSPTGFGNFANPTAYAMLAPGVVGGASALEDSSRVKYKD-NLYVPNPQ  775

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGA-YMPSHSGHASFNaaaaaaaavAQSSH  292
             ETSEIW+ N RD+  +Q+  Y+N+P Q+PH A +MPSH+GH SFN       A AQSSH
Sbjct  776  GETSEIWLQNPRDLPGMQSTQYYNLPGQSPHAAPFMPSHTGHTSFN------VAAAQSSH  829

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQFP +Y  P Q  P+A+PHHLG    GN      AAAA G Q+GAYQQPQLGHLNWT N
Sbjct  830  MQFPGMYQHPSQQAPMASPHHLG-PAMGNNVGVGVAAAAAGAQVGAYQQPQLGHLNWTTN  888

Query  114  F  112
            F
Sbjct  889  F  889



>gb|KJB70101.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=843

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 130/179 (73%), Gaps = 18/179 (10%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G+ TGFG+FTS +GYA+N PGV+GSA GL+DS+  KYKDGN+YV N Q
Sbjct  682  KYGIQQFKPVPAGNPTGFGNFTSPSGYAINAPGVVGSATGLEDSSRTKYKDGNIYVQNQQ  741

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
                    N R+V +LQ+ +Y+NMP QTPHG YMPSH+GHASFN      AA  QS+HMQ
Sbjct  742  --------NPREVPSLQSAAYYNMP-QTPHG-YMPSHTGHASFN------AAATQSTHMQ  785

Query  285  FP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F  +YHPPPQP  +ANPHHL     G       A AAPG Q+GAYQQPQLGHLNWT NF
Sbjct  786  FSGLYHPPPQPAAMANPHHL-NPAMGANVGFGVAPAAPGAQVGAYQQPQLGHLNWTTNF  843



>gb|KEH18456.1| plant/MDC16-11 protein [Medicago truncatula]
Length=1006

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 133/181 (73%), Gaps = 14/181 (8%)
 Frame = -3

Query  645   KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
             KYG+QQ+KPVP GS +GF +F +  GYAM  PGV+G A+ L+DS+ +KYKD NLYVPNPQ
Sbjct  837   KYGVQQFKPVPAGSPSGFQNFANP-GYAMLAPGVVGGASALEDSSRVKYKD-NLYVPNPQ  894

Query  465   AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGA-YMPSHSGHASFNaaaaaaaavAQSSH  292
             AETSEIW+ N RD+  +Q+  Y+NMP Q+PH A +MPSH+GHA+FN      AA AQSSH
Sbjct  895   AETSEIWLQNPRDLSGMQSPQYYNMPGQSPHAAPFMPSHAGHANFN------AAAAQSSH  948

Query  291   MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQFP +YH PPQ  P+ +PHHLG            A AAPG Q+GAYQQPQLGHLNWT N
Sbjct  949   MQFPGMYHTPPQQAPMPSPHHLG---PAMGNNVGVAGAAPGAQVGAYQQPQLGHLNWTTN  1005

Query  114   F  112
             F
Sbjct  1006  F  1006



>ref|XP_007214970.1| hypothetical protein PRUPE_ppa001749mg [Prunus persica]
 gb|EMJ16169.1| hypothetical protein PRUPE_ppa001749mg [Prunus persica]
Length=771

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+Q +KPVP GS TG+G+FT+  GYA+N PGV+G A+GL+DS+ +KYKDGNLYV NPQ
Sbjct  600  KYGVQPFKPVPAGSPTGYGNFTNPNGYAINGPGVVGGASGLEDSSRIKYKDGNLYVANPQ  659

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSE+W+ N R+   LQ+  Y+N+PAQ+PHGAYMPSH+ HAS        AA AQSSHM
Sbjct  660  AETSEMWIQNPREHPGLQSTPYYNVPAQSPHGAYMPSHAAHAS------FNAAAAQSSHM  713

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QFP  + PPQP  I NPHHLG    G       AAAAPG Q+GAYQQPQL H+NW  NF
Sbjct  714  QFPGLYHPPQPAAIPNPHHLG-PAMGGNVGVGVAAAAPGAQVGAYQQPQLNHMNWQTNF  771



>ref|XP_010932459.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Elaeis guineensis]
Length=861

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +N PG IGSAAGL+D + +KYKD +LYVP PQ
Sbjct  688  KYATSQYKPVPVGSPTGYGNYANPAGFTINSPGTIGSAAGLEDVSRIKYKDNSLYVPTPQ  747

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETS+IW+   R++ +LQ+  Y+N+  Q PH  +MP+H+GHASFN       A AQSSH+
Sbjct  748  AETSDIWIQTPRELSSLQSAPYYNLSGQAPHAVFMPTHAGHASFN-------AAAQSSHI  800

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapg--tqlgAYQQPQLGHLNWTGN  115
            Q+P  + PPQP  IA+PH +    + +               Q+GAYQQPQLGHLNWT N
Sbjct  801  QYPGLYHPPQPASIASPHQMVHQQAPSALGASVGVGVAAPGPQVGAYQQPQLGHLNWTAN  860

Query  114  F  112
            F
Sbjct  861  F  861



>ref|XP_010932458.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Elaeis guineensis]
Length=887

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +N PG IGSAAGL+D + +KYKD +LYVP PQ
Sbjct  714  KYATSQYKPVPVGSPTGYGNYANPAGFTINSPGTIGSAAGLEDVSRIKYKDNSLYVPTPQ  773

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETS+IW+   R++ +LQ+  Y+N+  Q PH  +MP+H+GHASFN       A AQSSH+
Sbjct  774  AETSDIWIQTPRELSSLQSAPYYNLSGQAPHAVFMPTHAGHASFN-------AAAQSSHI  826

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapg--tqlgAYQQPQLGHLNWTGN  115
            Q+P  + PPQP  IA+PH +    + +               Q+GAYQQPQLGHLNWT N
Sbjct  827  QYPGLYHPPQPASIASPHQMVHQQAPSALGASVGVGVAAPGPQVGAYQQPQLGHLNWTAN  886

Query  114  F  112
            F
Sbjct  887  F  887



>ref|XP_010685333.1| PREDICTED: uncharacterized protein LOC104899768 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=796

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 123/181 (68%), Gaps = 13/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+  +  GYA+N PGV+G   GLDDS+ +KYKD NLYVPNPQ
Sbjct  626  KYGVQQFKPYPVGSPTGFGNMQNPNGYAINAPGVVGGPTGLDDSSRIKYKDNNLYVPNPQ  685

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH--GAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETSE+W+ N RD+  +Q   YFNM  QT H   AY+ SH+GHASFN      A VAQSS
Sbjct  686  AETSEVWIPNHRDLPGMQQNPYFNMQGQTAHPAAAYLQSHTGHASFN-----GAGVAQSS  740

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQFP  + PPQ T I N HHLG    G       A  APG Q+GAYQQPQ+ HLNWT N
Sbjct  741  QMQFPGMY-PPQATGIPNAHHLG----GGNIGVGVAPPAPGAQVGAYQQPQISHLNWTTN  795

Query  114  F  112
            F
Sbjct  796  F  796



>ref|XP_010685331.1| PREDICTED: uncharacterized protein LOC104899768 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=825

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 123/181 (68%), Gaps = 13/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+  +  GYA+N PGV+G   GLDDS+ +KYKD NLYVPNPQ
Sbjct  655  KYGVQQFKPYPVGSPTGFGNMQNPNGYAINAPGVVGGPTGLDDSSRIKYKDNNLYVPNPQ  714

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH--GAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETSE+W+ N RD+  +Q   YFNM  QT H   AY+ SH+GHASFN      A VAQSS
Sbjct  715  AETSEVWIPNHRDLPGMQQNPYFNMQGQTAHPAAAYLQSHTGHASFN-----GAGVAQSS  769

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQFP  + PPQ T I N HHLG    G       A  APG Q+GAYQQPQ+ HLNWT N
Sbjct  770  QMQFPGMY-PPQATGIPNAHHLG----GGNIGVGVAPPAPGAQVGAYQQPQISHLNWTTN  824

Query  114  F  112
            F
Sbjct  825  F  825



>ref|XP_010685332.1| PREDICTED: uncharacterized protein LOC104899768 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=823

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 123/181 (68%), Gaps = 13/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP P GS TGFG+  +  GYA+N PGV+G   GLDDS+ +KYKD NLYVPNPQ
Sbjct  653  KYGVQQFKPYPVGSPTGFGNMQNPNGYAINAPGVVGGPTGLDDSSRIKYKDNNLYVPNPQ  712

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPH--GAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETSE+W+ N RD+  +Q   YFNM  QT H   AY+ SH+GHASFN      A VAQSS
Sbjct  713  AETSEVWIPNHRDLPGMQQNPYFNMQGQTAHPAAAYLQSHTGHASFN-----GAGVAQSS  767

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQFP  + PPQ T I N HHLG    G       A  APG Q+GAYQQPQ+ HLNWT N
Sbjct  768  QMQFPGMY-PPQATGIPNAHHLG----GGNIGVGVAPPAPGAQVGAYQQPQISHLNWTTN  822

Query  114  F  112
            F
Sbjct  823  F  823



>ref|XP_010542407.1| PREDICTED: uncharacterized protein LOC104815628 isoform X3 [Tarenaya 
hassleriana]
Length=860

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTG   GFGSF +  GY +N P ++G+A GL+DS+ +KYKDG++YVPNPQ
Sbjct  687  KYGIQQFKPVPTGGPMGFGSFNNPNGYPINSPSIVGNAVGLEDSSRMKYKDGSIYVPNPQ  746

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AE+SEIW+ N RD+  LQ+  Y+N+  QTPHGAY+ +H+ H SF+    AAAA AQSSHM
Sbjct  747  AESSEIWLQNPRDLTGLQSPPYYNVAGQTPHGAYLSNHTAHPSFD----AAAAAAQSSHM  802

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF     P QP  +A+PHH+     G         + P  Q G YQQPQLGH+NW  N+
Sbjct  803  QFQGLFHPTQPGAMASPHHM-GPGLGGNVGVGVTPSPPVAQAGTYQQPQLGHMNWPTNY  860



>ref|XP_010487183.1| PREDICTED: uncharacterized protein LOC104765203 isoform X2 [Camelina 
sativa]
Length=854

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  681  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  740

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H SFN    AAAA AQS H
Sbjct  741  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSFN----AAAAAAQSPH  796

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  797  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  854



>ref|XP_010487182.1| PREDICTED: uncharacterized protein LOC104765203 isoform X1 [Camelina 
sativa]
Length=855

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  682  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  741

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H SFN    AAAA AQS H
Sbjct  742  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSFN----AAAAAAQSPH  797

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  798  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  855



>ref|XP_010465278.1| PREDICTED: uncharacterized protein LOC104745669 isoform X3 [Camelina 
sativa]
Length=852

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  679  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  738

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  739  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  794

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  795  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  852



>ref|XP_010465277.1| PREDICTED: uncharacterized protein LOC104745669 isoform X2 [Camelina 
sativa]
Length=852

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  679  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  738

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  739  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  794

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  795  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  852



>ref|XP_010465276.1| PREDICTED: uncharacterized protein LOC104745669 isoform X1 [Camelina 
sativa]
Length=853

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  680  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  739

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  740  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  795

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  796  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  853



>ref|XP_010501510.1| PREDICTED: uncharacterized protein LOC104778757 isoform X3 [Camelina 
sativa]
Length=851

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  678  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  737

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  738  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  793

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  794  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  851



>ref|XP_010501505.1| PREDICTED: uncharacterized protein LOC104778757 isoform X2 [Camelina 
sativa]
Length=851

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  678  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  737

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  738  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  793

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  794  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  851



>ref|XP_010501517.1| PREDICTED: uncharacterized protein LOC104778757 isoform X4 [Camelina 
sativa]
Length=852

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  679  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  738

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  739  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  794

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  795  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  852



>ref|XP_010501500.1| PREDICTED: uncharacterized protein LOC104778757 isoform X1 [Camelina 
sativa]
Length=852

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  679  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  738

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  739  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  794

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  795  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  852



>ref|XP_010501523.1| PREDICTED: uncharacterized protein LOC104778757 isoform X5 [Camelina 
sativa]
Length=851

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPVPTG  TGFG++ +  GY +N P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  678  KYGINQQFKPVPTGGHTGFGTYNNPNGYPINPPNVVGNATGLEDSSRMKYKDGNIYNPNP  737

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  QTPHGAY+ SH+ H S+N    AAAA AQS H
Sbjct  738  QAETSEIWMPNPRDLSSLQSPQYYNVAGQTPHGAYLSSHTAHPSYN----AAAAAAQSPH  793

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+G        VG     +P +Q+G YQQ Q+GH NW  +F
Sbjct  794  MQFQGLFHPPQPGTMANPHHMG--PGLGGNVGAGVVPSPPSQVGTYQQSQIGHPNWPASF  851



>ref|XP_010542408.1| PREDICTED: uncharacterized protein LOC104815628 isoform X4 [Tarenaya 
hassleriana]
Length=694

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 123/180 (68%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP-  469
            KYG+QQ+KPVPTG   GFGSF +  GY +N P ++G+A GL+DS+ +KYKDG++YVPNP 
Sbjct  520  KYGIQQFKPVPTGGPMGFGSFNNPNGYPINSPSIVGNAVGLEDSSRMKYKDGSIYVPNPQ  579

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAE+SEIW+ N RD+  LQ+  Y+N+  QTPHGAY+ +H+ H SF+    AAAA AQSSH
Sbjct  580  QAESSEIWLQNPRDLTGLQSPPYYNVAGQTPHGAYLSNHTAHPSFD----AAAAAAQSSH  635

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     P QP  +A+PHH+     G         + P  Q G YQQPQLGH+NW  N+
Sbjct  636  MQFQGLFHPTQPGAMASPHHM-GPGLGGNVGVGVTPSPPVAQAGTYQQPQLGHMNWPTNY  694



>ref|XP_010542405.1| PREDICTED: uncharacterized protein LOC104815628 isoform X1 [Tarenaya 
hassleriana]
Length=861

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 123/180 (68%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP-  469
            KYG+QQ+KPVPTG   GFGSF +  GY +N P ++G+A GL+DS+ +KYKDG++YVPNP 
Sbjct  687  KYGIQQFKPVPTGGPMGFGSFNNPNGYPINSPSIVGNAVGLEDSSRMKYKDGSIYVPNPQ  746

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAE+SEIW+ N RD+  LQ+  Y+N+  QTPHGAY+ +H+ H SF+    AAAA AQSSH
Sbjct  747  QAESSEIWLQNPRDLTGLQSPPYYNVAGQTPHGAYLSNHTAHPSFD----AAAAAAQSSH  802

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     P QP  +A+PHH+     G         + P  Q G YQQPQLGH+NW  N+
Sbjct  803  MQFQGLFHPTQPGAMASPHHM-GPGLGGNVGVGVTPSPPVAQAGTYQQPQLGHMNWPTNY  861



>ref|XP_010542406.1| PREDICTED: uncharacterized protein LOC104815628 isoform X2 [Tarenaya 
hassleriana]
Length=860

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 123/180 (68%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP-  469
            KYG+QQ+KPVPTG   GFGSF +  GY +N P ++G+A GL+DS+ +KYKDG++YVPNP 
Sbjct  686  KYGIQQFKPVPTGGPMGFGSFNNPNGYPINSPSIVGNAVGLEDSSRMKYKDGSIYVPNPQ  745

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAE+SEIW+ N RD+  LQ+  Y+N+  QTPHGAY+ +H+ H SF+    AAAA AQSSH
Sbjct  746  QAESSEIWLQNPRDLTGLQSPPYYNVAGQTPHGAYLSNHTAHPSFD----AAAAAAQSSH  801

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     P QP  +A+PHH+     G         + P  Q G YQQPQLGH+NW  N+
Sbjct  802  MQFQGLFHPTQPGAMASPHHM-GPGLGGNVGVGVTPSPPVAQAGTYQQPQLGHMNWPTNY  860



>ref|XP_008784271.1| PREDICTED: uncharacterized protein LOC103703266 isoform X2 [Phoenix 
dactylifera]
Length=861

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 118/181 (65%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +N PG IGSAAGL+D + +KYKD +LYVP PQ
Sbjct  688  KYATSQYKPVPVGSPTGYGNYANPAGFTINSPGTIGSAAGLEDVSRIKYKDNSLYVPTPQ  747

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETS+IW+   +++ +LQ+  Y+N+  Q PH  YMP+H+GHASFN       A AQSS++
Sbjct  748  AETSDIWIQTPQELSSLQSAPYYNLSGQAPHAVYMPTHAGHASFN-------AAAQSSNV  800

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaap--gtqlgAYQQPQLGHLNWTGN  115
            Q+P  + PPQP  +A+PH +      +             G Q+GAYQQPQL HLNW  N
Sbjct  801  QYPGLYHPPQPASVASPHQMVHQQVPSALGASVGVGVAPPGPQIGAYQQPQLSHLNWMAN  860

Query  114  F  112
            F
Sbjct  861  F  861



>ref|XP_008784270.1| PREDICTED: uncharacterized protein LOC103703266 isoform X1 [Phoenix 
dactylifera]
Length=871

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 118/181 (65%), Gaps = 10/181 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +N PG IGSAAGL+D + +KYKD +LYVP PQ
Sbjct  698  KYATSQYKPVPVGSPTGYGNYANPAGFTINSPGTIGSAAGLEDVSRIKYKDNSLYVPTPQ  757

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETS+IW+   +++ +LQ+  Y+N+  Q PH  YMP+H+GHASFN       A AQSS++
Sbjct  758  AETSDIWIQTPQELSSLQSAPYYNLSGQAPHAVYMPTHAGHASFN-------AAAQSSNV  810

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaap--gtqlgAYQQPQLGHLNWTGN  115
            Q+P  + PPQP  +A+PH +      +             G Q+GAYQQPQL HLNW  N
Sbjct  811  QYPGLYHPPQPASVASPHQMVHQQVPSALGASVGVGVAPPGPQIGAYQQPQLSHLNWMAN  870

Query  114  F  112
            F
Sbjct  871  F  871



>ref|XP_010654471.1| PREDICTED: uncharacterized protein LOC100248075 isoform X4 [Vitis 
vinifera]
Length=819

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 113/143 (79%), Gaps = 7/143 (5%)
 Frame = -3

Query  534  AAGLDDSTXLKYKDGNLYVPNPQAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPS  358
            A GL+DS+ LKYKDGN+YVPNPQAETSEIW+ N R++  LQ+  Y+NMPAQTPH AYMPS
Sbjct  682  ATGLEDSSRLKYKDGNIYVPNPQAETSEIWIQNPRELPGLQSAPYYNMPAQTPHAAYMPS  741

Query  357  HSGHASFNaaaaaaaavAQSSHMQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaa  181
            H+GHASFN    AAAA AQSSHMQFP +YHPPPQP  +A+PHHLG    G       AAA
Sbjct  742  HTGHASFN----AAAAAAQSSHMQFPGLYHPPPQPAAMASPHHLG-PPMGGNVGVGVAAA  796

Query  180  apgtqlgAYQQPQLGHLNWTGNF  112
            APG Q+GAYQQPQLGHLNWT NF
Sbjct  797  APGPQVGAYQQPQLGHLNWTTNF  819



>ref|XP_002885002.1| hypothetical protein ARALYDRAFT_478805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61261.1| hypothetical protein ARALYDRAFT_478805 [Arabidopsis lyrata subsp. 
lyrata]
Length=852

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 119/180 (66%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQYKPVPTG  TGFG++ +  GY +N P V+G+A GL+D + +KYKD N+YVPNP
Sbjct  682  KYGIHQQYKPVPTGGPTGFGTYNNPNGYPINPPNVVGNATGLEDPSRMKYKDVNIYVPNP  741

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  Q+PHG Y+ SH+ H SFN         AQSSH
Sbjct  742  QAETSEIWMQNPRDLSSLQS-PYYNVAGQSPHGTYLSSHTAHQSFN-------PAAQSSH  793

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +ANPHH+     G         + P +Q+G YQQ QLGH NW  NF
Sbjct  794  MQFQGLFHPPQPGTMANPHHM-GPGLGGNVGVGVVPSPPPSQVGTYQQSQLGHPNWPANF  852



>emb|CDY33258.1| BnaC01g37310D [Brassica napus]
Length=871

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 120/179 (67%), Gaps = 16/179 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G  TGFG++ S  GY +N P V+G+A GL+D + +KYKDGN+YVPNPQ
Sbjct  708  KYGIQQFKPVP-GGPTGFGTYNSPNGYQINPPNVVGNAMGLEDPSRMKYKDGNIYVPNPQ  766

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIWM N RD+ NLQ+  Y+N+  QTPHGAY+PSH+ H SFN    A AA  QSS M
Sbjct  767  AETSEIWMQNPRDLSNLQSPPYYNVAGQTPHGAYLPSHTAHPSFN----APAATTQSSQM  822

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF     PPQP   AN HH+G  + GNVGVG+  +             QLGH +W  NF
Sbjct  823  QFQGLFHPPQPGTRANLHHMGPGLGGNVGVGVVPSPPS----------QLGHPSWAANF  871



>ref|XP_009117284.1| PREDICTED: uncharacterized protein LOC103842413 isoform X1 [Brassica 
rapa]
Length=871

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 16/179 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G  TGFG++ S  GY +N P V+G+A GL+D + +KYKDGN+YVPNPQ
Sbjct  708  KYGIQQFKPVP-GGPTGFGTYNSPNGYQINPPNVVGNAMGLEDPSRMKYKDGNIYVPNPQ  766

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIWM N RD+ NLQ+  Y+N+  QTPHGAY+PSH+ H SFN    A AA  QSS M
Sbjct  767  AETSEIWMQNPRDLSNLQSPPYYNVAGQTPHGAYLPSHTPHPSFN----APAAATQSSQM  822

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF     PPQP  +AN HH+G  + GNVGVG+  +             QLGH +W  NF
Sbjct  823  QFQGLFHPPQPGTMANLHHMGPGLGGNVGVGVVPSPPS----------QLGHPSWASNF  871



>emb|CDY39087.1| BnaA01g29690D [Brassica napus]
Length=873

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 120/179 (67%), Gaps = 16/179 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G  TGFG++ S  GY +N P V+G+  GL+D + +KYKDGN+YVPNPQ
Sbjct  710  KYGIQQFKPVP-GGPTGFGTYNSPNGYQINPPNVVGNGMGLEDPSRMKYKDGNIYVPNPQ  768

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETSEIWM N RD+ NLQ+  Y+N+  QTPHGAY+PSH+ H SFN    A AA  QSS M
Sbjct  769  AETSEIWMQNPRDLSNLQSPPYYNVAGQTPHGAYLPSHTPHPSFN----APAAATQSSQM  824

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF     PPQP  +AN HH+G  + GNVGVG+  +             QLGH +W  NF
Sbjct  825  QFQGLFHPPQPGTMANLHHMGPGLGGNVGVGVVPSPPS----------QLGHPSWAANF  873



>ref|XP_006296970.1| hypothetical protein CARUB_v10012965mg [Capsella rubella]
 gb|EOA29868.1| hypothetical protein CARUB_v10012965mg [Capsella rubella]
Length=850

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 119/180 (66%), Gaps = 7/180 (4%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQ+KPV T   TGF ++ + +GY MN P V+G+A GL+DS+ +KYKDGN+Y PNP
Sbjct  676  KYGIHQQFKPVATSGHTGFQTYNNPSGYPMNSPNVVGNATGLEDSSRMKYKDGNIYTPNP  735

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            Q+ETSEIWM N RD+ +LQ+  Y+N+  QTPHG Y+ SH+ H SFN    AAA  AQ SH
Sbjct  736  QSETSEIWMTNPRDLSSLQSPQYYNVAGQTPHGTYLSSHTAHPSFN----AAAGAAQPSH  791

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  +AN HH+     G         + P +Q+G YQQ Q+GH NW  NF
Sbjct  792  MQFQGLFHPPQPGTMANQHHM-GPGLGGNVGVGVVPSPPPSQVGTYQQSQIGHPNWPANF  850



>emb|CDY65326.1| BnaCnng46620D [Brassica napus]
Length=851

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 122/181 (67%), Gaps = 14/181 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+QQ+KPVPTG  TGFG++ +    Y +N P V+G+A GL+D + +KYKDGN+YV NP
Sbjct  682  KYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNP  741

Query  468  Q-AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            Q AETS+IWM N RD+ +LQ+  Y+N+  QTPHGAY+PSH+ H SFN       A AQS 
Sbjct  742  QQAETSDIWMQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFN-------AAAQSP  794

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQF     PPQP  +AN HH+G      +G  +    +P +QLGAYQQ QLGH NW  N
Sbjct  795  QMQFQGLFHPPQPGAMANQHHMG----PGLGGNVGVVPSPPSQLGAYQQSQLGHPNWGAN  850

Query  114  F  112
            F
Sbjct  851  F  851



>gb|AFK36533.1| unknown [Lotus japonicus]
Length=146

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 114/153 (75%), Gaps = 10/153 (7%)
 Frame = -3

Query  561  MNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQAETSEIWM-NARDVXNLQTGSYFNMPAQ  385
            M  PGV+G A  L+DS+ +KYKD NLYVPNPQAETSEIW+ N RD   +Q+  Y+NMP Q
Sbjct  1    MIAPGVVGGATTLEDSSRVKYKD-NLYVPNPQAETSEIWLQNPRDHPGVQSTPYYNMPGQ  59

Query  384  TPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQFP-VYHPPPQPTPI-ANPHHLGTamsg  211
            TPHGAYM SH+GHASFN     AAA AQSSHMQFP +YH PPQP  + A+PHHLG    G
Sbjct  60   TPHGAYMASHTGHASFN-----AAAAAQSSHMQFPGMYHTPPQPGAVAASPHHLG-PAIG  113

Query  210  nvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            N      AAAAPG Q+GAYQQPQLGHLNWT NF
Sbjct  114  NNVGVGVAAAAPGAQVGAYQQPQLGHLNWTTNF  146



>ref|XP_008797695.1| PREDICTED: uncharacterized protein LOC103712805 isoform X6 [Phoenix 
dactylifera]
Length=716

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  538  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  597

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  598  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  650

Query  294  HMQFPVYHPPPQP---TPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L       G  G      AAPG Q+G YQQPQLGHL
Sbjct  651  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  710

Query  129  NWTGNF  112
             WT NF
Sbjct  711  GWTANF  716



>ref|XP_008797704.1| PREDICTED: uncharacterized protein LOC103712805 isoform X7 [Phoenix 
dactylifera]
Length=690

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  512  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  571

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  572  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  624

Query  294  HMQFPVYHPPPQP---TPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L       G  G      AAPG Q+G YQQPQLGHL
Sbjct  625  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  684

Query  129  NWTGNF  112
             WT NF
Sbjct  685  GWTANF  690



>ref|XP_008791894.1| PREDICTED: uncharacterized protein LOC103708646 [Phoenix dactylifera]
 ref|XP_008791895.1| PREDICTED: uncharacterized protein LOC103708646 [Phoenix dactylifera]
 ref|XP_008791896.1| PREDICTED: uncharacterized protein LOC103708646 [Phoenix dactylifera]
 ref|XP_008791897.1| PREDICTED: uncharacterized protein LOC103708646 [Phoenix dactylifera]
 ref|XP_008791898.1| PREDICTED: uncharacterized protein LOC103708646 [Phoenix dactylifera]
 ref|XP_008791899.1| PREDICTED: uncharacterized protein LOC103708646 [Phoenix dactylifera]
Length=659

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 120/179 (67%), Gaps = 10/179 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVPTGS TG+G++ +  G+ ++ PG +GSA GL+D T +KYK+ +LY+P PQ
Sbjct  490  KYAPSQYKPVPTGSPTGYGNYANPAGFTISSPGTLGSATGLEDMTRIKYKENSLYIPTPQ  549

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+TS+IW+   R++ +LQ+  Y+++  Q P  A+MP+H+GHASFN       A AQSSH+
Sbjct  550  ADTSDIWIQTQRELSSLQSAPYYSLSGQAPPAAFMPTHAGHASFN-------AAAQSSHV  602

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            Q+P  + PPQ   + +PH L        G      AAPG Q+GAYQQPQL HLNWT NF
Sbjct  603  QYPGLYHPPQLASVTSPHPLAA--PALGGSVGVGVAAPGPQVGAYQQPQLSHLNWTANF  659



>ref|XP_008797689.1| PREDICTED: uncharacterized protein LOC103712805 isoform X5 [Phoenix 
dactylifera]
Length=733

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  555  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  614

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  615  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  667

Query  294  HMQFPVYHPPPQP---TPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L       G  G      AAPG Q+G YQQPQLGHL
Sbjct  668  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  727

Query  129  NWTGNF  112
             WT NF
Sbjct  728  GWTANF  733



>ref|XP_008797682.1| PREDICTED: uncharacterized protein LOC103712805 isoform X4 [Phoenix 
dactylifera]
Length=795

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  617  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  676

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  677  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  729

Query  294  HMQFPVYHPPPQP---TPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L       G  G      AAPG Q+G YQQPQLGHL
Sbjct  730  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  789

Query  129  NWTGNF  112
             WT NF
Sbjct  790  GWTANF  795



>emb|CDX97535.1| BnaA05g25440D [Brassica napus]
Length=863

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 121/181 (67%), Gaps = 14/181 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+QQ+KPVPTG  TGFG++ +    Y +N P V+G+A GL+D + +KYKDGN+YV NP
Sbjct  694  KYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNP  753

Query  468  QA-ETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            Q  ETS+IWM N RD+ +LQ+  Y+N+  QTPHGAY+PSH+ H SFN       A AQS 
Sbjct  754  QQPETSDIWMQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFN-------AAAQSP  806

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQF     PPQP  +AN HH+G      +G  +    +P +QLGAYQQ QLGH NW  N
Sbjct  807  QMQFQGLFHPPQPGAMANQHHMG----PGLGGNVGVVPSPPSQLGAYQQSQLGHPNWGAN  862

Query  114  F  112
            F
Sbjct  863  F  863



>ref|XP_008797669.1| PREDICTED: uncharacterized protein LOC103712805 isoform X2 [Phoenix 
dactylifera]
Length=861

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 117/186 (63%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  683  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  742

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  743  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  795

Query  294  HMQFPVYHPPPQP---TPIANPHHLGTamsgnvgvgmaaaaapg--tqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L          G           Q+G YQQPQLGHL
Sbjct  796  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  855

Query  129  NWTGNF  112
             WT NF
Sbjct  856  GWTANF  861



>ref|XP_008797675.1| PREDICTED: uncharacterized protein LOC103712805 isoform X3 [Phoenix 
dactylifera]
Length=860

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  682  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  741

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  742  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  794

Query  294  HMQFPVYHPPPQP---TPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L       G  G      AAPG Q+G YQQPQLGHL
Sbjct  795  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  854

Query  129  NWTGNF  112
             WT NF
Sbjct  855  GWTANF  860



>ref|XP_008797659.1| PREDICTED: uncharacterized protein LOC103712805 isoform X1 [Phoenix 
dactylifera]
Length=886

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +GS+T+ +G+ M+ PG +GS +GLD+++ +KYKD + YVPNPQ
Sbjct  708  KYATSQYKPVPAGSPNAYGSYTNPSGFTMSAPGTVGSTSGLDEASRIKYKDNSSYVPNPQ  767

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  768  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  820

Query  294  HMQFPVYHPPPQP---TPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L       G  G      AAPG Q+G YQQPQLGHL
Sbjct  821  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLGHL  880

Query  129  NWTGNF  112
             WT NF
Sbjct  881  GWTANF  886



>ref|XP_009146424.1| PREDICTED: uncharacterized protein LOC103870075 isoform X2 [Brassica 
rapa]
Length=902

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 121/181 (67%), Gaps = 14/181 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+QQ+KPVPTG  TGFG++ +    Y +N P V+G+A GL+D + +KYKDGN+YV NP
Sbjct  733  KYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNP  792

Query  468  -QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
             Q ETS+IWM N RD+ +LQ+  Y+N+  QTPHGAY+PSH+ H SFN       A AQS 
Sbjct  793  RQPETSDIWMQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFN-------AAAQSP  845

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
             MQF     PPQP  +AN HH+G      +G  +    +P +QLGAYQQ QLGH NW  N
Sbjct  846  QMQFQGLFHPPQPGAMANQHHMG----PGLGGNVGVVPSPPSQLGAYQQSQLGHPNWGAN  901

Query  114  F  112
            F
Sbjct  902  F  902



>ref|XP_009146423.1| PREDICTED: uncharacterized protein LOC103870075 isoform X1 [Brassica 
rapa]
Length=903

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 121/182 (66%), Gaps = 15/182 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+QQ+KPVPTG  TGFG++ +    Y +N P V+G+A GL+D + +KYKDGN+YV NP
Sbjct  733  KYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNP  792

Query  468  --QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQS  298
              Q ETS+IWM N RD+ +LQ+  Y+N+  QTPHGAY+PSH+ H SFN       A AQS
Sbjct  793  RQQPETSDIWMQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFN-------AAAQS  845

Query  297  SHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTG  118
              MQF     PPQP  +AN HH+G      +G  +    +P +QLGAYQQ QLGH NW  
Sbjct  846  PQMQFQGLFHPPQPGAMANQHHMG----PGLGGNVGVVPSPPSQLGAYQQSQLGHPNWGA  901

Query  117  NF  112
            NF
Sbjct  902  NF  903



>ref|XP_009146425.1| PREDICTED: uncharacterized protein LOC103870075 isoform X3 [Brassica 
rapa]
Length=902

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 121/182 (66%), Gaps = 15/182 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+QQ+KPVPTG  TGFG++ +    Y +N P V+G+A GL+D + +KYKDGN+YV NP
Sbjct  732  KYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNP  791

Query  468  --QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQS  298
              Q ETS+IWM N RD+ +LQ+  Y+N+  QTPHGAY+PSH+ H SFN       A AQS
Sbjct  792  RQQPETSDIWMQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFN-------AAAQS  844

Query  297  SHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTG  118
              MQF     PPQP  +AN HH+G      +G  +    +P +QLGAYQQ QLGH NW  
Sbjct  845  PQMQFQGLFHPPQPGAMANQHHMG----PGLGGNVGVVPSPPSQLGAYQQSQLGHPNWGA  900

Query  117  NF  112
            NF
Sbjct  901  NF  902



>ref|NP_001078149.1| kinase-related protein [Arabidopsis thaliana]
 dbj|BAE99198.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75449.1| uncharacterized protein AT3G13990 [Arabidopsis thaliana]
Length=847

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 115/180 (64%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQYKPVPTG   GFG++ +  GY  N P V+G+A GL+D + +  K GN+YVPNP
Sbjct  677  KYGIHQQYKPVPTGGPAGFGTYNNPNGYPTNPPNVVGNATGLEDPSRMINKHGNIYVPNP  736

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  Q+PHGAY+ SH+ H SFN         AQSSH
Sbjct  737  QAETSEIWMQNPRDLSSLQS-PYYNVAGQSPHGAYLSSHTAHQSFN-------PTAQSSH  788

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     P QP  +ANPHH+G              + P +Q+G YQQ QLGH NW  NF
Sbjct  789  MQFQGLFHPSQPGTMANPHHMG-PGLSGNVGVGVVPSPPPSQIGTYQQSQLGHPNWPSNF  847



>ref|NP_188015.2| kinase-related protein [Arabidopsis thaliana]
 gb|AAM83252.1| AT3g13990/MDC16_11 [Arabidopsis thaliana]
 gb|AAN18205.1| At3g13990/MDC16_11 [Arabidopsis thaliana]
 gb|AEE75448.1| uncharacterized protein AT3G13990 [Arabidopsis thaliana]
Length=848

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 115/180 (64%), Gaps = 11/180 (6%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQYKPVPTG   GFG++ +  GY  N P V+G+A GL+D + +  K GN+YVPNP
Sbjct  678  KYGIHQQYKPVPTGGPAGFGTYNNPNGYPTNPPNVVGNATGLEDPSRMINKHGNIYVPNP  737

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  Q+PHGAY+ SH+ H SFN         AQSSH
Sbjct  738  QAETSEIWMQNPRDLSSLQS-PYYNVAGQSPHGAYLSSHTAHQSFN-------PTAQSSH  789

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     P QP  +ANPHH+G              + P +Q+G YQQ QLGH NW  NF
Sbjct  790  MQFQGLFHPSQPGTMANPHHMG-PGLSGNVGVGVVPSPPPSQIGTYQQSQLGHPNWPSNF  848



>gb|KFK38756.1| hypothetical protein AALP_AA3G156400 [Arabis alpina]
Length=870

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQYKPVPTG   GFG++++  GY +N P V     GL+DS+ +K+KDGN+YVPNPQ
Sbjct  699  KYGIQQYKPVPTGGPAGFGTYSNPNGYQINSPNV--GNMGLEDSSRMKFKDGNIYVPNPQ  756

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA-QTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AETSEIWM N RD+ +LQ+  Y+N+   QTPHGAY+PSH+ H SFN    AAAA AQSS 
Sbjct  757  AETSEIWMQNPRDLSSLQSPQYYNVAGQQTPHGAYLPSHTAHPSFN----AAAAAAQSSQ  812

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  + NPH       G         + P +QLG Y Q QLGH NW  NF
Sbjct  813  MQFQGLFHPPQPGTMGNPHM--GPGLGGNVGVGVVPSPPPSQLGTYPQSQLGHPNWPANF  870



>gb|KFK38755.1| hypothetical protein AALP_AA3G156400 [Arabis alpina]
Length=869

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQYKPVPTG   GFG++++  GY +N P V     GL+DS+ +K+KDGN+YVPNPQ
Sbjct  698  KYGIQQYKPVPTGGPAGFGTYSNPNGYQINSPNV--GNMGLEDSSRMKFKDGNIYVPNPQ  755

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA-QTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AETSEIWM N RD+ +LQ+  Y+N+   QTPHGAY+PSH+ H SFN    AAAA AQSS 
Sbjct  756  AETSEIWMQNPRDLSSLQSPQYYNVAGQQTPHGAYLPSHTAHPSFN----AAAAAAQSSQ  811

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  + NPH       G         + P +QLG Y Q QLGH NW  NF
Sbjct  812  MQFQGLFHPPQPGTMGNPHM--GPGLGGNVGVGVVPSPPPSQLGTYPQSQLGHPNWPANF  869



>gb|KFK38754.1| hypothetical protein AALP_AA3G156400 [Arabis alpina]
Length=869

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 118/180 (66%), Gaps = 10/180 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQYKPVPTG   GFG++++  GY +N P V     GL+DS+ +K+KDGN+YVPNPQ
Sbjct  698  KYGIQQYKPVPTGGPAGFGTYSNPNGYQINSPNV--GNMGLEDSSRMKFKDGNIYVPNPQ  755

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA-QTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AETSEIWM N RD+ +LQ+  Y+N+   QTPHGAY+PSH+ H SFN    AAAA AQSS 
Sbjct  756  AETSEIWMQNPRDLSSLQSPQYYNVAGQQTPHGAYLPSHTAHPSFN----AAAAAAQSSQ  811

Query  291  MQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            MQF     PPQP  + NPH       G         + P +QLG Y Q QLGH NW  NF
Sbjct  812  MQFQGLFHPPQPGTMGNPHM--GPGLGGNVGVGVVPSPPPSQLGTYPQSQLGHPNWPANF  869



>ref|XP_010917134.1| PREDICTED: eukaryotic translation initiation factor 4 gamma-like 
isoform X3 [Elaeis guineensis]
Length=802

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +  PG +GSA GL+D   +KYK+ +LYVP PQ
Sbjct  631  KYATSQYKPVPIGSPTGYGNYANPAGFTIGSPGPLGSATGLEDMNRIKYKENSLYVPTPQ  690

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+ S+IW+   R++ +LQ+  Y+++  Q PH A+M SH+GHASFNAAA        SSH+
Sbjct  691  ADASDIWIQTPRELLSLQSAPYYSLSGQAPHAAFMASHAGHASFNAAAP-------SSHV  743

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            Q+P  + PPQP  IA+PH L     G        A  P        QP+L H NWT NF
Sbjct  744  QYPDLYHPPQPASIASPHQLVGPAVGGSVGVGGPARGPQVGAYQQPQPRLSHHNWTANF  802



>ref|XP_010917133.1| PREDICTED: uncharacterized protein LOC105041803 isoform X2 [Elaeis 
guineensis]
Length=859

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +  PG +GSA GL+D   +KYK+ +LYVP PQ
Sbjct  688  KYATSQYKPVPIGSPTGYGNYANPAGFTIGSPGPLGSATGLEDMNRIKYKENSLYVPTPQ  747

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+ S+IW+   R++ +LQ+  Y+++  Q PH A+M SH+GHASFNAAA        SSH+
Sbjct  748  ADASDIWIQTPRELLSLQSAPYYSLSGQAPHAAFMASHAGHASFNAAAP-------SSHV  800

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            Q+P  + PPQP  IA+PH L     G        A  P        QP+L H NWT NF
Sbjct  801  QYPDLYHPPQPASIASPHQLVGPAVGGSVGVGGPARGPQVGAYQQPQPRLSHHNWTANF  859



>ref|XP_010917132.1| PREDICTED: uncharacterized protein LOC105041803 isoform X1 [Elaeis 
guineensis]
Length=861

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 8/179 (4%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS TG+G++ +  G+ +  PG +GSA GL+D   +KYK+ +LYVP PQ
Sbjct  690  KYATSQYKPVPIGSPTGYGNYANPAGFTIGSPGPLGSATGLEDMNRIKYKENSLYVPTPQ  749

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            A+ S+IW+   R++ +LQ+  Y+++  Q PH A+M SH+GHASFNAAA        SSH+
Sbjct  750  ADASDIWIQTPRELLSLQSAPYYSLSGQAPHAAFMASHAGHASFNAAAP-------SSHV  802

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            Q+P  + PPQP  IA+PH L     G        A  P        QP+L H NWT NF
Sbjct  803  QYPDLYHPPQPASIASPHQLVGPAVGGSVGVGGPARGPQVGAYQQPQPRLSHHNWTANF  861



>ref|XP_010936970.1| PREDICTED: uncharacterized protein LOC105056461 isoform X2 [Elaeis 
guineensis]
Length=861

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 115/186 (62%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +G++++ +G+ M+ PG  GS +GLD+++ +KYKD + YVPNPQ
Sbjct  683  KYATSQYKPVPAGSPNAYGNYSNPSGFTMSAPGTAGSTSGLDEASRIKYKDNSSYVPNPQ  742

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  743  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  795

Query  294  HMQFPVYHPPPQP---TPIANPHHLGTamsgnvgvgmaaaaapg--tqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L          G           Q+G YQQPQL HL
Sbjct  796  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLSHL  855

Query  129  NWTGNF  112
             WT NF
Sbjct  856  GWTANF  861



>ref|XP_010936968.1| PREDICTED: uncharacterized protein LOC105056461 isoform X1 [Elaeis 
guineensis]
Length=863

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 115/186 (62%), Gaps = 15/186 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS   +G++++ +G+ M+ PG  GS +GLD+++ +KYKD + YVPNPQ
Sbjct  685  KYATSQYKPVPAGSPNAYGNYSNPSGFTMSAPGTAGSTSGLDEASRIKYKDNSSYVPNPQ  744

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            AETS+IW+   RD+ NLQ+  ++N+  Q   PH AY+P+H+GHASFN       A AQ+S
Sbjct  745  AETSDIWIQTPRDLPNLQSAPFYNLSGQAAAPHAAYLPTHAGHASFN-------AAAQTS  797

Query  294  HMQFPVYHPPPQP---TPIANPHHLGTamsgnvgvgmaaaaapg--tqlgAYQQPQLGHL  130
            H+Q+P  +  PQP     IA+PH L          G           Q+G YQQPQL HL
Sbjct  798  HVQYPGMYHSPQPASMASIASPHPLVHQQMQPGLGGNVGVGVAAPGAQVGTYQQPQLSHL  857

Query  129  NWTGNF  112
             WT NF
Sbjct  858  GWTANF  863



>dbj|BAB02329.1| unnamed protein product [Arabidopsis thaliana]
Length=870

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 98/142 (69%), Gaps = 10/142 (7%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+ QQYKPVPTG   GFG++ +  GY  N P V+G+A GL+D + +  K GN+YVPNP
Sbjct  677  KYGIHQQYKPVPTGGPAGFGTYNNPNGYPTNPPNVVGNATGLEDPSRMINKHGNIYVPNP  736

Query  468  QAETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            QAETSEIWM N RD+ +LQ+  Y+N+  Q+PHGAY+ SH+ H SFN         AQSSH
Sbjct  737  QAETSEIWMQNPRDLSSLQS-PYYNVAGQSPHGAYLSSHTAHQSFN-------PTAQSSH  788

Query  291  MQFPVYHPPPQPTPIANPHHLG  226
            MQF     P QP  +ANPHH+G
Sbjct  789  MQFQGLFHPSQPGTMANPHHMG  810



>ref|XP_009391448.1| PREDICTED: uncharacterized protein LOC103977608 [Musa acuminata 
subsp. malaccensis]
Length=857

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 113/183 (62%), Gaps = 12/183 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KY   QYKPVP GS T + S+ +  G+ ++ PG +GS AG DD T +KYKD  LY+PN Q
Sbjct  682  KYAAAQYKPVPGGSPTAYASYNNSAGFTISPPGAVGSTAGPDDITRIKYKDHGLYMPNQQ  741

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            AETS+IW+   R+  +LQ+  Y+N+  Q PH A++P+H+GH SF  AA       Q SH+
Sbjct  742  AETSDIWIQTQREHPSLQSAPYYNLSGQAPHAAFLPAHAGHGSFGPAA-------QISHV  794

Query  288  QFPVYHPPPQPTPIANPHHLG----TamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWT  121
            Q+P  + P QP  +A+PH L         G       AA  PG Q+G YQQPQ+GHLNWT
Sbjct  795  QYPGLYHPSQPASMASPHQLVHHNVAPAIGGGVGVGVAAPGPGPQVGTYQQPQVGHLNWT  854

Query  120  GNF  112
             NF
Sbjct  855  ANF  857



>ref|XP_006392706.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
 gb|ESQ29992.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
Length=832

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 123/181 (68%), Gaps = 17/181 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G  TGFG+F + TGY ++   V+G+A G +DS+ +KYKDGN+YVPNPQ
Sbjct  666  KYGIQQFKPVPGGGPTGFGTFNNPTGYQISSLNVVGNAPGFEDSSRMKYKDGNVYVPNPQ  725

Query  465  AETSEIWM-NARDVX-NLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AETSEIWM N+RD+  +LQ+  Y+NM  QTPH AYM      +SFN      +   QSSH
Sbjct  726  AETSEIWMQNSRDLSGSLQSPPYYNMAGQTPHAAYM------SSFN------SPPVQSSH  773

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQF  V+H  PQP P+ANPHH+  +  G       A +    Q+GAYQQPQLGHLNW  +
Sbjct  774  MQFQGVFH-SPQPGPMANPHHM-GSGLGGNVGLGVAPSPSPVQVGAYQQPQLGHLNWPAS  831

Query  114  F  112
            F
Sbjct  832  F  832



>ref|XP_006392705.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
 gb|ESQ29991.1| hypothetical protein EUTSA_v10011240mg [Eutrema salsugineum]
Length=831

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 123/181 (68%), Gaps = 17/181 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G  TGFG+F + TGY ++   V+G+A G +DS+ +KYKDGN+YVPNPQ
Sbjct  665  KYGIQQFKPVPGGGPTGFGTFNNPTGYQISSLNVVGNAPGFEDSSRMKYKDGNVYVPNPQ  724

Query  465  AETSEIWM-NARDVX-NLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AETSEIWM N+RD+  +LQ+  Y+NM  QTPH AYM      +SFN      +   QSSH
Sbjct  725  AETSEIWMQNSRDLSGSLQSPPYYNMAGQTPHAAYM------SSFN------SPPVQSSH  772

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQF  V+H  PQP P+ANPHH+  +  G       A +    Q+GAYQQPQLGHLNW  +
Sbjct  773  MQFQGVFH-SPQPGPMANPHHM-GSGLGGNVGLGVAPSPSPVQVGAYQQPQLGHLNWPAS  830

Query  114  F  112
            F
Sbjct  831  F  831



>ref|XP_009146426.1| PREDICTED: uncharacterized protein LOC103870075 isoform X4 [Brassica 
rapa]
Length=892

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 20/179 (11%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG+QQ+KPVPTG  TGFG++ +    Y +N P V+G+A GL+D + +KYKDGN+YV NP
Sbjct  733  KYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNP  792

Query  468  QAETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
            +        N RD+ +LQ+  Y+N+  QTPHGAY+PSH+ H SFN       A AQS  M
Sbjct  793  R--------NPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFN-------AAAQSPQM  837

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            QF     PPQP  +AN HH+G      +G  +    +P +QLGAYQQ QLGH NW  NF
Sbjct  838  QFQGLFHPPQPGAMANQHHMG----PGLGGNVGVVPSPPSQLGAYQQSQLGHPNWGANF  892



>emb|CAN64817.1| hypothetical protein VITISV_010669 [Vitis vinifera]
Length=480

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 20/142 (14%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            K+G+Q  KPV  GS TGFG+FT+ TGYA+N P V+GSA GL+DS+              +
Sbjct  211  KHGIQLLKPVLAGSPTGFGNFTNPTGYAINAPSVVGSATGLEDSS--------------R  256

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ET EIW+ N R++  LQ   Y+NMPAQTPH  YM SH+GHASFN     A A AQSSHM
Sbjct  257  PETLEIWIQNPRELPGLQYAPYYNMPAQTPHAPYMSSHTGHASFN----VAVAAAQSSHM  312

Query  288  QFP-VYHPPPQPTPIANPHHLG  226
            QF  +YH PPQP  +A+PHHLG
Sbjct  313  QFHGLYHSPPQPAAMASPHHLG  334



>ref|XP_009117292.1| PREDICTED: uncharacterized protein LOC103842413 isoform X2 [Brassica 
rapa]
Length=862

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 113/178 (63%), Gaps = 23/178 (13%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVP G  TGFG++ S  GY +N P V+G+A GL+D + +KYKDGN+YVPNPQ
Sbjct  708  KYGIQQFKPVP-GGPTGFGTYNSPNGYQINPPNVVGNAMGLEDPSRMKYKDGNIYVPNPQ  766

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
                    N RD+ NLQ+  Y+N+  QTPHGAY+PSH+ H SFN    A AA  QSS MQ
Sbjct  767  --------NPRDLSNLQSPPYYNVAGQTPHGAYLPSHTPHPSFN----APAAATQSSQMQ  814

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
            F     PPQP  +AN HH+G  + GNVGVG+  +             QLGH +W  NF
Sbjct  815  FQGLFHPPQPGTMANLHHMGPGLGGNVGVGVVPSPPS----------QLGHPSWASNF  862



>dbj|BAK02193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=876

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 110/176 (63%), Gaps = 10/176 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP G+ +G+G++T   GY ++ PGVIG+  G+DD   +KYKD N+Y P PQ
Sbjct  704  KYGVSQYKPVPAGNPSGYGNYTHPAGYTISSPGVIGAGVGVDDVNRMKYKDNNIYAPTPQ  763

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
             ETS+IW+  R++  LQ   Y+N+  Q   GAYMP + G+ASF+       A AQSSH Q
Sbjct  764  VETSDIWIQNREIPTLQCPPYYNLSGQATPGAYMP-NPGNASFS-------ATAQSSHAQ  815

Query  285  FPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNW  124
            FP  + P QP  I +PH +      +          AAPG Q+GAYQQ QLGH+NW
Sbjct  816  FPGMYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQQQLGHMNW  871



>gb|EMT03241.1| hypothetical protein F775_28234 [Aegilops tauschii]
Length=859

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 111/177 (63%), Gaps = 22/177 (12%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP G+ +G+G++T   GY ++ PGVIG+  G+DD   +KYKD N+Y P PQ
Sbjct  697  KYGVSQYKPVPAGNPSGYGNYTHPAGYTISSPGVIGAGVGVDDVNRMKYKDNNIYAPTPQ  756

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
             ETS+IW+  R++  LQ   Y+N+  Q   GAYMP + G+ASF+       A AQSSH Q
Sbjct  757  VETSDIWIQNREIPTLQCPPYYNLSGQATPGAYMP-NPGNASFS-------ATAQSSHAQ  808

Query  285  FP-VYHP--PPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNW  124
            FP +YHP  PP   P A   ++G              AAPG Q+GAYQQ QLGH+NW
Sbjct  809  FPGMYHPQQPPSIVPSAIGPNVGV-----------GVAAPGPQVGAYQQQQLGHMNW  854



>gb|EMS49912.1| hypothetical protein TRIUR3_09953 [Triticum urartu]
Length=786

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 111/177 (63%), Gaps = 22/177 (12%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP G+ +G+G++T   GY ++ PGVIG+  G+DD   +KYKD N+Y P PQ
Sbjct  624  KYGVSQYKPVPAGNPSGYGNYTHPAGYTISSPGVIGAGVGVDDVNRMKYKDNNIYAPTPQ  683

Query  465  AETSEIWMNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQ  286
             ETS+IW+  R++  LQ   Y+N+  Q   GAYMP+  G+ASF+       A AQSSH Q
Sbjct  684  VETSDIWIQNREIPTLQCPPYYNLSGQATPGAYMPN-PGNASFS-------ATAQSSHAQ  735

Query  285  FP-VYHP--PPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNW  124
            FP +YHP  PP   P A   ++G              AAPG Q+GAYQQ QLGH+NW
Sbjct  736  FPGMYHPQQPPSIVPSAIGPNVGV-----------GVAAPGPQVGAYQQQQLGHMNW  781



>gb|AFW85388.1| putative DUF1296 domain containing family protein [Zea mays]
Length=231

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  60   KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  118

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  119  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  170

Query  288  QFPVYHPPPQPTPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      S          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  171  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  230

Query  114  F  112
            F
Sbjct  231  F  231



>ref|XP_002436662.1| hypothetical protein SORBIDRAFT_10g006740 [Sorghum bicolor]
 gb|EER88029.1| hypothetical protein SORBIDRAFT_10g006740 [Sorghum bicolor]
Length=859

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 116/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP+G+ +G+G++T   G+ M  PGVIG+A G+DD   +KYKD N+Y   PQ
Sbjct  688  KYGVSQYKPVPSGNPSGYGNYTHPAGFTMGSPGVIGAAVGVDDVNRMKYKD-NIYASTPQ  746

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+ +AR++  LQ  SY+N+P Q   GA++P +  +ASFN       A AQSSH 
Sbjct  747  VETSDIWIQSAREMPPLQVPSYYNIPGQATAGAFVP-NPANASFN-------ATAQSSHA  798

Query  288  QFPVYHPPPQPTPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      S          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  799  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  858

Query  114  F  112
            F
Sbjct  859  F  859



>ref|NP_001182930.1| uncharacterized protein LOC100501220 [Zea mays]
 gb|ACR35156.1| unknown [Zea mays]
Length=277

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  106  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  164

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  165  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  216

Query  288  QFPVYHPPPQPTPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      S          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  217  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  276

Query  114  F  112
            F
Sbjct  277  F  277



>ref|XP_010534929.1| PREDICTED: uncharacterized protein LOC104810364 isoform X1 [Tarenaya 
hassleriana]
Length=836

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 24/181 (13%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTG  +GF SF +  GY +N P   G+A+GL++S  +KYKDG+ YVPNPQ
Sbjct  677  KYGIQQFKPVPTGGPSGFQSFNNPNGYPINSP---GNASGLEESR-MKYKDGSFYVPNPQ  732

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA-QTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AE+SEIWM N RD   LQ+  Y+N+ A QTPHGAY+ +H  H +            Q SH
Sbjct  733  AESSEIWMQNPRD---LQSPPYYNVAAGQTPHGAYISNHMAHPA------------QPSH  777

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQF  ++HP      +A+PHH+G        VG+  A  P  Q+G YQQPQLGH++W  N
Sbjct  778  MQFQGLFHPAQPGGAMASPHHMGP--GLGGNVGVGVAPTPAAQVGNYQQPQLGHMSWPTN  835

Query  114  F  112
            F
Sbjct  836  F  836



>ref|XP_010534930.1| PREDICTED: uncharacterized protein LOC104810364 isoform X2 [Tarenaya 
hassleriana]
Length=672

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 116/181 (64%), Gaps = 24/181 (13%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTG  +GF SF +  GY +N P   G+A+GL++S  +KYKDG+ YVPNPQ
Sbjct  513  KYGIQQFKPVPTGGPSGFQSFNNPNGYPINSP---GNASGLEESR-MKYKDGSFYVPNPQ  568

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA-QTPHGAYMPSHSGHASFNaaaaaaaavAQSSH  292
            AE+SEIWM N RD   LQ+  Y+N+ A QTPHGAY+ +H  H +            Q SH
Sbjct  569  AESSEIWMQNPRD---LQSPPYYNVAAGQTPHGAYISNHMAHPA------------QPSH  613

Query  291  MQFP-VYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            MQF  ++HP      +A+PHH+G        VG+  A  P  Q+G YQQPQLGH++W  N
Sbjct  614  MQFQGLFHPAQPGGAMASPHHMGP--GLGGNVGVGVAPTPAAQVGNYQQPQLGHMSWPTN  671

Query  114  F  112
            F
Sbjct  672  F  672



>gb|AFW85389.1| putative DUF1296 domain containing family protein [Zea mays]
Length=395

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  224  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  282

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  283  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  334

Query  288  QFPVYHPPPQPTPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      S          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  335  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  394

Query  114  F  112
            F
Sbjct  395  F  395



>ref|XP_006656745.1| PREDICTED: uncharacterized protein LOC102709938, partial [Oryza 
brachyantha]
Length=1028

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 107/174 (61%), Gaps = 11/174 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP GS +G+G++T   GY ++ PG+IG   G+DD   +KYKD NLY P+PQ
Sbjct  658  KYGVSQYKPVPAGSPSGYGNYTHPAGYPISSPGIIGGNVGVDDVNRIKYKDNNLYAPSPQ  717

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+   R++  +Q   YFN+  QT  GA++P + G+A FN       A AQSSH 
Sbjct  718  VETSDIWIQTPREMQPMQCPPYFNLSGQTTSGAFVP-NPGNAPFN-------ATAQSSHA  769

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGH  133
            QFP  + P QP+ I +PH +      +          A P  Q+GAYQQPQLGH
Sbjct  770  QFPGLYHPQQPSSIVSPHAMVHQQVPSAIGPSVGVGVATPAPQVGAYQQPQLGH  823



>ref|XP_008658959.1| PREDICTED: uncharacterized protein LOC100501220 isoform X4 [Zea 
mays]
Length=851

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  680  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  738

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  739  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  790

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      +          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  791  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  850

Query  114  F  112
            F
Sbjct  851  F  851



>ref|XP_008658958.1| PREDICTED: uncharacterized protein LOC100501220 isoform X3 [Zea 
mays]
Length=852

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  681  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  740  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  791

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      +          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  792  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  851

Query  114  F  112
            F
Sbjct  852  F  852



>ref|XP_008658956.1| PREDICTED: uncharacterized protein LOC100501220 isoform X1 [Zea 
mays]
Length=853

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  682  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  740

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  741  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  792

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      +          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  793  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  852

Query  114  F  112
            F
Sbjct  853  F  853



>ref|XP_008658957.1| PREDICTED: uncharacterized protein LOC100501220 isoform X2 [Zea 
mays]
 gb|AFW85391.1| putative DUF1296 domain containing family protein [Zea mays]
Length=852

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  681  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  740  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  791

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      +          AAPG Q+GAYQQPQLGH+NW  +
Sbjct  792  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNWRPS  851

Query  114  F  112
            F
Sbjct  852  F  852



>ref|XP_008648067.1| PREDICTED: uncharacterized protein LOC100382099 isoform X1 [Zea 
mays]
 gb|AFW76656.1| putative DUF1296 domain containing family protein [Zea mays]
Length=858

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 113/181 (62%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP+G+ +G+G++T   G+ M  PGVIG+A G+DD   +KYKD N+Y   PQ
Sbjct  687  KYGVSQYKPVPSGNPSGYGNYTHPAGFTMGSPGVIGAAVGVDDVNRMKYKD-NIYASTPQ  745

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  LQ  SY+N+P Q   GA++P +  +ASFN       A +QS H 
Sbjct  746  VETSDIWIQTAREMPPLQVPSYYNIPGQATPGAFVP-NPANASFN-------ATSQSPHA  797

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      +          AAPG Q+GAYQQ Q+GH+NW  +
Sbjct  798  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQRQIGHMNWRPS  857

Query  114  F  112
            F
Sbjct  858  F  858



>ref|NP_001168331.1| uncharacterized protein LOC100382099 [Zea mays]
 gb|ACN27843.1| unknown [Zea mays]
Length=857

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 113/181 (62%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP+G+ +G+G++T   G+ M  PGVIG+A G+DD   +KYKD N+Y   PQ
Sbjct  686  KYGVSQYKPVPSGNPSGYGNYTHPAGFTMGSPGVIGAAVGVDDVNRMKYKD-NIYASTPQ  744

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  LQ  SY+N+P Q   GA++P +  +ASFN       A +QS H 
Sbjct  745  VETSDIWIQTAREMPPLQVPSYYNIPGQATPGAFVP-NPANASFN-------ATSQSPHA  796

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      +          AAPG Q+GAYQQ Q+GH+NW  +
Sbjct  797  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQRQIGHMNWRPS  856

Query  114  F  112
            F
Sbjct  857  F  857



>ref|XP_010227879.1| PREDICTED: uncharacterized protein LOC100833454 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 109/177 (62%), Gaps = 11/177 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVPTG+ +G+G++T   G+ ++ PGVIG+A G+DD   +KYKD N+Y   PQ
Sbjct  676  KYGVSQYKPVPTGNPSGYGNYTHPAGFTISSPGVIGAAVGVDDVNRMKYKDNNIYAQTPQ  735

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             E S+IW+   R++  LQ   Y+N+  Q   GAYM ++ G+AS+N       A AQSSH 
Sbjct  736  VEASDIWIQTPREMPTLQCPPYYNISGQATPGAYM-ANPGNASYN-------ATAQSSHA  787

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNW  124
            QF   +   QP  I +PH +      +          AAPG Q+GAYQQPQLGH+NW
Sbjct  788  QFAGMYHQQQPPSIVSPHAMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNW  844



>ref|XP_010227878.1| PREDICTED: uncharacterized protein LOC100833454 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 109/177 (62%), Gaps = 11/177 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVPTG+ +G+G++T   G+ ++ PGVIG+A G+DD   +KYKD N+Y   PQ
Sbjct  677  KYGVSQYKPVPTGNPSGYGNYTHPAGFTISSPGVIGAAVGVDDVNRMKYKDNNIYAQTPQ  736

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             E S+IW+   R++  LQ   Y+N+  Q   GAYM ++ G+AS+N       A AQSSH 
Sbjct  737  VEASDIWIQTPREMPTLQCPPYYNISGQATPGAYM-ANPGNASYN-------ATAQSSHA  788

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNW  124
            QF   +   QP  I +PH +      +          AAPG Q+GAYQQPQLGH+NW
Sbjct  789  QFAGMYHQQQPPSIVSPHAMVHQQVPSAIGPNVGVGVAAPGPQVGAYQQPQLGHMNW  845



>ref|XP_004964933.1| PREDICTED: uncharacterized protein LOC101755132 isoform X1 [Setaria 
italica]
Length=852

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 109/181 (60%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP G+ + +G++T   G+ M  PGVIG+A G+DD   +KYKD N+Y    Q
Sbjct  681  KYGVSQYKPVPAGNPSAYGNYT-PAGFTMGSPGVIGAAVGVDDVNRMKYKDNNIYASTQQ  739

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+ A R++  +Q   Y+N+  Q   GA++P +  +ASFN       A AQSSH 
Sbjct  740  VETSDIWIQAGREIPTMQVPPYYNISGQATPGAFVP-NPANASFN-------ATAQSSHA  791

Query  288  QFPVYHPPPQPTPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      S          AAPG Q+G YQQPQLGH+NW  +
Sbjct  792  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGTYQQPQLGHMNWRPS  851

Query  114  F  112
            F
Sbjct  852  F  852



>ref|XP_004964934.1| PREDICTED: uncharacterized protein LOC101755132 isoform X2 [Setaria 
italica]
Length=847

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 109/181 (60%), Gaps = 12/181 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP G+ + +G++T   G+ M  PGVIG+A G+DD   +KYKD N+Y    Q
Sbjct  676  KYGVSQYKPVPAGNPSAYGNYT-PAGFTMGSPGVIGAAVGVDDVNRMKYKDNNIYASTQQ  734

Query  465  AETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+ A R++  +Q   Y+N+  Q   GA++P +  +ASFN       A AQSSH 
Sbjct  735  VETSDIWIQAGREIPTMQVPPYYNISGQATPGAFVP-NPANASFN-------ATAQSSHA  786

Query  288  QFPVYHPPPQPTPIANPHHL--GTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGN  115
            QFP  + P QP  I +PH +      S          AAPG Q+G YQQPQLGH+NW  +
Sbjct  787  QFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQVGTYQQPQLGHMNWRPS  846

Query  114  F  112
            F
Sbjct  847  F  847



>ref|XP_009393682.1| PREDICTED: uncharacterized protein LOC103979312 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 99/182 (54%), Gaps = 11/182 (6%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            K    QY+P+  G+ TG G++T+   +A++ PG + +    +D   +KYKD N++VPNPQ
Sbjct  508  KCATTQYRPIAAGNPTGCGTYTNPASFAISFPGAVSNTTSQEDLNSVKYKDNNVFVPNPQ  567

Query  465  AETSEIW-MNARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             +TS+ W + +R++ NLQ+  Y+++  Q    A++P+H+ HA FN       A   +SH+
Sbjct  568  LDTSDNWILTSRELPNLQSAPYYSLSGQALQSAFLPAHADHAVFN-------ATRNTSHV  620

Query  288  QFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapg---tqlgAYQQPQLGHLNWTG  118
            Q+P  +P PQPT + N HHL          G              G  QQ QLGHLNW  
Sbjct  621  QYPGLYPQPQPTSMVNSHHLLQQQVPPAIGGSLGLGIASPGPQVGGNRQQTQLGHLNWAA  680

Query  117  NF  112
             F
Sbjct  681  KF  682



>gb|AAL68853.1|AF466199_12 gb protein [Sorghum bicolor]
Length=1009

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 90/134 (67%), Gaps = 10/134 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ QYKPVP+G+ +G+G++T   G+ M  PGVIG+A G+DD   +KYKD N+Y   PQ
Sbjct  662  KYGVSQYKPVPSGNPSGYGNYTHPAGFTMGSPGVIGAAVGVDDVNRMKYKD-NIYASTPQ  720

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+ +AR++  LQ  SY+N+P Q   GA++P +  +ASFN       A AQSSH 
Sbjct  721  VETSDIWIQSAREMPPLQVPSYYNIPGQATAGAFVP-NPANASFN-------ATAQSSHA  772

Query  288  QFPVYHPPPQPTPI  247
            QFP  + P QP  I
Sbjct  773  QFPGLYHPQQPPSI  786



>ref|XP_006849608.1| hypothetical protein AMTR_s00024p00204950 [Amborella trichopoda]
 gb|ERN11189.1| hypothetical protein AMTR_s00024p00204950 [Amborella trichopoda]
Length=714

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 104/177 (59%), Gaps = 19/177 (11%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTG-YAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KY   QYKPVP+   T +G++ +  G Y  + P V    AGL+D + +KYK+ NLY+PNP
Sbjct  551  KYSPSQYKPVPSPIPTAYGNYANQAGGYGASTPVVT---AGLEDMSRIKYKESNLYIPNP  607

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMP-AQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            QA+ SEIW+   R++ ++Q+G ++N+   Q PH AY+PSH+GHA FN         AQS+
Sbjct  608  QADGSEIWIQTPREMGSMQSGPFYNLSGGQAPHAAYVPSHTGHAPFN--------AAQSA  659

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNW  124
            H  F   +  PQP+ +ANPH +           M     P  Q  AYQ PQLGH+NW
Sbjct  660  HPAFAGLYHAPQPSAMANPHLV-----HQQLPSMGGNVGPTAQAPAYQPPQLGHINW  711



>gb|AAT08008.1| unknown [Zea mays]
 gb|AFW85394.1| putative DUF1296 domain containing family protein [Zea mays]
Length=942

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  784  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  842

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHM  289
             ETS+IW+  AR++  +Q  SY+N+P Q   GA++P +  +ASFN       A AQSSH+
Sbjct  843  VETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVP-NPANASFN-------ATAQSSHV  894

Query  288  QFPVYHPPPQPTPI  247
            QFP  + P QP  I
Sbjct  895  QFPGLYHPQQPPSI  908



>ref|NP_001057094.1| Os06g0206100 [Oryza sativa Japonica Group]
 dbj|BAD35846.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAD36202.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAF19008.1| Os06g0206100 [Oryza sativa Japonica Group]
 dbj|BAH00409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=854

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 105/183 (57%), Gaps = 15/183 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGL--DDSTXLKYKDGNLYVPN  472
            KYG+ QYKPVP GS +G+G++T   G+  + PGV      +  DD   +KYKD NLY P+
Sbjct  682  KYGVSQYKPVPAGSPSGYGNYTHPAGFTFSSPGVGVIGGAVGVDDVNRIKYKDNNLYAPS  741

Query  471  PQAETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            PQ ETS+IW+   R++  LQ   YFN+  Q   GA++P + G+ASFN       A AQSS
Sbjct  742  PQVETSDIWIQTPREMPTLQCPPYFNLSGQATSGAFVP-NPGNASFN-------ATAQSS  793

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWT  121
            H QFP  +   QP+ I +PH +      +     G    A P  Q+GAYQQPQLGH  W 
Sbjct  794  HAQFPGLYHAQQPSSIVSPHPMVHQQVQSAIGPNGGVGVATPAPQVGAYQQPQLGH--WR  851

Query  120  GNF  112
              F
Sbjct  852  PGF  854



>gb|EEE65290.1| hypothetical protein OsJ_20522 [Oryza sativa Japonica Group]
Length=861

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 105/183 (57%), Gaps = 15/183 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGL--DDSTXLKYKDGNLYVPN  472
            KYG+ QYKPVP GS +G+G++T   G+  + PGV      +  DD   +KYKD NLY P+
Sbjct  689  KYGVSQYKPVPAGSPSGYGNYTHPAGFTFSSPGVGVIGGAVGVDDVNRIKYKDNNLYAPS  748

Query  471  PQAETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            PQ ETS+IW+   R++  LQ   YFN+  Q   GA++P + G+ASFN       A AQSS
Sbjct  749  PQVETSDIWIQTPREMPTLQCPPYFNLSGQATSGAFVP-NPGNASFN-------ATAQSS  800

Query  294  HMQFPVYHPPPQPTPIANPHHLGTamsgnvg--vgmaaaaapgtqlgAYQQPQLGHLNWT  121
            H QFP  +   QP+ I +PH +      +     G    A P  Q+GAYQQPQLGH  W 
Sbjct  801  HAQFPGLYHAQQPSSIVSPHPMVHQQVQSAIGPNGGVGVATPAPQVGAYQQPQLGH--WR  858

Query  120  GNF  112
              F
Sbjct  859  PGF  861



>gb|EEC80202.1| hypothetical protein OsI_22088 [Oryza sativa Indica Group]
Length=861

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 86/140 (61%), Gaps = 11/140 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGL--DDSTXLKYKDGNLYVPN  472
            KYG+ QYKPVP GS +G+G++T   G+  + PGV      +  DD   +KYKD NLY P+
Sbjct  689  KYGVSQYKPVPAGSPSGYGNYTHPAGFTFSSPGVGVIGGAVGVDDVNRIKYKDNNLYAPS  748

Query  471  PQAETSEIWMNA-RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSS  295
            PQ ETS+IW+   R++  LQ   YFN+  Q   GA++P+  G+ASFN       A AQSS
Sbjct  749  PQVETSDIWIQTPREMPTLQCPPYFNLSGQATSGAFVPN-PGNASFN-------ATAQSS  800

Query  294  HMQFPVYHPPPQPTPIANPH  235
            H QFP  +   QP+ I +PH
Sbjct  801  HAQFPGLYHAQQPSSIVSPH  820



>ref|XP_009792824.1| PREDICTED: uncharacterized protein LOC104239808 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009792825.1| PREDICTED: uncharacterized protein LOC104239808 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009792826.1| PREDICTED: uncharacterized protein LOC104239808 isoform X1 [Nicotiana 
sylvestris]
Length=241

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +G G+FTS TGYA+N  GVIGS  G++DS+ LKYKD NLYVPNPQ
Sbjct  144  KYGIQQFKPVPTGSTSGLGTFTSLTGYAVNTSGVIGSTTGVEDSSRLKYKDNNLYVPNPQ  203

Query  465  AE  460
              
Sbjct  204  VS  205



>ref|XP_009792827.1| PREDICTED: uncharacterized protein LOC104239808 isoform X2 [Nicotiana 
sylvestris]
Length=233

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +G G+FTS TGYA+N  GVIGS  G++DS+ LKYKD NLYVPNPQ
Sbjct  136  KYGIQQFKPVPTGSTSGLGTFTSLTGYAVNTSGVIGSTTGVEDSSRLKYKDNNLYVPNPQ  195

Query  465  AE  460
              
Sbjct  196  VS  197



>ref|XP_009792829.1| PREDICTED: uncharacterized protein LOC104239808 isoform X4 [Nicotiana 
sylvestris]
Length=209

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +G G+FTS TGYA+N  GVIGS  G++DS+ LKYKD NLYVPNPQ
Sbjct  144  KYGIQQFKPVPTGSTSGLGTFTSLTGYAVNTSGVIGSTTGVEDSSRLKYKDNNLYVPNPQ  203



>ref|XP_009792828.1| PREDICTED: uncharacterized protein LOC104239808 isoform X3 [Nicotiana 
sylvestris]
Length=215

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KPVPTGS +G G+FTS TGYA+N  GVIGS  G++DS+ LKYKD NLYVPNPQ
Sbjct  144  KYGIQQFKPVPTGSTSGLGTFTSLTGYAVNTSGVIGSTTGVEDSSRLKYKDNNLYVPNPQ  203



>ref|XP_004141213.1| PREDICTED: uncharacterized protein LOC101203238 [Cucumis sativus]
Length=740

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+QQ+KP+P GS  GFG+F S  G+A+N PGV+GSA GL+DS+ +KYKDGNLYVPN Q
Sbjct  676  KYGIQQFKPLPAGSPAGFGNFNSPAGFAVNAPGVVGSATGLEDSSRIKYKDGNLYVPNAQ  735

Query  465  AETSE  451
            A+  E
Sbjct  736  AKVDE  740



>gb|AFW85390.1| putative DUF1296 domain containing family protein [Zea mays]
Length=373

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 2/87 (2%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  224  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  282

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA  388
             ETS+IW+  AR++  +Q  SY+N+P 
Sbjct  283  VETSDIWIQQAREMPPMQVPSYYNIPV  309



>gb|AFW85392.1| putative DUF1296 domain containing family protein [Zea mays]
Length=830

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 2/87 (2%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQ  466
            KYG+ Q+KP+P+G+ +G+G++T   G+ M  PGVIG+  G+DD   +KYKD N+Y   PQ
Sbjct  681  KYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKD-NIYASTPQ  739

Query  465  AETSEIWM-NARDVXNLQTGSYFNMPA  388
             ETS+IW+  AR++  +Q  SY+N+P 
Sbjct  740  VETSDIWIQQAREMPPMQVPSYYNIPV  766



>ref|XP_010228510.1| PREDICTED: uncharacterized protein LOC100821170 isoform X1 [Brachypodium 
distachyon]
Length=797

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 23/189 (12%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGN-LYVPN  472
            K+G   QYK V  GS  G+GS+ + +GY ++   +IGS   ++D++  KYKD N +Y PN
Sbjct  612  KFGTPHQYKQVFPGSPAGYGSYANQSGYPVSN-CIIGSTGAVEDASMSKYKDNNNMYTPN  670

Query  471  PQAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQ  301
             QAET+++W+ A RD+ ++ T  ++NM  +  +PH AY+P+H+GHA FN           
Sbjct  671  QQAETTDLWIQAHRDIPSMPTTPFYNMMGRPMSPHTAYLPAHNGHAPFN-------PAPH  723

Query  300  SSHMQFPVYHPPPQPTP---IANPHHL-----GTamsgnvgvgmaaaaap--gtqlgAYQ  151
             +H+QFP    P QPT    + NP  +     G        +   A A    G Q+GA+Q
Sbjct  724  PAHLQFPGLPHPLQPTSMTMVQNPQSMVHQPAGNMGIDMAAMAPGAQAGAFPGAQVGAFQ  783

Query  150  QPQLGHLNW  124
            Q QLGHL W
Sbjct  784  QNQLGHLGW  792



>ref|XP_010228511.1| PREDICTED: uncharacterized protein LOC100821170 isoform X2 [Brachypodium 
distachyon]
Length=789

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 108/189 (57%), Gaps = 23/189 (12%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGN-LYVPN  472
            K+G   QYK V  GS  G+GS+ + +GY ++   +IGS   ++D++  KYKD N +Y PN
Sbjct  604  KFGTPHQYKQVFPGSPAGYGSYANQSGYPVSN-CIIGSTGAVEDASMSKYKDNNNMYTPN  662

Query  471  PQAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQ  301
             QAET+++W+ A RD+ ++ T  ++NM  +  +PH AY+P+H+GHA FN           
Sbjct  663  QQAETTDLWIQAHRDIPSMPTTPFYNMMGRPMSPHTAYLPAHNGHAPFN-------PAPH  715

Query  300  SSHMQFPVYHPPPQPTP---IANPHHLGTamsgnvgvgmaaaaapgtqlg-------AYQ  151
             +H+QFP    P QPT    + NP  +    +GN+G+ MAA A              A+Q
Sbjct  716  PAHLQFPGLPHPLQPTSMTMVQNPQSMVHQPAGNMGIDMAAMAPGAQAGAFPGAQVGAFQ  775

Query  150  QPQLGHLNW  124
            Q QLGHL W
Sbjct  776  QNQLGHLGW  784



>ref|XP_004984048.1| PREDICTED: uncharacterized protein LOC101768529 isoform X2 [Setaria 
italica]
Length=777

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 5/108 (5%)
 Frame = -3

Query  645  KYGMQ-QYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   QYKPV  G+  G+G + S   Y ++  GVI S   ++D+   KYKD NLY PNP
Sbjct  598  KYGSSHQYKPVFQGTPAGYGGYASHNSYPVSN-GVISSTGAIEDANMNKYKDNNLYAPNP  656

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFN  334
            QAE +++W+   R++ N+    ++N+  Q  +PH AY+P H+GH SF+
Sbjct  657  QAEAADLWVQGQREILNMPPAQFYNIVGQPVSPHAAYLPPHNGHPSFS  704



>ref|XP_004984047.1| PREDICTED: uncharacterized protein LOC101768529 isoform X1 [Setaria 
italica]
Length=778

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 5/108 (5%)
 Frame = -3

Query  645  KYGMQ-QYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   QYKPV  G+  G+G + S   Y ++  GVI S   ++D+   KYKD NLY PNP
Sbjct  599  KYGSSHQYKPVFQGTPAGYGGYASHNSYPVSN-GVISSTGAIEDANMNKYKDNNLYAPNP  657

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFN  334
            QAE +++W+   R++ N+    ++N+  Q  +PH AY+P H+GH SF+
Sbjct  658  QAEAADLWVQGQREILNMPPAQFYNIVGQPVSPHAAYLPPHNGHPSFS  705



>gb|AAO37496.1| unknown protein, 5'-partial [Oryza sativa Japonica Group]
Length=715

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 97/185 (52%), Gaps = 19/185 (10%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   Q K +  G   G+G FT+  GY +N  GVIG    ++D+   KYKD NLY  NP
Sbjct  533  KYGPPHQCKQMFPGGPAGYGGFTNQNGYPVNT-GVIGGTGSVEDANMSKYKDNNLYTLNP  591

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQS  298
            QAET+++W+ A  D+  + +  ++NM  Q  +PH AY+P H+GHA F+        V   
Sbjct  592  QAETADVWIQAPTDIPVMPSTPFYNMMGQPMSPHTAYLPPHNGHAPFS-------PVQHP  644

Query  297  SHMQFPVYHPPPQPTP---IANP----HHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
            +H+QFP      QPT    + NP    H               AA A G Q+GA+QQ QL
Sbjct  645  AHLQFPAMPHGLQPTTMTMVQNPQPMVHQPACPPLAGNIGIDMAAMASGAQVGAFQQNQL  704

Query  138  GHLNW  124
             HL W
Sbjct  705  SHLGW  709



>ref|NP_001050346.1| Os03g0411000 [Oryza sativa Japonica Group]
 gb|AAR06316.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96562.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12260.1| Os03g0411000 [Oryza sativa Japonica Group]
Length=771

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 97/185 (52%), Gaps = 19/185 (10%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   Q K +  G   G+G FT+  GY +N  GVIG    ++D+   KYKD NLY  NP
Sbjct  589  KYGPPHQCKQMFPGGPAGYGGFTNQNGYPVNT-GVIGGTGSVEDANMSKYKDNNLYTLNP  647

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQS  298
            QAET+++W+ A  D+  + +  ++NM  Q  +PH AY+P H+GHA F+        V   
Sbjct  648  QAETADVWIQAPTDIPVMPSTPFYNMMGQPMSPHTAYLPPHNGHAPFS-------PVQHP  700

Query  297  SHMQFPVYHPPPQPTP---IANP----HHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
            +H+QFP      QPT    + NP    H               AA A G Q+GA+QQ QL
Sbjct  701  AHLQFPAMPHGLQPTTMTMVQNPQPMVHQPACPPLAGNIGIDMAAMASGAQVGAFQQNQL  760

Query  138  GHLNW  124
             HL W
Sbjct  761  SHLGW  765



>gb|EAY90426.1| hypothetical protein OsI_12013 [Oryza sativa Indica Group]
 gb|EAZ27300.1| hypothetical protein OsJ_11240 [Oryza sativa Japonica Group]
Length=755

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 74/126 (59%), Gaps = 12/126 (10%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   Q K +  G   G+G FT+  GY +N  GVIG    ++D+   KYKD NLY  NP
Sbjct  589  KYGPPHQCKQMFPGGPAGYGGFTNQNGYPVNT-GVIGGTGSVEDANMSKYKDNNLYTLNP  647

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQS  298
            QAET+++W+ A  D+  + +  ++NM  Q  +PH AY+P H+GHA F+        V   
Sbjct  648  QAETADVWIQAPTDIPVMPSTPFYNMMGQPMSPHTAYLPPHNGHAPFS-------PVQHP  700

Query  297  SHMQFP  280
            +H+QFP
Sbjct  701  AHLQFP  706



>ref|XP_006651495.1| PREDICTED: uncharacterized protein LOC102714907 [Oryza brachyantha]
Length=762

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 94/181 (52%), Gaps = 16/181 (9%)
 Frame = -3

Query  645  KYGM-QQYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   Q K V  G   G+G F +  GY +N  GVIG    ++D+   KYKD NLY  NP
Sbjct  586  KYGQPHQCKQVFPGGPAGYGGFPNQNGYPVNT-GVIGGTGTVEDANMGKYKDTNLYALNP  644

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQS  298
            QAE  ++W+ A  D+  +    ++NM  Q  +PH AY+P+HSGHA F+        V   
Sbjct  645  QAEAGDVWIQAPSDIPVMPPTPFYNMMGQPVSPHTAYLPAHSGHAPFS-------PVQHP  697

Query  297  SHMQFPVYHPPPQPTP---IANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLN  127
            +H+QFP      QPT    + NP  +             AA A G Q+GA+QQ QL HL 
Sbjct  698  AHLQFPAMPHGIQPTTMTMVQNPQPM-VHQPAGNISIDMAAMASGAQVGAFQQNQLSHLG  756

Query  126  W  124
            W
Sbjct  757  W  757



>gb|EPS69389.1| hypothetical protein M569_05380, partial [Genlisea aurea]
Length=599

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 6/78 (8%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTG----FGSFTSXT-GYAMNXPGVIGSAAGLDDSTXLKYKDGNLY  481
            KYG+QQ+ PVP  +       FG+  + T GYA+N  GV+GSAAG +DS+ LKYK+ NLY
Sbjct  523  KYGVQQFNPVPAAAAANPNGLFGNIPNRTVGYAINSSGVVGSAAGHEDSSRLKYKE-NLY  581

Query  480  VPNPQAETSEIWMNARDV  427
            VPNPQ ETSEIWMN RD+
Sbjct  582  VPNPQPETSEIWMNPRDI  599



>ref|XP_008783012.1| PREDICTED: uncharacterized protein LOC103702379 isoform X3 [Phoenix 
dactylifera]
Length=899

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 86/189 (46%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  733  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  792

Query  489  NLYVPNPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +     
Sbjct  793  NVYMPGQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG----  848

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQPQ 
Sbjct  849  -------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQR  890

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  891  AQVNWTNNY  899



>ref|XP_010942574.1| PREDICTED: uncharacterized protein LOC105060521 isoform X5 [Elaeis 
guineensis]
Length=891

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 88/189 (47%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  725  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  784

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+     
Sbjct  785  NVYMPGQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG----  840

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQPQ 
Sbjct  841  -------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQR  882

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  883  AQINWTNNY  891



>ref|XP_010942570.1| PREDICTED: uncharacterized protein LOC105060521 isoform X2 [Elaeis 
guineensis]
Length=892

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 88/189 (47%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  726  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  785

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+     
Sbjct  786  NVYMPGQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG----  841

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQPQ 
Sbjct  842  -------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQR  883

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  884  AQINWTNNY  892



>ref|XP_008797742.1| PREDICTED: uncharacterized protein LOC103712844 isoform X4 [Phoenix 
dactylifera]
Length=895

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 87/189 (46%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N     G++ G +D T  ++K+ 
Sbjct  729  KYSLSQYKPGTNAGNSALVGMPTGYGTYSSSPAGYTPNPAVGSGNSTGNEDLTGSQFKEN  788

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q E S +W+ A   RD+ +LQ  S+++ P+Q PH  + P+ +GH +F+     
Sbjct  789  NVYMPGQQTEGSAVWIPAAAGRDISSLQASSFYSFPSQGPHMTFAPTQAGHGAFSG----  844

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQPQ 
Sbjct  845  -------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQR  886

Query  138  GHLNWTGNF  112
              +NWT  +
Sbjct  887  AQINWTNTY  895



>ref|XP_008797740.1| PREDICTED: uncharacterized protein LOC103712844 isoform X2 [Phoenix 
dactylifera]
Length=896

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 87/189 (46%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N     G++ G +D T  ++K+ 
Sbjct  730  KYSLSQYKPGTNAGNSALVGMPTGYGTYSSSPAGYTPNPAVGSGNSTGNEDLTGSQFKEN  789

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q E S +W+ A   RD+ +LQ  S+++ P+Q PH  + P+ +GH +F+     
Sbjct  790  NVYMPGQQTEGSAVWIPAAAGRDISSLQASSFYSFPSQGPHMTFAPTQAGHGAFSG----  845

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQPQ 
Sbjct  846  -------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQR  887

Query  138  GHLNWTGNF  112
              +NWT  +
Sbjct  888  AQINWTNTY  896



>tpg|DAA45760.1| TPA: hypothetical protein ZEAMMB73_654486 [Zea mays]
Length=563

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 95/186 (51%), Gaps = 21/186 (11%)
 Frame = -3

Query  645  KYGMQ-QYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   QYK V  G+  G+G + +  GY     GVIG    ++D    KYKD  LY PNP
Sbjct  384  KYGSNHQYKQVFQGAPAGYG-YGNHNGYPN---GVIGGTGAIEDMNMSKYKDNCLYAPNP  439

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQS  298
            Q ET+++W+ + ++  N+ +  ++NM  Q  +PH AY+P  SGH +F+       A +  
Sbjct  440  QVETADVWIQSQKESPNMPSAPFYNMVGQPVSPHAAYLPPQSGHTAFS------PAPSHP  493

Query  297  SHMQFPVYHPPPQPTP---IANP----HHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
             H+Q+P +    QPT    + NP    H               +A  PG Q+GA+Q  QL
Sbjct  494  GHLQYPGFVHALQPTSMTMVQNPQTMIHQPAAPPLAGNLGLDMSAMVPGNQVGAFQHNQL  553

Query  138  GHLNWT  121
             HL WT
Sbjct  554  AHLGWT  559



>ref|XP_008783017.1| PREDICTED: uncharacterized protein LOC103702379 isoform X8 [Phoenix 
dactylifera]
Length=866

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  699  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  758

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  759  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  815

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  816  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  856

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  857  RAQVNWTNNY  866



>ref|XP_008783018.1| PREDICTED: uncharacterized protein LOC103702379 isoform X9 [Phoenix 
dactylifera]
Length=865

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  698  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  757

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  758  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  814

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  815  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  855

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  856  RAQVNWTNNY  865



>ref|XP_008783015.1| PREDICTED: uncharacterized protein LOC103702379 isoform X6 [Phoenix 
dactylifera]
Length=898

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  731  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  790

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  791  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  847

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  848  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  888

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  889  RAQVNWTNNY  898



>ref|XP_008783016.1| PREDICTED: uncharacterized protein LOC103702379 isoform X7 [Phoenix 
dactylifera]
Length=898

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  731  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  790

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  791  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  847

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  848  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  888

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  889  RAQVNWTNNY  898



>ref|XP_008783011.1| PREDICTED: uncharacterized protein LOC103702379 isoform X2 [Phoenix 
dactylifera]
Length=899

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  732  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  791

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  792  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  848

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  849  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  889

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  890  RAQVNWTNNY  899



>ref|XP_008783009.1| PREDICTED: uncharacterized protein LOC103702379 isoform X1 [Phoenix 
dactylifera]
Length=900

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  733  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  792

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  793  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  849

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  850  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  890

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  891  RAQVNWTNNY  900



>ref|XP_008783014.1| PREDICTED: uncharacterized protein LOC103702379 isoform X5 [Phoenix 
dactylifera]
Length=899

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  732  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  791

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  792  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  848

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  849  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  889

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  890  RAQVNWTNNY  899



>ref|XP_008783013.1| PREDICTED: uncharacterized protein LOC103702379 isoform X4 [Phoenix 
dactylifera]
Length=899

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N  G IG++ G +D T  ++K+ 
Sbjct  732  KYSISQYKPGTNTGNSSLVGIPTGYGTYSSSPAGYTPNPAGSIGNSTGNEDLTASQFKEN  791

Query  489  NLYVP-NPQAETSEIWM---NARDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+    ARD+ +LQ  S++ MP Q  H    P+ +GH   +    
Sbjct  792  NVYMPGQQQSEGSAVWIPAAAARDISSLQASSFYTMPPQGQHMTLAPTQAGHGGLSG---  848

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  849  --------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  889

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  890  RAQVNWTNNY  899



>ref|XP_010942572.1| PREDICTED: uncharacterized protein LOC105060521 isoform X4 [Elaeis 
guineensis]
Length=892

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 88/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  725  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  784

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+    
Sbjct  785  NVYMPGQQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG---  841

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  842  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  882

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  883  RAQINWTNNY  892



>ref|XP_010942575.1| PREDICTED: uncharacterized protein LOC105060521 isoform X6 [Elaeis 
guineensis]
Length=891

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 88/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  724  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  783

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+    
Sbjct  784  NVYMPGQQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG---  840

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  841  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  881

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  882  RAQINWTNNY  891



>tpg|DAA45759.1| TPA: hypothetical protein ZEAMMB73_654486 [Zea mays]
Length=722

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 95/186 (51%), Gaps = 21/186 (11%)
 Frame = -3

Query  645  KYGMQ-QYKPVPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNP  469
            KYG   QYK V  G+  G+G + +  GY     GVIG    ++D    KYKD  LY PNP
Sbjct  543  KYGSNHQYKQVFQGAPAGYG-YGNHNGYPN---GVIGGTGAIEDMNMSKYKDNCLYAPNP  598

Query  468  QAETSEIWMNA-RDVXNLQTGSYFNMPAQ--TPHGAYMPSHSGHASFNaaaaaaaavAQS  298
            Q ET+++W+ + ++  N+ +  ++NM  Q  +PH AY+P  SGH +F+       A +  
Sbjct  599  QVETADVWIQSQKESPNMPSAPFYNMVGQPVSPHAAYLPPQSGHTAFS------PAPSHP  652

Query  297  SHMQFPVYHPPPQPTP---IANP----HHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
             H+Q+P +    QPT    + NP    H               +A  PG Q+GA+Q  QL
Sbjct  653  GHLQYPGFVHALQPTSMTMVQNPQTMIHQPAAPPLAGNLGLDMSAMVPGNQVGAFQHNQL  712

Query  138  GHLNWT  121
             HL WT
Sbjct  713  AHLGWT  718



>ref|XP_010942569.1| PREDICTED: uncharacterized protein LOC105060521 isoform X1 [Elaeis 
guineensis]
Length=893

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 88/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  726  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  785

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+    
Sbjct  786  NVYMPGQQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG---  842

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  843  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  883

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  884  RAQINWTNNY  893



>ref|XP_010942571.1| PREDICTED: uncharacterized protein LOC105060521 isoform X3 [Elaeis 
guineensis]
Length=892

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 88/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  725  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  784

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+    
Sbjct  785  NVYMPGQQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG---  841

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  842  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  882

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  883  RAQINWTNNY  892



>ref|XP_010942576.1| PREDICTED: uncharacterized protein LOC105060521 isoform X7 [Elaeis 
guineensis]
Length=891

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 88/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G++ S   GYA N     G++ G +D T  ++K+ 
Sbjct  724  KYSISQYKPGTNTGNSALVGMPTGYGTYNSSPAGYAPNPAVSSGNSTGNEDPTASQFKEN  783

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q+E S +W+ A   RD+ +LQ  S+++ P Q PH  + P+ +GH +F+    
Sbjct  784  NVYMPGQQQSEGSAVWIPAAAGRDISSLQASSFYSFPPQGPHMTFAPTQAGHGAFSG---  840

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  841  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  881

Query  141  LGHLNWTGNF  112
               +NWT N+
Sbjct  882  RAQINWTNNY  891



>ref|XP_008797743.1| PREDICTED: uncharacterized protein LOC103712844 isoform X5 [Phoenix 
dactylifera]
Length=895

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 87/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N     G++ G +D T  ++K+ 
Sbjct  728  KYSLSQYKPGTNAGNSALVGMPTGYGTYSSSPAGYTPNPAVGSGNSTGNEDLTGSQFKEN  787

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q E S +W+ A   RD+ +LQ  S+++ P+Q PH  + P+ +GH +F+    
Sbjct  788  NVYMPGQQQTEGSAVWIPAAAGRDISSLQASSFYSFPSQGPHMTFAPTQAGHGAFSG---  844

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  845  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  885

Query  141  LGHLNWTGNF  112
               +NWT  +
Sbjct  886  RAQINWTNTY  895



>ref|XP_008797741.1| PREDICTED: uncharacterized protein LOC103712844 isoform X3 [Phoenix 
dactylifera]
Length=896

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 87/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N     G++ G +D T  ++K+ 
Sbjct  729  KYSLSQYKPGTNAGNSALVGMPTGYGTYSSSPAGYTPNPAVGSGNSTGNEDLTGSQFKEN  788

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q E S +W+ A   RD+ +LQ  S+++ P+Q PH  + P+ +GH +F+    
Sbjct  789  NVYMPGQQQTEGSAVWIPAAAGRDISSLQASSFYSFPSQGPHMTFAPTQAGHGAFSG---  845

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  846  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  886

Query  141  LGHLNWTGNF  112
               +NWT  +
Sbjct  887  RAQINWTNTY  896



>ref|XP_008797739.1| PREDICTED: uncharacterized protein LOC103712844 isoform X1 [Phoenix 
dactylifera]
Length=897

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 87/190 (46%), Gaps = 34/190 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G+++S   GY  N     G++ G +D T  ++K+ 
Sbjct  730  KYSLSQYKPGTNAGNSALVGMPTGYGTYSSSPAGYTPNPAVGSGNSTGNEDLTGSQFKEN  789

Query  489  NLYVP-NPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaa  322
            N+Y+P   Q E S +W+ A   RD+ +LQ  S+++ P+Q PH  + P+ +GH +F+    
Sbjct  790  NVYMPGQQQTEGSAVWIPAAAGRDISSLQASSFYSFPSQGPHMTFAPTQAGHGAFSG---  846

Query  321  aaaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQ  142
                          +YHP P     A  H L             A    G   G YQQPQ
Sbjct  847  --------------LYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQPQ  887

Query  141  LGHLNWTGNF  112
               +NWT  +
Sbjct  888  RAQINWTNTY  897



>ref|XP_009412058.1| PREDICTED: uncharacterized protein LOC103993639 [Musa acuminata 
subsp. malaccensis]
Length=890

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 86/188 (46%), Gaps = 33/188 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G Q+ +G++ +   GYA       G++   +D    ++K+ 
Sbjct  726  KYTLPQYKPGANTGNSTIVGLQSVYGTYNATPAGYASGPAASSGNSTSNEDLGSSQFKEN  785

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+P  Q+E S +W+ A  RD+  LQ  S++N+P+Q  H  + P+ +GH +F+      
Sbjct  786  NVYIPGQQSEGSAVWIPAPGRDISALQASSFYNIPSQGQHMTFAPTQAGHGAFSG-----  840

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        VY  PP PT  A  H L             A    G   G YQQPQ  
Sbjct  841  ------------VY--PPTPTVSAPVHPL----LQQSQTLAGAVEMLGPSGGVYQQPQRA  882

Query  135  HLNWTGNF  112
             +NWT N+
Sbjct  883  QMNWTNNY  890



>ref|XP_009407930.1| PREDICTED: uncharacterized protein LOC103990491 [Musa acuminata 
subsp. malaccensis]
Length=895

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 84/188 (45%), Gaps = 34/188 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G   G+G + S   GY  +     G++   DD    ++K+ 
Sbjct  732  KYSLPQYKPGANIGNSTIVGMPAGYGMYNSTPAGYTPDA-ATSGNSTANDDLGSSQFKEN  790

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            NL +P  Q+E+  +W+ A  RD+  LQ  SY+++P Q  H  Y P+ +GH +F+      
Sbjct  791  NLCIPGQQSESLSVWIPAPGRDISTLQASSYYSIP-QGQHMTYAPTQAGHGAFSG-----  844

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        VYHPPP   P ++ H L             A    G   G YQQPQ  
Sbjct  845  ------------VYHPPPT-VPASSVHPL----LQQSQTVAGAVEMVGPPAGVYQQPQHA  887

Query  135  HLNWTGNF  112
             +NWT N+
Sbjct  888  QINWTNNY  895



>ref|XP_010929039.1| PREDICTED: uncharacterized protein LOC105050641 isoform X4 [Elaeis 
guineensis]
Length=890

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 85/189 (45%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP   TG+ T      G+G+++S    Y  N     G++ G +D T  ++K+ 
Sbjct  724  KYSISQYKPGTNTGNSTLVGMPIGYGTYSSSPAAYTPNPTVSNGNSTGNEDLTASQFKEN  783

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+ A   RD+ +LQ GS++ +P Q  H A  P+ + H   +     
Sbjct  784  NVYMPGQQSEGSAVWIPAATGRDIASLQAGSFYTLPPQGQHMALAPTQASHGGLSG----  839

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQ Q 
Sbjct  840  -------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQSQR  881

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  882  AQVNWTNNY  890



>ref|XP_010929036.1| PREDICTED: uncharacterized protein LOC105050641 isoform X2 [Elaeis 
guineensis]
Length=899

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 85/189 (45%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP   TG+ T      G+G+++S    Y  N     G++ G +D T  ++K+ 
Sbjct  733  KYSISQYKPGTNTGNSTLVGMPIGYGTYSSSPAAYTPNPTVSNGNSTGNEDLTASQFKEN  792

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+ A   RD+ +LQ GS++ +P Q  H A  P+ + H   +     
Sbjct  793  NVYMPGQQSEGSAVWIPAATGRDIASLQAGSFYTLPPQGQHMALAPTQASHGGLSG----  848

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQ Q 
Sbjct  849  -------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQSQR  890

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  891  AQVNWTNNY  899



>ref|XP_010929038.1| PREDICTED: uncharacterized protein LOC105050641 isoform X3 [Elaeis 
guineensis]
Length=899

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 85/189 (45%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP   TG+ T      G+G+++S    Y  N     G++ G +D T  ++K+ 
Sbjct  733  KYSISQYKPGTNTGNSTLVGMPIGYGTYSSSPAAYTPNPTVSNGNSTGNEDLTASQFKEN  792

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+ A   RD+ +LQ GS++ +P Q  H A  P+ + H   +     
Sbjct  793  NVYMPGQQSEGSAVWIPAATGRDIASLQAGSFYTLPPQGQHMALAPTQASHGGLSG----  848

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQ Q 
Sbjct  849  -------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQSQR  890

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  891  AQVNWTNNY  899



>ref|XP_010929035.1| PREDICTED: uncharacterized protein LOC105050641 isoform X1 [Elaeis 
guineensis]
Length=900

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 85/189 (45%), Gaps = 33/189 (17%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP   TG+ T      G+G+++S    Y  N     G++ G +D T  ++K+ 
Sbjct  734  KYSISQYKPGTNTGNSTLVGMPIGYGTYSSSPAAYTPNPTVSNGNSTGNEDLTASQFKEN  793

Query  489  NLYVPNPQAETSEIWMNA---RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            N+Y+P  Q+E S +W+ A   RD+ +LQ GS++ +P Q  H A  P+ + H   +     
Sbjct  794  NVYMPGQQSEGSAVWIPAATGRDIASLQAGSFYTLPPQGQHMALAPTQASHGGLSG----  849

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +YHP P     A  H L             A    G   G YQQ Q 
Sbjct  850  -------------IYHPTPT-VAAAAVHPL----LQQSQTVAGAVEMVGPPSGVYQQSQR  891

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  892  AQVNWTNNY  900



>ref|XP_010088348.1| hypothetical protein L484_004856 [Morus notabilis]
 gb|EXB34466.1| hypothetical protein L484_004856 [Morus notabilis]
Length=270

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  +G+G + +S  GY  N    +G++   DD    ++K+ 
Sbjct  105  KYSVPQYKPGTNTGNSAHIGMTSGYGPYGSSPGGYIPNSATTVGNSTTNDDLGPSQFKEN  164

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H A+ P+ +GH +F
Sbjct  165  NVYIAGQQSEGSAMWVAAPGRDISSLPTSSFYNLPPQGQHVAFTPAQAGHGTF  217



>ref|XP_009361529.1| PREDICTED: uncharacterized protein LOC103951798 isoform X1 [Pyrus 
x bretschneideri]
Length=861

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 64/116 (55%), Gaps = 17/116 (15%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTG----------FGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKY  499
            KY + QYK   TG+ TG          +G + +S  GY  + P  +G++   +D    ++
Sbjct  697  KYSLPQYK---TGTNTGNSAHMGMASGYGPYGSSPAGYNPSAPTTVGNSTSNEDLASSRF  753

Query  498  KDGNLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            K+ N+Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F
Sbjct  754  KESNVYITGQQSEGSSVWVAAPGRDISSL-TSSFYNLPPQGQHMTFTPTQAGHGTF  808



>ref|XP_009361530.1| PREDICTED: mucin-12 isoform X2 [Pyrus x bretschneideri]
Length=860

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 64/116 (55%), Gaps = 17/116 (15%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTG----------FGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKY  499
            KY + QYK   TG+ TG          +G + +S  GY  + P  +G++   +D    ++
Sbjct  696  KYSLPQYK---TGTNTGNSAHMGMASGYGPYGSSPAGYNPSAPTTVGNSTSNEDLASSRF  752

Query  498  KDGNLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            K+ N+Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F
Sbjct  753  KESNVYITGQQSEGSSVWVAAPGRDISSL-TSSFYNLPPQGQHMTFTPTQAGHGTF  807



>ref|XP_009391914.1| PREDICTED: uncharacterized protein LOC103977959 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=894

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 83/188 (44%), Gaps = 33/188 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYK           G  T +G+++S   GY        G++   +D    ++K+ 
Sbjct  730  KYSIPQYKAGANIGNSAIVGLPTVYGTYSSTPAGYTSGPAASSGNSTANEDLGSSQFKEN  789

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            ++YVP  Q+E S +W+ A  RD+  LQ  S++++P Q  H  +  + +GH +F+      
Sbjct  790  SVYVPGQQSEGSAVWIPAPGRDISALQASSFYSIPPQGQHMTFAAAQAGHGAFSG-----  844

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +Y  PP PT  A+ H L             A    G   G YQQPQ  
Sbjct  845  ------------IY--PPTPTVAASVHPL----LQQSQTVAGAVEMLGPPAGVYQQPQRA  886

Query  135  HLNWTGNF  112
             +NWT N+
Sbjct  887  QINWTNNY  894



>ref|XP_006575395.1| PREDICTED: cell wall protein AWA1-like [Glycine max]
Length=884

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQ-------TGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + Q+KP    +        + +G + +S  GY  N     G++   +D    ++K+ 
Sbjct  719  KYPLPQFKPGANAANPTHLVMPSAYGVYGSSAAGYNHNSAAAAGNSTSNEDLGSSQFKES  778

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +WM A  RD+ +L T +++N+P Q  H  + P+ +GH +F
Sbjct  779  NVYISGQQSEGSAVWMAAPGRDITSLPTSTFYNLPPQGQHVTFAPTQAGHGTF  831



>gb|KHN46209.1| hypothetical protein glysoja_039933 [Glycine soja]
Length=884

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQ-------TGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + Q+KP    +        + +G + +S  GY  N     G++   +D    ++K+ 
Sbjct  719  KYPLPQFKPGANAANPTHLVMPSAYGVYGSSAAGYNHNSAAAAGNSTSNEDLGSSQFKES  778

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +WM A  RD+ +L T +++N+P Q  H  + P+ +GH +F
Sbjct  779  NVYISGQQSEGSAVWMAAPGRDITSLPTSTFYNLPPQGQHVTFAPTQAGHGTF  831



>gb|AES98495.2| MLP3.11 protein [Medicago truncatula]
Length=868

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 72/164 (44%), Gaps = 25/164 (15%)
 Frame = -3

Query  594  FGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQAETSEIWMNA--RDVX  424
            FG + +S  GY  N     G++A  +D    ++K+ N+Y+   Q+E S +W+ A  RD+ 
Sbjct  727  FGIYGSSPAGYNHNSATTAGNSASNEDLGSSQFKENNVYISGQQSEGSAVWVAAPGRDMN  786

Query  423  NLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaaaavAQSSHMQFPVYHPPPQPTPIA  244
            NL T S++N+P Q  H  + P+ +GH  F +                 +YH P Q    A
Sbjct  787  NLPTSSFYNLPPQGQHMTFAPTQAGHGPFTS-----------------IYH-PAQAVTAA  828

Query  243  NPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLGHLNWTGNF  112
              H L             A    G     YQQPQ   +NW  N+
Sbjct  829  TVHPL----LQQSQTMAGAVDMVGQGGNVYQQPQHAQMNWPSNY  868



>gb|KDP29958.1| hypothetical protein JCGZ_18527 [Jatropha curcas]
Length=892

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYKP   TG+ T      G+G + +S  GY  +     G++   +D    ++KD 
Sbjct  727  KYSLPQYKPGTNTGNSTHIGIASGYGPYGSSQAGYNPSSAATGGNSTTNEDLGASQFKDS  786

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+ +L   S++N+P Q  H  + P+ +GH +F
Sbjct  787  NVYITGQQSEGSAVWIAAPGRDMSSLPASSFYNLPPQGQHVTFTPTQAGHGTF  839



>ref|XP_008380020.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=866

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 11/113 (10%)
 Frame = -3

Query  645  KYGMQQYK-------PVPTGSQTGFG-SFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYK           G  +G+G S +S  GY  + P   G++   +D    ++K+ 
Sbjct  702  KYSLPQYKTGTNSGNSAHMGMASGYGPSGSSLAGYNQSAPTTAGNSTSNEDLASSQFKEN  761

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F
Sbjct  762  NVYITGQQSEGSSVWVAAPGRDISSL-TSSFYNLPPQGQHMTFTPTQAGHGTF  813



>ref|XP_008380021.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 11/113 (10%)
 Frame = -3

Query  645  KYGMQQYK-------PVPTGSQTGFG-SFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYK           G  +G+G S +S  GY  + P   G++   +D    ++K+ 
Sbjct  701  KYSLPQYKTGTNSGNSAHMGMASGYGPSGSSLAGYNQSAPTTAGNSTSNEDLASSQFKEN  760

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F
Sbjct  761  NVYITGQQSEGSSVWVAAPGRDISSL-TSSFYNLPPQGQHMTFTPTQAGHGTF  812



>ref|XP_008462126.1| PREDICTED: flocculation protein FLO11 [Cucumis melo]
Length=884

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 85/188 (45%), Gaps = 31/188 (16%)
 Frame = -3

Query  645  KYGMQQYK-------PVPTGSQTGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYK           G  +G+G + +S +GY+ +     G+    +D    ++K+ 
Sbjct  718  KYSIPQYKMGANSGNSSHIGVPSGYGPYGSSASGYSPSTAAPAGNTTANEDIGASQFKEN  777

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            ++Y+  PQ+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F +     
Sbjct  778  SVYITGPQSEGSAVWIGAPGRDMSSLPTNSFYNLPPQGQHVTFTPTQTGHGTFAS-----  832

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YHP    TP    H L   +  +  V        G     YQQPQ  
Sbjct  833  ------------IYHPAQAVTP-GTVHPL---LQQSQAVAGGGVDTVGPGGSIYQQPQHS  876

Query  135  HLNWTGNF  112
             +NW  N+
Sbjct  877  QINWPSNY  884



>ref|XP_008342252.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 17/116 (15%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTG----------FGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKY  499
            KY + QYK   TG+ TG          +G + +S  GY  + P  +G++   +D    ++
Sbjct  701  KYSLPQYK---TGTNTGNSAHMGMASGYGPYGSSPAGYNPSAPTTVGNSTSNEDLASSQF  757

Query  498  KDGNLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            K+ N Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F
Sbjct  758  KENNAYITGQQSEGSSVWVAAPGRDISSL-TSSFYNLPPQGQHMTFTPTQAGHGTF  812



>ref|XP_008342251.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X1 [Malus 
domestica]
Length=866

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 17/116 (15%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQTG----------FGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKY  499
            KY + QYK   TG+ TG          +G + +S  GY  + P  +G++   +D    ++
Sbjct  702  KYSLPQYK---TGTNTGNSAHMGMASGYGPYGSSPAGYNPSAPTTVGNSTSNEDLASSQF  758

Query  498  KDGNLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            K+ N Y+   Q+E S +W+ A  RD+ +L T S++N+P Q  H  + P+ +GH +F
Sbjct  759  KENNAYITGQQSEGSSVWVAAPGRDISSL-TSSFYNLPPQGQHMTFTPTQAGHGTF  813



>ref|XP_010252823.1| PREDICTED: uncharacterized protein LOC104594285 isoform X4 [Nelumbo 
nucifera]
Length=858

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY   QYKP   TG+ T      G+G ++S   GY+ +     G++ G +D    ++K+ 
Sbjct  694  KYSFSQYKPGANTGNSTHIAMPTGYGPYSSSPAGYSPSPAVTTGNSTGNEDLGGSQFKEN  753

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            ++Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F
Sbjct  754  SVYMTGQQSEGSAVWIPAPGRDIPSLQPSSFYNLPPQGQHVTFAPTQGGHGAF  806



>ref|XP_007141366.1| hypothetical protein PHAVU_008G189700g [Phaseolus vulgaris]
 gb|ESW13360.1| hypothetical protein PHAVU_008G189700g [Phaseolus vulgaris]
Length=817

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 32/188 (17%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQ-------TGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + Q+KP    +        + +G + +S  GY  N     G++   +D    ++K+ 
Sbjct  652  KYPLAQFKPSANAANPTHLVMPSAYGVYGSSAAGYNHNSAAAAGNSTSNEDLGSSQFKEN  711

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+   Q E S +W+ A  RD+ ++ T +++N+P Q  H  + P+ +GH +F       
Sbjct  712  NVYLSGQQTEGSAVWLAAAGRDITSMPTSTFYNLPPQGQHVTFAPTQAGHGTFAG-----  766

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YH P Q    A  H L                  G     YQQPQ  
Sbjct  767  ------------IYH-PAQAVTAATVHPL----LQQSQTMAGGVDMVGPGGNVYQQPQHA  809

Query  135  HLNWTGNF  112
             +NW  N+
Sbjct  810  QINWPSNY  817



>ref|XP_010252820.1| PREDICTED: uncharacterized protein LOC104594285 isoform X1 [Nelumbo 
nucifera]
Length=913

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY   QYKP   TG+ T      G+G ++S   GY+ +     G++ G +D    ++K+ 
Sbjct  749  KYSFSQYKPGANTGNSTHIAMPTGYGPYSSSPAGYSPSPAVTTGNSTGNEDLGGSQFKEN  808

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            ++Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F
Sbjct  809  SVYMTGQQSEGSAVWIPAPGRDIPSLQPSSFYNLPPQGQHVTFAPTQGGHGAF  861



>ref|XP_010252821.1| PREDICTED: uncharacterized protein LOC104594285 isoform X2 [Nelumbo 
nucifera]
Length=912

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY   QYKP   TG+ T      G+G ++S   GY+ +     G++ G +D    ++K+ 
Sbjct  748  KYSFSQYKPGANTGNSTHIAMPTGYGPYSSSPAGYSPSPAVTTGNSTGNEDLGGSQFKEN  807

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            ++Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F
Sbjct  808  SVYMTGQQSEGSAVWIPAPGRDIPSLQPSSFYNLPPQGQHVTFAPTQGGHGAF  860



>ref|XP_010252822.1| PREDICTED: uncharacterized protein LOC104594285 isoform X3 [Nelumbo 
nucifera]
Length=910

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY   QYKP   TG+ T      G+G ++S   GY+ +     G++ G +D    ++K+ 
Sbjct  746  KYSFSQYKPGANTGNSTHIAMPTGYGPYSSSPAGYSPSPAVTTGNSTGNEDLGGSQFKEN  805

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            ++Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F
Sbjct  806  SVYMTGQQSEGSAVWIPAPGRDIPSLQPSSFYNLPPQGQHVTFAPTQGGHGAF  858



>ref|XP_003615537.1| hypothetical protein MTR_5g069290 [Medicago truncatula]
Length=924

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -3

Query  594  FGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGNLYVPNPQAETSEIWMNA--RDVX  424
            FG + +S  GY  N     G++A  +D    ++K+ N+Y+   Q+E S +W+ A  RD+ 
Sbjct  727  FGIYGSSPAGYNHNSATTAGNSASNEDLGSSQFKENNVYISGQQSEGSAVWVAAPGRDMN  786

Query  423  NLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            NL T S++N+P Q  H  + P+ +GH  F
Sbjct  787  NLPTSSFYNLPPQGQHMTFAPTQAGHGPF  815



>ref|XP_010237341.1| PREDICTED: uncharacterized protein LOC100835561 [Brachypodium 
distachyon]
Length=821

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP   TGSQT       +G++ +S + Y  N     G++A   D +  ++K+ 
Sbjct  657  KYSAATYKPGANTGSQTYTVTPGAYGTYGSSPSVYTNNNVVPSGTSADNGDVSGSQFKEN  716

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  R++  LQ+ SY+ +P Q  H A+ P+ +GH ++
Sbjct  717  NIYIAGQQSEGSTVWIPAPGRELSTLQSSSYYGLPPQGQHLAFAPAQAGHGAY  769



>ref|XP_006660473.1| PREDICTED: flocculation protein FLO11-like, partial [Oryza brachyantha]
Length=819

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 59/113 (52%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP    G+Q        +G++ +S + Y  N     G++   DD +  +YK+ 
Sbjct  654  KYATNTYKPGANNGTQAHAGNPGAYGTYDSSPSVYTNNAVVASGTSVENDDISGSQYKET  713

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q E S +W++A  RD+  LQ  SY+ +  Q  H A+ P+ +GH +F
Sbjct  714  NVYIAGQQNEGSAVWISAPGRDISGLQPSSYYGLTLQGQHLAFAPAQAGHGTF  766



>gb|KHN40032.1| hypothetical protein glysoja_009409 [Glycine soja]
Length=858

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 80/188 (43%), Gaps = 32/188 (17%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQ-------TGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + Q+KP    +        + +G + +S  GY  N     G++   +D    ++K+ 
Sbjct  693  KYPLPQFKPGANAANPTHLVMPSAYGVYGSSAAGYNHNSAAAAGNSTSNEDLGSSQFKES  752

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+   Q+E S +W+ A  RD+ +L T +++N+P Q  H  + P+ +GH +F       
Sbjct  753  NVYIGGQQSEGSAVWVAAPGRDITSLPTSTFYNLPPQGQHVTFAPTQAGHGNFAG-----  807

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YHP  Q    A  H L             A    G     YQQPQ  
Sbjct  808  ------------MYHPA-QAVTAATVHPL----LQQSQTMAGAVDMVGPGGNVYQQPQHS  850

Query  135  HLNWTGNF  112
             +NW  N+
Sbjct  851  QINWPSNY  858



>ref|XP_003544279.1| PREDICTED: cell wall protein AWA1-like [Glycine max]
Length=878

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 80/188 (43%), Gaps = 32/188 (17%)
 Frame = -3

Query  645  KYGMQQYKPVPTGSQ-------TGFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + Q+KP    +        + +G + +S  GY  N     G++   +D    ++K+ 
Sbjct  713  KYPLPQFKPGANAANPTHLVMPSAYGVYGSSAAGYNHNSAAAAGNSTSNEDLGSSQFKES  772

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+   Q+E S +W+ A  RD+ +L T +++N+P Q  H  + P+ +GH +F       
Sbjct  773  NVYIGGQQSEGSAVWVAAPGRDITSLPTSTFYNLPPQGQHVTFAPTQAGHGNFAG-----  827

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YHP  Q    A  H L             A    G     YQQPQ  
Sbjct  828  ------------MYHPA-QAVTAATVHPL----LQQSQTMAGAVDMVGPGGNVYQQPQHS  870

Query  135  HLNWTGNF  112
             +NW  N+
Sbjct  871  QINWPSNY  878



>ref|XP_009391913.1| PREDICTED: uncharacterized protein LOC103977959 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=895

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 83/189 (44%), Gaps = 34/189 (18%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY + QYK           G  T +G+++S   GY        G++   +D    ++K+ 
Sbjct  730  KYSIPQYKAGANIGNSAIVGLPTVYGTYSSTPAGYTSGPAASSGNSTANEDLGSSQFKEN  789

Query  489  NLYVP-NPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaa  319
            ++YVP   Q+E S +W+ A  RD+  LQ  S++++P Q  H  +  + +GH +F+     
Sbjct  790  SVYVPGQQQSEGSAVWIPAPGRDISALQASSFYSIPPQGQHMTFAAAQAGHGAFSG----  845

Query  318  aaavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQL  139
                         +Y  PP PT  A+ H L             A    G   G YQQPQ 
Sbjct  846  -------------IY--PPTPTVAASVHPL----LQQSQTVAGAVEMLGPPAGVYQQPQR  886

Query  138  GHLNWTGNF  112
              +NWT N+
Sbjct  887  AQINWTNNY  895



>ref|XP_010245043.1| PREDICTED: uncharacterized protein LOC104588700 isoform X4 [Nelumbo 
nucifera]
Length=897

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 81/188 (43%), Gaps = 31/188 (16%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSXTGYAMNXPG-VIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G ++S        P    G++ G +D    ++K+ 
Sbjct  731  KYSLSQYKPGANAGNSAHIGMPTGYGPYSSSPASYSPSPAATTGNSTGNEDLAASQFKEN  790

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F       
Sbjct  791  NVYITGQQSEGSTVWIPAPGRDISSLQPSSFYNLP-QGQHVTFAPTQGGHGAFAGPG---  846

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YH P Q    A  H L             A    G   G +QQPQ  
Sbjct  847  ------------IYH-PAQTVAAATVHPL----LQQSQTMAGAVEMVGPPAGVFQQPQRA  889

Query  135  HLNWTGNF  112
             +NWT N+
Sbjct  890  QINWTNNY  897



>gb|EEE69302.1| hypothetical protein OsJ_28583 [Oryza sativa Japonica Group]
Length=742

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP    G+QT       +G++ +S + Y  N     G++   DD +  ++K+ 
Sbjct  577  KYPTNTYKPGANNGTQTHVGNHGAYGTYDSSPSIYTNNTMVASGTSVESDDISGSQFKET  636

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+  LQ  +Y+ +P Q  H A+ P+ +GH +F
Sbjct  637  NVYIAGQQSEGSGVWIPAPGRDISGLQPSNYYGLPLQGQHLAFAPAQAGHGTF  689



>gb|EEC84205.1| hypothetical protein OsI_30606 [Oryza sativa Indica Group]
Length=744

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP    G+QT       +G++ +S + Y  N     G++   DD +  ++K+ 
Sbjct  579  KYPTNTYKPGANNGTQTHVGNHGAYGTYDSSPSIYTNNTMVASGTSVESDDISGSQFKET  638

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+  LQ  +Y+ +P Q  H A+ P+ +GH +F
Sbjct  639  NVYIAGQQSEGSGVWIPAPGRDISGLQPSNYYGLPLQGQHLAFAPAQAGHGTF  691



>ref|XP_010245040.1| PREDICTED: uncharacterized protein LOC104588700 isoform X1 [Nelumbo 
nucifera]
Length=952

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 81/188 (43%), Gaps = 31/188 (16%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSXTGYAMNXPG-VIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G ++S        P    G++ G +D    ++K+ 
Sbjct  786  KYSLSQYKPGANAGNSAHIGMPTGYGPYSSSPASYSPSPAATTGNSTGNEDLAASQFKEN  845

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F       
Sbjct  846  NVYITGQQSEGSTVWIPAPGRDISSLQPSSFYNLP-QGQHVTFAPTQGGHGAFAGPG---  901

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YH P Q    A  H L             A    G   G +QQPQ  
Sbjct  902  ------------IYH-PAQTVAAATVHPL----LQQSQTMAGAVEMVGPPAGVFQQPQRA  944

Query  135  HLNWTGNF  112
             +NWT N+
Sbjct  945  QINWTNNY  952



>ref|XP_010942882.1| PREDICTED: uncharacterized protein LOC105060749 isoform X3 [Elaeis 
guineensis]
Length=857

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 9/112 (8%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGN  487
            KY + Q+KP       + TG  TGFG  +S        P +    +  ++   ++ K+ N
Sbjct  693  KYSLSQHKPPTNNSNPIHTGMPTGFGIHSSSPASYSPTPAMTSGNSTSNEDGSMQSKENN  752

Query  486  LYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
              + + Q+E   +W+ A  RDV +LQ  S++++P Q  H  + P+ +GH SF
Sbjct  753  ADIDSQQSEVPTVWIPAPGRDVSSLQASSFYSLPPQGQHVTFAPTQAGHGSF  804



>dbj|BAD29556.1| hydroxyproline-rich glycoprotein family protein-like [Oryza sativa 
Japonica Group]
 dbj|BAD38249.1| hydroxyproline-rich glycoprotein family protein-like [Oryza sativa 
Japonica Group]
Length=777

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSF-TSXTGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP    G+QT       +G++ +S + Y  N     G++   DD +  ++K+ 
Sbjct  612  KYPTNTYKPGANNGTQTHVGNHGAYGTYDSSPSIYTNNTMVASGTSVESDDISGSQFKET  671

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+  LQ  +Y+ +P Q  H A+ P+ +GH +F
Sbjct  672  NVYIAGQQSEGSGVWIPAPGRDISGLQPSNYYGLPLQGQHLAFAPAQAGHGTF  724



>gb|EMT26073.1| hypothetical protein F775_05710 [Aegilops tauschii]
Length=1023

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP   TGSQT       +G++ S  + Y  N     G++A   D +  ++K+ 
Sbjct  859  KYSATAYKPGANTGSQTYAVTPGAYGTYGSNPSVYTNNNVVPSGTSAENGDVSGSQFKEN  918

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+  LQ+ S++ +P Q  H A+ P+ +GH ++
Sbjct  919  NIYIAGQQSEGSTVWIPAPGRDLSALQSSSFYGLPPQGQHLAFAPAQAGHGAY  971



>gb|EMS48403.1| hypothetical protein TRIUR3_27107 [Triticum urartu]
Length=766

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 62/113 (55%), Gaps = 10/113 (9%)
 Frame = -3

Query  645  KYGMQQYKP-VPTGSQT------GFGSFTSX-TGYAMNXPGVIGSAAGLDDSTXLKYKDG  490
            KY    YKP   TGSQT       +G++ S  + Y  N     G++A   D +  ++K+ 
Sbjct  602  KYSATAYKPGANTGSQTYAVTPGAYGTYGSNPSVYTNNNVVPSGTSAENGDVSGSQFKEN  661

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
            N+Y+   Q+E S +W+ A  RD+  LQ+ S++ +P Q  H A+ P+ +GH ++
Sbjct  662  NIYIAGQQSEGSTVWIPAPGRDLSALQSSSFYGLPPQGQHLAFAPAQAGHGAY  714



>ref|XP_010245041.1| PREDICTED: uncharacterized protein LOC104588700 isoform X2 [Nelumbo 
nucifera]
Length=922

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 81/188 (43%), Gaps = 31/188 (16%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSXTGYAMNXPG-VIGSAAGLDDSTXLKYKDG  490
            KY + QYKP          G  TG+G ++S        P    G++ G +D    ++K+ 
Sbjct  756  KYSLSQYKPGANAGNSAHIGMPTGYGPYSSSPASYSPSPAATTGNSTGNEDLAASQFKEN  815

Query  489  NLYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASFNaaaaaa  316
            N+Y+   Q+E S +W+ A  RD+ +LQ  S++N+P Q  H  + P+  GH +F       
Sbjct  816  NVYITGQQSEGSTVWIPAPGRDISSLQPSSFYNLP-QGQHVTFAPTQGGHGAFAGPG---  871

Query  315  aavAQSSHMQFPVYHPPPQPTPIANPHHLGTamsgnvgvgmaaaaapgtqlgAYQQPQLG  136
                        +YH P Q    A  H L             A    G   G +QQPQ  
Sbjct  872  ------------IYH-PAQTVAAATVHPL----LQQSQTMAGAVEMVGPPAGVFQQPQRA  914

Query  135  HLNWTGNF  112
             +NWT N+
Sbjct  915  QINWTNNY  922



>ref|XP_010942881.1| PREDICTED: uncharacterized protein LOC105060749 isoform X2 [Elaeis 
guineensis]
Length=890

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 9/112 (8%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGN  487
            KY + Q+KP       + TG  TGFG  +S        P +    +  ++   ++ K+ N
Sbjct  726  KYSLSQHKPPTNNSNPIHTGMPTGFGIHSSSPASYSPTPAMTSGNSTSNEDGSMQSKENN  785

Query  486  LYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
              + + Q+E   +W+ A  RDV +LQ  S++++P Q  H  + P+ +GH SF
Sbjct  786  ADIDSQQSEVPTVWIPAPGRDVSSLQASSFYSLPPQGQHVTFAPTQAGHGSF  837



>ref|XP_010942880.1| PREDICTED: uncharacterized protein LOC105060749 isoform X1 [Elaeis 
guineensis]
Length=891

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 9/112 (8%)
 Frame = -3

Query  645  KYGMQQYKP-------VPTGSQTGFGSFTSXTGYAMNXPGVIGSAAGLDDSTXLKYKDGN  487
            KY + Q+KP       + TG  TGFG  +S        P +    +  ++   ++ K+ N
Sbjct  727  KYSLSQHKPPTNNSNPIHTGMPTGFGIHSSSPASYSPTPAMTSGNSTSNEDGSMQSKENN  786

Query  486  LYVPNPQAETSEIWMNA--RDVXNLQTGSYFNMPAQTPHGAYMPSHSGHASF  337
              + + Q+E   +W+ A  RDV +LQ  S++++P Q  H  + P+ +GH SF
Sbjct  787  ADIDSQQSEVPTVWIPAPGRDVSSLQASSFYSLPPQGQHVTFAPTQAGHGSF  838



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335