BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016E06

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    174   1e-48   Solanum tuberosum [potatoes]
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    171   3e-47   
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    171   3e-47   Nicotiana tomentosiformis
ref|XP_002510674.1|  protein binding protein, putative                  170   7e-47   Ricinus communis
ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    166   1e-45   Solanum tuberosum [potatoes]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    166   2e-45   Oryza brachyantha
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    166   2e-45   Cucumis melo [Oriental melon]
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    165   3e-45   Eucalyptus grandis [rose gum]
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    165   5e-45   Eucalyptus grandis [rose gum]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    164   8e-45   Solanum lycopersicum
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    164   8e-45   Solanum lycopersicum
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  164   8e-45   
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-44   
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-44   Cucumis sativus [cucumbers]
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-44   Malus domestica [apple tree]
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             164   1e-44   Eutrema salsugineum [saltwater cress]
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    163   1e-44   Fragaria vesca subsp. vesca
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    163   1e-44   Nicotiana tomentosiformis
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    163   1e-44   Prunus mume [ume]
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    163   3e-44   Sesamum indicum [beniseed]
gb|KHG01113.1|  hypothetical protein F383_22949                         162   3e-44   Gossypium arboreum [tree cotton]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               162   3e-44   Arabis alpina [alpine rockcress]
gb|KJB57964.1|  hypothetical protein B456_009G187700                    162   3e-44   Gossypium raimondii
ref|NP_001174372.1|  Os05g0345500                                       151   5e-44   
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  161   7e-44   Morus notabilis
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    161   1e-43   
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    161   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             160   2e-43   Capsella rubella
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        160   2e-43   
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        160   2e-43   
emb|CDY29657.1|  BnaA04g17700D                                          160   2e-43   Brassica napus [oilseed rape]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    160   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    160   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    160   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    160   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    159   4e-43   Brassica rapa
dbj|BAD95193.1|  hypothetical protein                                   154   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    159   4e-43   Brassica rapa
emb|CBI40712.3|  unnamed protein product                                159   4e-43   Vitis vinifera
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    159   4e-43   Vitis vinifera
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    159   4e-43   Populus euphratica
ref|NP_180618.2|  BTB/POZ domain-containing protein                     159   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    159   5e-43   Populus euphratica
emb|CDX97805.1|  BnaC04g41340D                                          159   5e-43   
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    159   5e-43   Tarenaya hassleriana [spider flower]
dbj|BAD93995.1|  hypothetical protein                                   159   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  159   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           158   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    158   2e-42   Citrus sinensis [apfelsine]
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           158   2e-42   
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    158   2e-42   Citrus sinensis [apfelsine]
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    157   3e-42   Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    157   3e-42   
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             157   4e-42   
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    156   5e-42   
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    156   5e-42   
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    155   1e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    155   1e-41   Populus euphratica
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    155   1e-41   Populus euphratica
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             155   2e-41   Prunus persica
gb|AES98295.2|  BTB/POZ domain plant protein                            155   2e-41   Medicago truncatula
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                155   2e-41   Erythranthe guttata [common monkey flower]
gb|EEE63337.1|  hypothetical protein OsJ_18148                          154   3e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65824.1|  hypothetical protein M569_08953                         154   3e-41   Genlisea aurea
ref|XP_003615337.1|  Kelch-like protein                                 155   3e-41   
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    154   4e-41   Brachypodium distachyon [annual false brome]
gb|EEC79014.1|  hypothetical protein OsI_19541                          154   5e-41   Oryza sativa Indica Group [Indian rice]
gb|AAV43802.1|  unknown protein                                         154   5e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CDM85346.1|  unnamed protein product                                154   6e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    153   6e-41   
emb|CDP07293.1|  unnamed protein product                                153   8e-41   Coffea canephora [robusta coffee]
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    152   2e-40   
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             150   1e-39   Phaseolus vulgaris [French bean]
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          150   1e-39   Sorghum bicolor [broomcorn]
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    149   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    147   1e-38   Cicer arietinum [garbanzo]
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    147   1e-38   Cicer arietinum [garbanzo]
gb|AAB63076.1|  unknown protein                                         131   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          140   4e-36   
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    139   7e-36   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    137   7e-35   Nicotiana sylvestris
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              135   2e-34   
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             135   3e-34   
ref|XP_001751401.1|  predicted protein                                  133   1e-33   
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              111   5e-26   Chlorella variabilis
gb|KIY99757.1|  hypothetical protein MNEG_8204                          103   5e-23   Monoraphidium neglectum
ref|XP_005650913.1|  hypothetical protein COCSUDRAFT_46062            93.6    4e-20   Coccomyxa subellipsoidea C-169
ref|XP_001697437.1|  predicted protein                                87.4    1e-19   Chlamydomonas reinhardtii
ref|XP_002950189.1|  hypothetical protein VOLCADRAFT_48365            84.3    2e-18   Volvox carteri f. nagariensis
ref|XP_011399599.1|  BTB/POZ domain-containing protein                86.3    2e-17   Auxenochlorella protothecoides
ref|XP_005708947.1|  ubiquitin-protein ligase                         64.7    1e-09   Galdieria sulphuraria
gb|KDD72973.1|  hypothetical protein H632_c2675p1                     57.4    2e-08   Helicosporidium sp. ATCC 50920
ref|XP_004339299.1|  BTB/POZ domain containing protein                57.8    3e-07   Acanthamoeba castellanii str. Neff
ref|XP_011189870.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  57.8    3e-07   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189869.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  57.8    3e-07   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  57.8    3e-07   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189868.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  57.8    4e-07   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011199880.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  56.6    1e-06   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199881.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  56.2    1e-06   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199879.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  56.2    1e-06   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199876.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  56.2    1e-06   
ref|XP_004521546.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  55.5    2e-06   Ceratitis capitata [medfly]
ref|XP_004521542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  55.5    2e-06   Ceratitis capitata [medfly]
ref|XP_004521545.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  55.5    2e-06   Ceratitis capitata [medfly]
ref|XP_011414031.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  55.5    2e-06   Crassostrea gigas
ref|XP_011414030.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  55.5    2e-06   Crassostrea gigas
ref|XP_004521547.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  55.5    3e-06   
gb|EKC30956.1|  E3 ubiquitin-protein ligase HECTD1                    55.5    3e-06   Crassostrea gigas
ref|XP_005708289.1|  ubiquitin-protein ligase isoform 2               54.7    3e-06   Galdieria sulphuraria
ref|XP_005708288.1|  ubiquitin-protein ligase isoform 1               54.7    3e-06   Galdieria sulphuraria
ref|XP_004333299.1|  BTB/POZ domain containing protein                53.9    5e-06   Acanthamoeba castellanii str. Neff
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    6e-06   
ref|XP_005178040.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  53.9    8e-06   
ref|XP_011290265.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  53.5    9e-06   Musca domestica
ref|XP_011290264.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  52.8    2e-05   Musca domestica
ref|XP_011290263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  52.8    2e-05   Musca domestica
ref|XP_005178039.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  52.8    2e-05   Musca domestica
ref|XP_001969437.1|  GG23957                                          52.8    2e-05   
ref|XP_002089068.1|  GE26196                                          52.8    2e-05   Drosophila yakuba
ref|XP_002424807.1|  hect E3 ubiquitin ligase, putative               52.0    3e-05   Pediculus humanus corporis [human body lice]
ref|XP_002036468.1|  GM11846                                          51.6    4e-05   Drosophila sechellia
ref|XP_002078905.1|  GD22285                                          51.6    4e-05   
ref|XP_001963078.1|  GF14121                                          51.6    4e-05   Drosophila ananassae
ref|XP_002004091.1|  GI19489                                          51.2    5e-05   
ref|XP_009860152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    50.8    8e-05   
ref|XP_011314687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.8    8e-05   Fopius arisanus
ref|XP_011314680.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Fopius arisanus
ref|XP_011314684.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Fopius arisanus
ref|XP_011314679.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Fopius arisanus
ref|XP_011406508.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   
ref|XP_011267641.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Camponotus floridanus
gb|EFN60527.1|  E3 ubiquitin-protein ligase HECTD1                    50.4    9e-05   Camponotus floridanus
ref|XP_011314681.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Fopius arisanus
ref|XP_011267639.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Camponotus floridanus
ref|XP_011267637.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    9e-05   Camponotus floridanus
ref|XP_011314688.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    1e-04   Fopius arisanus
ref|XP_011267642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    1e-04   Camponotus floridanus
ref|XP_011314685.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    1e-04   Fopius arisanus
ref|XP_011267640.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    1e-04   
ref|XP_011314686.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    1e-04   Fopius arisanus
ref|XP_011314682.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  50.4    1e-04   Fopius arisanus
ref|WP_029637034.1|  hypothetical protein [                           48.1    2e-04   [Scytonema hofmanni] UTEX B 1581
gb|AAQ23602.1|  LP05936p                                              49.7    2e-04   Drosophila melanogaster
ref|NP_609369.1|  CG5604                                              49.7    2e-04   Drosophila melanogaster
ref|XP_003739715.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  49.7    2e-04   
ref|XP_002052386.1|  GJ21961                                          49.3    2e-04   Drosophila virilis
ref|XP_008547990.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  48.9    3e-04   
ref|XP_008547994.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  48.9    3e-04   
ref|XP_008547992.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  48.9    3e-04   
ref|XP_008547995.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  48.9    3e-04   
ref|XP_008547989.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  48.9    3e-04   
ref|XP_008547993.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  48.9    3e-04   
ref|XP_003699429.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    48.9    4e-04   Megachile rotundata
ref|XP_003394975.1|  PREDICTED: LOW QUALITY PROTEIN: e3 ubiquitin...  48.5    5e-04   
ref|XP_002014386.1|  GL19165                                          48.5    5e-04   Drosophila persimilis
gb|KFB39857.1|  AGAP009511-PA-like protein                            48.1    5e-04   Anopheles sinensis
ref|XP_001992956.1|  GH13561                                          48.1    6e-04   Drosophila grimshawi
ref|XP_310184.4|  AGAP009511-PA                                       47.4    0.001   Anopheles gambiae str. PEST
gb|KDR14371.1|  E3 ubiquitin-protein ligase HECTD1                    47.4    0.001   Zootermopsis nevadensis
ref|XP_004989701.1|  hypothetical protein PTSG_12883                  47.4    0.001   Salpingoeca rosetta
ref|XP_006624251.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  47.4    0.001   Apis dorsata [rock honeybee]
ref|XP_008211005.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  47.4    0.001   
ref|XP_008211004.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  47.4    0.001   
ref|XP_006624246.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  47.4    0.001   Apis dorsata [rock honeybee]



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   174 bits (442),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 77/101 (76%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  694  KVLVSRNFQGTSVAGPQMEGGRNASWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQG  753

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++DQT CKPGQFASW ITG N LLPFRF
Sbjct  754  SLDGKNWTNLRVHENDQTICKPGQFASWPITGSNALLPFRF  794



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   171 bits (433),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAFMR WN QG
Sbjct  694  KVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQG  753

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQ+ CKP QFASW IT PN LLPFRF
Sbjct  754  SLDGKSWTNLRVHENDQSICKPCQFASWPITDPNALLPFRF  794



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   171 bits (433),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAFMR WN QG
Sbjct  696  KVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQG  755

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQ+ CKP QFASW IT PN LLPFRF
Sbjct  756  SLDGKSWTNLRVHENDQSICKPCQFASWPITDPNALLPFRF  796



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP+ EDGN  + W +D+G DHQLMCNYYT+RQDGSRA++R WN QG
Sbjct  676  KALVSRTYQGTSFAGPRMEDGNKCAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRFWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVHKDDQT CKPGQFASW ITGPN LLPFRF
Sbjct  736  SLDGKSWTNLRVHKDDQTVCKPGQFASWPITGPNSLLPFRF  776



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  674  KVLVSRNFQGTSVAGPQMEGGRNASWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQG  733

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++DQT CKPGQFASW ITG N LLPFRF
Sbjct  734  SLDGKNWTNLRVHENDQTICKPGQFASWPITGSNALLPFRF  774



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+QGT FAGP+ EDG + S W +D+G+DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  675  KALVSKNYQGTCFAGPRLEDGKMCSWWMVDIGHDHQLMCNYYTVRQDGSTTFMRSWVLQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWT+LR+HKDDQT C+PGQFASW ITGP+ LLPFRF
Sbjct  735  SMDGQNWTSLRIHKDDQTICQPGQFASWPITGPSALLPFRF  775



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGTSFAG + EDG   S W +D+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  676  KVLVSRTYQGTSFAGLRVEDGKTCSWWMVDIGEDHQLMCNYYTLRQDGSRAFIRYWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW +TGPN LLPFRF
Sbjct  736  SLDGKTWTNLRVHENDQTVCKPGQFASWPVTGPNALLPFRF  776



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR FQGTSFAGP+ EDG+  S W +D+G DHQLMCNYYT+RQDGSRA+MRSW  QG
Sbjct  672  KVLVSRTFQGTSFAGPRIEDGHNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WT+LR H +DQT CKPGQFASW ITGPN LLPFR+
Sbjct  732  SVDGSSWTDLRAHDNDQTICKPGQFASWPITGPNALLPFRY  772



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR FQGTSFAGP+ EDG+  S W +D+G DHQLMCNYYT+RQDGSRA+MRSW  QG
Sbjct  723  KVLVSRTFQGTSFAGPRIEDGHNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQG  782

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WT+LR H +DQT CKPGQFASW ITGPN LLPFR+
Sbjct  783  SVDGSSWTDLRAHDNDQTICKPGQFASWPITGPNALLPFRY  823



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  674  KVLVSRNFQGTSVAGPQMEGGRNTSWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQG  733

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQT CKPGQFASW +TG N LLPFRF
Sbjct  734  SLDGKSWTNLRVHENDQTICKPGQFASWPVTGSNALLPFRF  774



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  694  KVLVSRNFQGTSVAGPQMEGGRNTSWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQG  753

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQT CKPGQFASW +TG N LLPFRF
Sbjct  754  SLDGKSWTNLRVHENDQTICKPGQFASWPVTGSNALLPFRF  794



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   164 bits (415),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  679  KALASKTYVGTSFAGPRMEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  738

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  739  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  779



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   164 bits (414),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR ++GTSFAGPQ EDG+ S+ W +D+G DHQL+CN YT+RQDGSRA+MR WN QG
Sbjct  673  KALVSRTYRGTSFAGPQIEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQG  732

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW + G N LLPFRF
Sbjct  733  SLDGKTWTNLRVHENDQTICKPGQFASWPVIGQNALLPFRF  773



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGTSF G + EDG   S W +D+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  676  KVLVSRTYQGTSFTGLRVEDGKTCSWWMVDIGEDHQLMCNYYTLRQDGSRAFIRYWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW +TGPN LLPFRF
Sbjct  736  SFDGKTWTNLRVHENDQTVCKPGQFASWAVTGPNALLPFRF  776



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   164 bits (414),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR ++GTSFAGPQ EDG+ S+ W +D+G DHQL+CN YT+RQDGSRA+MR WN QG
Sbjct  675  KALVSRTYRGTSFAGPQIEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW + G N LLPFRF
Sbjct  735  SLDGKTWTNLRVHENDQTICKPGQFASWPVIGQNALLPFRF  775



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   164 bits (414),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 72/101 (71%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  676  KALASKTYVGTSFAGPRKEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  736  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  776



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGTSFAGP  EDG  ++ W +D+G DHQL+CNYYT+R DGSRA+MR WN QG
Sbjct  673  KVLVSRTYQGTSFAGPHIEDGRNNTWWMVDIGADHQLICNYYTLRHDGSRAYMRYWNFQG  732

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW +TGPN LLPFRF
Sbjct  733  SLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNALLPFRF  773



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ E G  +S W +D+G DHQLMCNYYT+RQDGSRAFMR WN QG
Sbjct  674  KVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQG  733

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQ+ CKP QFASW IT PN LLPFRF
Sbjct  734  SLDGKSWTNLRVHENDQSICKPCQFASWPITDPNALLPFRF  774



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   163 bits (413),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGPQ  DG+  + W +D+  DHQL+CNYYT+RQDGSRA+MR W  QG
Sbjct  675  KALVSRTYQGTSFAGPQIIDGHNCTWWMVDISADHQLICNYYTLRQDGSRAYMRYWKFQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW +TGPN LLP+RF
Sbjct  735  SLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNALLPYRF  775



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR++QGTSFAGP+ EDG  +S W +D+G+ HQLMCNYYT+RQDGSRAF+R+W+ QG
Sbjct  674  KVLVSRSYQGTSFAGPRKEDGRTTSWWMVDIGHGHQLMCNYYTLRQDGSRAFIRNWSFQG  733

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++D T CKPGQ+ASW + GPN LLPFRF
Sbjct  734  SMDGNNWTNLRVHENDVTMCKPGQYASWPVVGPNALLPFRF  774



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+GNI + W +D+G DHQLMCNYYT+RQDGSRA++R+W  QG
Sbjct  672  KVLVSRTYQGTCFAGPRMENGNICAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  W +LRVH++DQT CKPGQFASW +TGPN LLPFRF
Sbjct  732  CMDGKTWIDLRVHENDQTMCKPGQFASWPVTGPNALLPFRF  772



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   162 bits (411),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  677  KALASKTYVGTSFAGPRMEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  736

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH++DQT CK GQFASW IT  N LLPFRF
Sbjct  737  SMDGKTWTDLRVHENDQTMCKAGQFASWPITAANALLPFRF  777



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+GNI + W +D+G DHQLMCNYYT+RQDGSRA++R+W  QG
Sbjct  672  KVLVSRTYQGTCFAGPRMENGNICAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  W +LRVH++DQT CKPGQFASW +TGPN LLPFRF
Sbjct  732  CMDGKTWIDLRVHENDQTMCKPGQFASWPVTGPNALLPFRF  772



>ref|NP_001174372.1| Os05g0345500 [Oryza sativa Japonica Group]
 dbj|BAH93100.1| Os05g0345500 [Oryza sativa Japonica Group]
Length=152

 Score =   151 bits (381),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+Q T FAGP+ EDG + S W +D+G DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  22   KALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQG  81

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WT+L VH+DDQT C+PGQFASW ITG   LLPFRF
Sbjct  82   SMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRF  122



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   161 bits (408),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SR +QGTSFAGP+ EDG+ S+ W +D+G +HQLMCNYYT+RQDGSRA++RSW+ QG
Sbjct  680  KVLASRTYQGTSFAGPRIEDGHSSTWWMVDIGSNHQLMCNYYTLRQDGSRAYIRSWSLQG  739

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNL VH++DQT CK GQFASW I GPN L PFRF
Sbjct  740  SLDGKTWTNLSVHENDQTVCKLGQFASWPIVGPNALRPFRF  780



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   161 bits (408),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ E G+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  694  KALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  753

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  754  SMDGRTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  794



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   161 bits (407),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ E G+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  679  KALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  738

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  739  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  779



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   160 bits (406),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ E G+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  679  KALASKTYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  738

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LR+H+DDQT CK GQFASW IT  N LLPFRF
Sbjct  739  SMDGKTWTDLRIHEDDQTMCKVGQFASWPITAANALLPFRF  779



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   160 bits (405),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E G I + W ID+G DHQL+CNYYT+RQDGSRA++R W  QG
Sbjct  675  KVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W +LRVH++DQT CKPGQFASW +TG N LLPFRF
Sbjct  735  SVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTNALLPFRF  775



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   160 bits (405),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E G I + W ID+G DHQL+CNYYT+RQDGSRA++R W  QG
Sbjct  659  KVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQG  718

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W +LRVH++DQT CKPGQFASW +TG N LLPFRF
Sbjct  719  SVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTNALLPFRF  759



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   160 bits (406),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG ISS W +DLG DHQLMCNYYT RQDGSRA+ RSW  QG
Sbjct  714  KALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQG  773

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH++DQT CK GQFASW IT  N LLPFRF
Sbjct  774  SMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPFRF  814



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   160 bits (405),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ E G+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  693  KALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  752

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  753  SMDGKIWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  793



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   160 bits (405),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ E G+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  679  KALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  738

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  739  SMDGKIWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  779



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   160 bits (404),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +Q TSFAGP+ EDG+ S+ W +D+G+DHQLMCNYYT+RQDGS  ++RSW  QG
Sbjct  673  KALVSRTYQATSFAGPRIEDGHSSAWWMVDIGHDHQLMCNYYTLRQDGSSTYIRSWAFQG  732

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFR  4
              DG NWTNLRVH DDQT C+ GQFASW + GP  LLPFR
Sbjct  733  SVDGKNWTNLRVHNDDQTICRSGQFASWPVIGPMALLPFR  772



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   160 bits (404),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/101 (70%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ E G+ISS W +DLG DHQLMCNYYT RQDGSRAF RSW  QG
Sbjct  688  KALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQG  747

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  748  SMDGKIWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  788



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   159 bits (403),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG ISS W +DLG DHQLMCNYYT RQDGSRA+ RSW  QG
Sbjct  671  KALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQG  730

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH++DQT CK GQFASW IT  N LLPFRF
Sbjct  731  SMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPFRF  771



>dbj|BAD95193.1| hypothetical protein [Arabidopsis thaliana]
Length=331

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG +HQLMCNYYT RQDGSRAF R W  QG
Sbjct  201  KALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQG  260

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  261  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  301



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   159 bits (403),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG ISS W +DLG DHQLMCNYYT RQDGSRA+ RSW  QG
Sbjct  676  KALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH++DQT CK GQFASW IT  N LLPFRF
Sbjct  736  SMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPFRF  776



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGTSF GP+ EDG   S W +D+G DHQLMCNYYT+RQDGSRA++R WN QG
Sbjct  659  KVLVSRTYQGTSFTGPRVEDGKNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQG  718

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQ+ASW I  PN LLPFRF
Sbjct  719  SLDGKAWTNLRVHENDQTMCKPGQYASWPIMAPNALLPFRF  759



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGTSF GP+ EDG   S W +D+G DHQLMCNYYT+RQDGSRA++R WN QG
Sbjct  676  KVLVSRTYQGTSFTGPRVEDGKNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQ+ASW I  PN LLPFRF
Sbjct  736  SLDGKAWTNLRVHENDQTMCKPGQYASWPIMAPNALLPFRF  776



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGT FAGP+ E G I + W ID+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  678  KALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQG  737

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CK GQFASW ITGP  LLPFRF
Sbjct  738  SLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQALLPFRF  778



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   159 bits (403),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG +HQLMCNYYT RQDGSRAF R W  QG
Sbjct  679  KALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQG  738

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  739  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  779



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGT FAGP+ E G I + W ID+G DHQLMCNYYT+RQDGSRAF+R WN QG
Sbjct  671  KALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQG  730

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CK GQFASW ITGP  LLPFRF
Sbjct  731  SLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQALLPFRF  771



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   159 bits (402),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG ISS W +DLG DHQLMCNYYT RQDGSRA+ RSW  QG
Sbjct  666  KALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQG  725

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH++DQT CK GQFASW IT  N LLPFRF
Sbjct  726  SMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPFRF  766



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   159 bits (402),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 68/101 (67%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L SR + GTSFAGP+ EDG ISS W +DLG DHQLMCNYYT+RQDGSR + RSW  QG
Sbjct  674  KTLASRTYMGTSFAGPRMEDGQISSWWMVDLGKDHQLMCNYYTLRQDGSRTYPRSWKLQG  733

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W ++RVH+DDQT CK GQFASW I G N LLPFR+
Sbjct  734  SMDGNSWADVRVHEDDQTMCKLGQFASWPIVGANSLLPFRY  774



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   159 bits (402),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG +HQLMCNYYT RQDGSRAF R W  QG
Sbjct  682  KALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQG  741

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  742  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  782



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   159 bits (403),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L S+ + GTSFAGP+ EDG+ISS W +DLG +HQLMCNYYT RQDGSRAF R W  QG
Sbjct  725  KALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQG  784

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LRVH+DDQT CK GQFASW IT  N LLPFRF
Sbjct  785  SMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPFRF  825



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGT FAGP+ E G I + W ID+G DHQLMCN+YT+RQDGSRAF+R WN QG
Sbjct  671  KALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQDHQLMCNHYTLRQDGSRAFIRCWNLQG  730

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CK GQFASW ITGP  LLPFRF
Sbjct  731  SLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQALLPFRF  771



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   158 bits (399),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L SR +QG SFAGP+ EDG+  + W +D+G DHQLMCNYYT+R DGSRA++R WN QG
Sbjct  676  KALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQT CK GQFASW + GPN L PFRF
Sbjct  736  SMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPNALRPFRF  776



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP  EDG+I + W +D+G DHQLMCN+YT+RQDGSRAF+R WN QG
Sbjct  676  KTLVSRTYQGTSFAGPCMEDGHIRAWWMVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CK  QFASW ITGP+ LLPFRF
Sbjct  736  SLDGKTWTNLRVHENDQTMCKADQFASWPITGPHALLPFRF  776



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   158 bits (399),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L SR +QG SFAGP+ EDG+  + W +D+G DHQLMCNYYT+R DGSRA++R WN QG
Sbjct  687  KALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQG  746

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQT CK GQFASW + GPN L PFRF
Sbjct  747  SMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPNALRPFRF  787



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+G   S W +DLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  672  KVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNVQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++D++ CKPGQFASW I GPN LLPFR+
Sbjct  732  SLDGKSWTNLRVHENDRSICKPGQFASWPIIGPNALLPFRY  772



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+G   S W +DLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  676  KVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNVQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++D++ CKPGQFASW I GPN LLPFR+
Sbjct  736  SLDGKSWTNLRVHENDRSICKPGQFASWPIIGPNALLPFRY  776



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   157 bits (396),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L SR +QG SFAGP+ EDG+  + W +D+G DHQLMCNYYT+R DGSRA++R WN QG
Sbjct  688  KALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQG  747

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLRVH++DQT CK GQFASW + GPN L PFRF
Sbjct  748  SMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPNALRPFRF  788



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP+ EDG   + W +D+G DHQLMCNYYT+RQDGS  +MRSW  QG
Sbjct  675  KALVSRAYQGTSFAGPRIEDGKNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++DQT C+PGQFASW +TG   LLPFRF
Sbjct  735  SMDGENWTNLRVHENDQTICRPGQFASWTVTGSTALLPFRF  775



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP+ EDG   + W +D+G DHQLMCNYYT+RQDGS  +MRSW  QG
Sbjct  673  KALVSRAYQGTSFAGPRIEDGKNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQG  732

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++DQT C+PGQFASW +TG   LLPFRF
Sbjct  733  SMDGENWTNLRVHENDQTICRPGQFASWTVTGSTALLPFRF  773



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SR +QGTSF+GP+ EDG   S W ID+G DHQLMCNYYT+RQDGSR F+R WN QG
Sbjct  675  KVLASRTYQGTSFSGPRFEDGRTCSWWMIDVGEDHQLMCNYYTLRQDGSRTFIRHWNLQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLR HK+DQ  CKPGQFASW +TGP  LL FRF
Sbjct  735  SLDGKHWTNLREHKNDQKICKPGQFASWPVTGPQALLSFRF  775



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP  E+G+I + W +D+G DHQLMCN+YT+RQDGSRAF+R WN QG
Sbjct  676  KTLVSRTYQGTSFAGPCMENGHIRAWWTVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CK  QFASW +TGP+ LLPFRF
Sbjct  736  SLDGKTWTNLRVHENDQTMCKADQFASWPVTGPHALLPFRF  776



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP  E+G+I + W +D+G DHQLMCN+YT+RQDGSRAF+R WN QG
Sbjct  676  KTLVSRTYQGTSFAGPCMENGHIRAWWTVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CK  QFASW +TGP+ LLPFRF
Sbjct  736  SLDGKTWTNLRVHENDQTMCKADQFASWPVTGPHALLPFRF  776



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGPQ  DG+  + W +D+  DHQL+CNYYT+RQDGSR +MR W  QG
Sbjct  675  KALVSRTYQGTSFAGPQIIDGHNCTWWMVDISADHQLICNYYTLRQDGSRTYMRYWKFQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW +TGPN LLP+RF
Sbjct  735  SLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNALLPYRF  775



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+G+  S W IDLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  669  KVLVSRTYQGTCFAGPRLENGHNCSWWMIDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQG  728

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W +LRVH++D+T CKPGQFASW + GPN LLPFR+
Sbjct  729  SADGKSWRDLRVHENDRTVCKPGQFASWPVVGPNALLPFRY  769



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR++ GTSFAGP+ E+G  ++ W +D+G+ HQLMCN+YT+RQDGSRAFMR+WN QG
Sbjct  672  KVLVSRSYLGTSFAGPRMENGRNTAWWMVDIGHSHQLMCNHYTLRQDGSRAFMRNWNFQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++D+T  KPGQFASW + GP  LLPFRF
Sbjct  732  SMDGNNWTNLRVHENDETMSKPGQFASWPVVGPTALLPFRF  772



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+Q T FAGP+ EDG + S W +D+G DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  604  KALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQG  663

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WT+L VH+DDQT C+PGQFASW ITG   LLPFRF
Sbjct  664  SMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRF  704



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR++QGTSFAGP+ E+G  ++ W +D+G DHQL+CNYYTIRQDGSRAF+R W+ QG
Sbjct  673  KVLVSRSYQGTSFAGPRMENGKNTAWWMVDIGDDHQLICNYYTIRQDGSRAFLRHWSLQG  732

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
             TDG NW +LRVH++D T CK GQ+ASW + G N LLPFRF
Sbjct  733  STDGANWASLRVHENDATMCKSGQYASWPVVGSNALLPFRF  773



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+G+  S W IDLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  754  KVLVSRTYQGTCFAGPRLENGHNCSWWMIDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQG  813

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W +LRVH++D+T CKPGQFASW + GPN LLPFR+
Sbjct  814  SADGKSWRDLRVHENDRTVCKPGQFASWPVVGPNALLPFRY  854



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+QGT FAGP+ E+G   S W +D+G DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  682  KALVSKNYQGTCFAGPRDENGKKCSWWMVDIGEDHQLMCNYYTVRQDGSTTFMRSWVFQG  741

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWT+L VH+++QT C+PGQFASW ITGP+ LLPFRF
Sbjct  742  SMDGENWTSLGVHEEEQTICQPGQFASWPITGPSALLPFRF  782



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+Q T FAGP+ EDG + S W +D+G DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  676  KALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WT+L VH+DDQT C+PGQFASW ITG   LLPFRF
Sbjct  736  SMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRF  776



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+Q T FAGP+ EDG + S W +D+G DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  676  KALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WT+L VH+DDQT C+PGQFASW ITG   LLPFRF
Sbjct  736  SMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRF  776



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+QGT FAGP+ EDG   S W +D+G DHQLMCNYYT+RQDGS AFMRSW  QG
Sbjct  677  KALVSKNYQGTCFAGPRDEDGKKCSWWMVDIGQDHQLMCNYYTVRQDGSTAFMRSWVLQG  736

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWT+L V++D++  C+PGQFASW ITGP+ LLPFRF
Sbjct  737  SMDGENWTSLVVNEDERAICQPGQFASWPITGPSALLPFRF  777



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +QGTSFAGP+ EDG   + W +D+G DHQLMCNYYT+RQDGS  +MRSW  QG
Sbjct  675  KTLVSRAYQGTSFAGPRIEDGMNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWAFQG  734

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWTNLRVH++DQT C+PGQFASW I G   LLPFRF
Sbjct  735  SMDGENWTNLRVHENDQTICRPGQFASWPIIGSTSLLPFRF  775



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SR +QGTSFAG +  DG  +S W +D+G  HQLMCNYYT+RQDGS+AFMR WN QG
Sbjct  672  KVLASRTYQGTSFAGSRMGDGRNTSWWMVDIGPGHQLMCNYYTLRQDGSKAFMRCWNFQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
             +DG NWTNLR+H+ D+T CKPGQFASW I  PN LLPFRF
Sbjct  732  SSDGRNWTNLRIHEKDETLCKPGQFASWPINDPNALLPFRF  772



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+QGT FAGP  EDG   S W +D+G DHQLMCNYYT+RQDGS  FMRSW  QG
Sbjct  730  KALVSKNYQGTCFAGPCIEDGKKISWWMVDIGQDHQLMCNYYTVRQDGSTTFMRSWVLQG  789

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWT+LRVH++D T C PGQFASW + GP  LLPFRF
Sbjct  790  SMDGRNWTSLRVHEEDATICHPGQFASWPVVGPPALLPFRF  830



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +QGT FAGP+ E+G   + W +DLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  672  KVLVSRTYQGTCFAGPRLENGQNCTWWMVDLGQDHQLMCNYYTLRQDGSKAFPRFWNIQG  731

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              +G +WTNL VH++D++ CKPGQFASW I GPN LLPFR+
Sbjct  732  SQEGKSWTNLWVHENDRSVCKPGQFASWPIVGPNALLPFRY  772



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS+N+QGT FAGP  E+G   S W +D+G D+QLMCNYYT+RQDGS  FMRSW  QG
Sbjct  679  KALVSKNYQGTCFAGPCIENGKKLSWWMVDIGQDYQLMCNYYTVRQDGSTTFMRSWALQG  738

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWT+LRVH DD T C PGQFASW I GP  LLPFRF
Sbjct  739  SMDGRNWTSLRVHDDDPTICHPGQFASWPIVGPAALLPFRF  779



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSR +Q TSFAGP+ EDG   + W +DLG DHQLMCN YT+RQDGS  +MR W  QG
Sbjct  676  KVLVSRTYQATSFAGPRMEDGKNCAWWMVDLGQDHQLMCNCYTLRQDGSNVYMRCWALQG  735

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG NWT+L+VH +DQT CKPGQFASW + GP  +LPFRF
Sbjct  736  SLDGRNWTDLKVHGNDQTICKPGQFASWPVQGPAAVLPFRF  776



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SR ++GT FAGP+ E+G+  S W +DLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  665  KVLASRTYRGTCFAGPRLENGHNCSWWMVDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQG  724

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W  LR+H++D T CKPGQFASW I  PN LLPFR+
Sbjct  725  SMDGKSWRELRIHENDGTICKPGQFASWPIVAPNALLPFRY  765



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SR ++GT FAGP+ E+G+  S W +DLG DHQLMCNYYT+RQDGS+AF R WN QG
Sbjct  685  KVLASRTYRGTCFAGPRLENGHNCSWWMVDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQG  744

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +W  LR+H++D T CKPGQFASW I  PN LLPFR+
Sbjct  745  SMDGKSWRELRIHENDGTICKPGQFASWPIVAPNALLPFRY  785



>gb|AAB63076.1| unknown protein [Arabidopsis thaliana]
Length=114

 Score =   131 bits (329),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  EDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQT  70
            EDG+ISS W +DLG +HQLMCNYYT RQDGSRAF R W  QG  DG  WT+LRVH+DDQT
Sbjct  2    EDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQT  61

Query  69   XCKPGQFASWXITGPNPLLPFRF  1
             CK GQFASW IT  N LLPFRF
Sbjct  62   MCKAGQFASWPITAANALLPFRF  84



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR +Q TSFAGP+   G   + W ID+G DH+LMCNYYTIRQDGS  F R W+ QG
Sbjct  697  KSLVSRTYQATSFAGPRIVGGKNCAWWKIDIGQDHELMCNYYTIRQDGSTGFTRHWSLQG  756

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              D  NWT+LRVH++D+T CKP QFASW I  PN LLPFRF
Sbjct  757  SRDAENWTDLRVHENDRTICKPAQFASWPIHPPNALLPFRF  797



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   139 bits (351),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 8/101 (8%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSR ++         EDG+ S+ W +D+G DHQL+CN YT+RQDGSRA+MR WN QG
Sbjct  675  KALVSRTYR--------IEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQG  726

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WTNLRVH++DQT CKPGQFASW + G N LLPFRF
Sbjct  727  SLDGKTWTNLRVHENDQTICKPGQFASWPVIGQNALLPFRF  767



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   137 bits (344),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 72/101 (71%), Gaps = 14/101 (14%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVLVSRNFQGTS AGPQ EDG  +S W +D+G DHQLMCNYYT+RQDGS AFMR WN QG
Sbjct  694  KVLVSRNFQGTSLAGPQMEDGRNASWWMVDVGQDHQLMCNYYTLRQDGSGAFMRRWNFQG  753

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG +WTNLR+      XC P        TGPN LLPFRF
Sbjct  754  SLDGKSWTNLRI------XCSP--------TGPNALLPFRF  780



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   135 bits (340),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SRN+Q TSFAGP  E G   S W +DLG DH+LMCNYY++RQDGS  F R+W  QG
Sbjct  642  KVLASRNYQATSFAGPCIERGETVSWWRVDLGPDHKLMCNYYSVRQDGSTNFARNWTFQG  701

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LR H+ D +  +P Q+ASW + G   L+PFRF
Sbjct  702  SGDGETWTDLRKHEKDHSIYRPAQYASWPVHGSKSLIPFRF  742



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   135 bits (339),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            KVL SRN+Q TSFAGP  E G   S W +DLG DH+LMCNYY++RQDGS  F R+W  QG
Sbjct  662  KVLASRNYQATSFAGPCIERGETVSWWRVDLGPDHKLMCNYYSVRQDGSTNFARNWTFQG  721

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT+LR H+ D +  +P Q+ASW + G   L+PFRF
Sbjct  722  SGDGETWTDLRKHEKDHSIYRPAQYASWPVHGSKSLIPFRF  762



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVSRN+QGTSFAGP    G +S+ W +DLG D QL+CNYYT+RQD S +FMR+W+ QG
Sbjct  654  KALVSRNYQGTSFAGPCNVGGQMSAWWKVDLGADQQLLCNYYTVRQDSSSSFMRNWSLQG  713

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
              DG  WT LR H +DQT    GQ+ASW + G N LLPFRF
Sbjct  714  SVDGQRWTQLRTHHNDQTIGHGGQYASWPVFGANALLPFRF  754



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   111 bits (278),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K L   NF   +FAGP+ E+G +SS W +DLG +H+L+CN+YT+R DGS  F+RSW  QG
Sbjct  524  KALAGNNFARCNFAGPRMENGQLSSWWVLDLGPEHRLICNHYTLRHDGSTDFLRSWVLQG  583

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFR  4
              DG +W +LR H  D+T   PGQ+ASW ++     +P+R
Sbjct  584  SNDGASWADLRRHISDRTVRMPGQYASWPVSSHAAAVPYR  623



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score =   103 bits (256),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 0/100 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K LVS  F  TSFA P+ E G  SS W +DLG  H+L+CNYYT+R D S  F R W  Q 
Sbjct  555  KALVSGAFLRTSFACPRYEGGQPSSWWLVDLGPSHRLLCNYYTMRHDSSSDFPRHWVLQA  614

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFR  4
              D  +W +LR H  D     PGQ+ASW ++GP   +PFR
Sbjct  615  SNDLQHWVDLRRHIADAAIRLPGQYASWPVSGPASHMPFR  654



>ref|XP_005650913.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26369.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQG  124
            K +VS +F   + AG Q  DG   + W +DLG  H+LMCNYYT+R D S  + RSW  Q 
Sbjct  311  KAVVSGHFLRNNAAG-QRRDGG--TWWRVDLGEQHRLMCNYYTMRHDASPDYARSWALQA  367

Query  123  XTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
             TDG  W +LR H DD T    GQ+ASW +TG     PFRF
Sbjct  368  STDGTVWVDLRQHADDCTINMAGQYASWPVTGHAARRPFRF  408



>ref|XP_001697437.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00099.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=113

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -3

Query  246  DGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
            +G  SS W +DLG  HQL   YYT+R DGS+ F RSW  QG  D  NW +L+ H +D T 
Sbjct  1    NGVASSWWQVDLGEQHQLAITYYTLRHDGSQDFARSWVLQGSHDLSNWVDLKRHANDTTV  60

Query  66   CKPGQFASWXITGPNPLLPFR  4
              PGQ+ASW + GP    P+R
Sbjct  61   KVPGQYASWPVIGPAAATPYR  81



>ref|XP_002950189.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
 gb|EFJ48857.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
Length=108

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  231  SXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
            S W +DLG  HQL   YYT+R DGS+ F+RSW  QG  D   W +L+ H +D T   PGQ
Sbjct  1    SWWQVDLGEQHQLAITYYTLRHDGSQDFVRSWVLQGSHDLAVWVDLKRHSNDTTIKVPGQ  60

Query  51   FASWXITGPNPLLPFR  4
            +ASW + GP   +P+R
Sbjct  61   YASWPVIGPAAAVPYR  76



>ref|XP_011399599.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
 gb|KFM26661.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
Length=465

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -3

Query  270  SFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQGXTDG--VNWTN  97
            +FA P+ E G + S W +DLG  HQL C+ YT+R D S   +RSW  Q   DG    W +
Sbjct  322  NFAAPRSEAGRLVSWWSLDLGPRHQLACSAYTLRHDKSHDPLRSWTLQASRDGPQCGWED  381

Query  96   LRVHKDDQTXCKPGQFASWXITGPNPLLPFR  4
            LR H++D T   PGQ+ SW +TG    +P+R
Sbjct  382  LRRHENDLTLRLPGQYGSWAVTGHAATVPYR  412



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  WXIDLGYDHQLMCNYYTIRQDGSRA-FMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQF  49
            + +DLG +  L C++YT+  DGS + F+R+W  +G  DG +WT L+ H++D+T   P Q 
Sbjct  866  FALDLGAERVLACSFYTLAHDGSESNFLRNWCLEGSKDGKSWTVLKEHQNDETLQSPLQR  925

Query  48   ASWXITGPNPLLPFRF  1
            A+W +  P   + +R+
Sbjct  926  ATWRLEEPTSQVFYRY  941



>gb|KDD72973.1| hypothetical protein H632_c2675p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=110

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 37/72 (51%), Gaps = 0/72 (0%)
 Frame = -3

Query  219  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQFASW  40
            +DLG   +L   +Y +R D SR F+R W  Q   DG  W ++R H  D +     Q+A+W
Sbjct  1    VDLGPRRRLALTHYALRHDASRDFLRDWVVQASADGEAWVDVRRHASDPSLKVAHQWAAW  60

Query  39   XITGPNPLLPFR  4
             + G     P+R
Sbjct  61   PLVGHAAARPWR  72



>ref|XP_004339299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=775

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  YTIRQDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNPLLPFRF  1
            Y IRQDGS  F+RSW+ QG  DG +W +L  H +D     P ++  W ++   P   FR 
Sbjct  689  YAIRQDGSTVFLRSWSMQGSNDGQSWVDLSTHVNDCGLASPSRWVFWPVSSVVPYAQFRL  748



>ref|XP_011189870.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
cucurbitae]
Length=2889

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    L+ N YT+R  +   R+ +R+W  QG  DGV WT L  H DD++ 
Sbjct  1214  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1271

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1272  VEPGSTATWPIVCAPDEMHGFR  1293



>ref|XP_011189869.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
cucurbitae]
Length=2893

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    L+ N YT+R  +   R+ +R+W  QG  DGV WT L  H DD++ 
Sbjct  1214  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1271

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1272  VEPGSTATWPIVCAPDEMHGFR  1293



>ref|XP_011189866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
 ref|XP_011189867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
Length=2905

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    L+ N YT+R  +   R+ +R+W  QG  DGV WT L  H DD++ 
Sbjct  1226  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1283

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1284  VEPGSTATWPIVCAPDEMHGFR  1305



>ref|XP_011189868.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
cucurbitae]
Length=2901

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    L+ N YT+R  +   R+ +R+W  QG  DGV WT L  H DD++ 
Sbjct  1226  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1283

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1284  VEPGSTATWPIVCAPDEMHGFR  1305



>ref|XP_011199880.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
dorsalis]
Length=2887

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1209  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1266

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1267  VEPGSTATWPIVCAPDEMHGFR  1288



>ref|XP_011199881.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
dorsalis]
Length=2883

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1209  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1266

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1267  VEPGSTATWPIVCAPDEMHGFR  1288



>ref|XP_011199879.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
dorsalis]
Length=2895

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1221  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1278

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1279  VEPGSTATWPIVCAPDEMHGFR  1300



>ref|XP_011199876.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199877.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199878.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
Length=2899

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1221  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1278

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1279  VEPGSTATWPIVCAPDEMHGFR  1300



>ref|XP_004521546.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X5 
[Ceratitis capitata]
Length=2888

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1211  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1268

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1269  VEPGSTATWPIVCSPDEMQGFR  1290



>ref|XP_004521542.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521543.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Ceratitis capitata]
 ref|XP_004521544.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Ceratitis capitata]
Length=2900

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1223  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1280

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1281  VEPGSTATWPIVCSPDEMQGFR  1302



>ref|XP_004521545.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X4 
[Ceratitis capitata]
Length=2896

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1223  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1280

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1281  VEPGSTATWPIVCSPDEMQGFR  1302



>ref|XP_011414031.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Crassostrea gigas]
Length=2445

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++  +YT+R  +   R+ +R+W  Q   DG+NW  L+ HKDD +  +PG 
Sbjct  1147  FAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGS  1204

Query  51    FASWXITGP  25
              A+W +T P
Sbjct  1205  TATWPLTPP  1213



>ref|XP_011414030.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Crassostrea gigas]
Length=2448

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++  +YT+R  +   R+ +R+W  Q   DG+NW  L+ HKDD +  +PG 
Sbjct  1150  FAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGS  1207

Query  51    FASWXITGP  25
              A+W +T P
Sbjct  1208  TATWPLTPP  1216



>ref|XP_004521547.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X6 
[Ceratitis capitata]
Length=2477

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1223  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1280

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+ +  FR
Sbjct  1281  VEPGSTATWPIVCSPDEMQGFR  1302



>gb|EKC30956.1| E3 ubiquitin-protein ligase HECTD1 [Crassostrea gigas]
Length=2380

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++  +YT+R  +   R+ +R+W  Q   DG+NW  L+ HKDD +  +PG 
Sbjct  1147  FAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGS  1204

Query  51    FASWXITGP  25
              A+W +T P
Sbjct  1205  TATWPLTPP  1213



>ref|XP_005708289.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
 gb|EME31769.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
Length=960

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -3

Query  297  LVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRA-FMRSWNXQGX  121
            LV      +SFA P   D +  + + +D G  ++L C+ Y++  DGS + F+R+W  +G 
Sbjct  833  LVESGANRSSFALP---DSSGLAWFSLDFGTKYELACSAYSLVHDGSESNFLRNWCLEGS  889

Query  120  TDGVNWTNLRVHKDDQTXCKPGQFASWXI  34
             DG  W+ L+ H +D++   P Q + W I
Sbjct  890  KDGTQWSILKEHINDKSLQHPLQRSVWKI  918



>ref|XP_005708288.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
 gb|EME31768.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
Length=944

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -3

Query  297  LVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQLMCNYYTIRQDGSRA-FMRSWNXQGX  121
            LV      +SFA P   D +  + + +D G  ++L C+ Y++  DGS + F+R+W  +G 
Sbjct  817  LVESGANRSSFALP---DSSGLAWFSLDFGTKYELACSAYSLVHDGSESNFLRNWCLEGS  873

Query  120  TDGVNWTNLRVHKDDQTXCKPGQFASWXI  34
             DG  W+ L+ H +D++   P Q + W I
Sbjct  874  KDGTQWSILKEHINDKSLQHPLQRSVWKI  902



>ref|XP_004333299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=764

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = -3

Query  243  GNISSXW-XIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNXQGXTDGVNWTNLRVHKDDQ  73
            G++ + W  IDLG    L+ NYYT+R  G+     +R+W+ QG +DG  W  L+ H +D 
Sbjct  653  GDVPASWFAIDLGPSRTLVPNYYTLRHGGNYKADSLRTWDLQGSSDGKTWIVLKRHTNDT  712

Query  72   TXCKPGQFASWXI  34
            +   P    SW I
Sbjct  713  SLSGPFATHSWPI  725



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  303  KVLVSRNFQGTSFAGPQXEDGNISSXWXIDLGYDHQ  196
            KVLVSR +QGT FAGP+ E+G   S W +DLG DHQ
Sbjct  676  KVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQDHQ  711



>ref|XP_005178040.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Musca 
domestica]
Length=2792

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGVNWT L  H DD++ 
Sbjct  1189  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1246

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+    FR
Sbjct  1247  VEPGSTATWPIVCAPDENQGFR  1268



>ref|XP_011290265.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Musca 
domestica]
Length=2804

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGVNWT L  H DD++ 
Sbjct  1201  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1258

Query  66    CKPGQFASWXIT-GPNPLLPFR  4
              +PG  A+W I   P+    FR
Sbjct  1259  VEPGSTATWPIVCAPDENQGFR  1280



>ref|XP_011290264.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Musca 
domestica]
Length=2836

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 4/67 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R      R+ +R+W  Q   DGVNWT L  H DD++  +PG 
Sbjct  1238  FAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGS  1295

Query  51    FASWXIT  31
              A+W I 
Sbjct  1296  TATWPIV  1302



>ref|XP_011290263.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Musca 
domestica]
Length=2848

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 4/67 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R      R+ +R+W  Q   DGVNWT L  H DD++  +PG 
Sbjct  1250  FAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGS  1307

Query  51    FASWXIT  31
              A+W I 
Sbjct  1308  TATWPIV  1314



>ref|XP_005178039.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Musca 
domestica]
Length=2847

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 4/67 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R      R+ +R+W  Q   DGVNWT L  H DD++  +PG 
Sbjct  1249  FAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGS  1306

Query  51    FASWXIT  31
              A+W I 
Sbjct  1307  TATWPIV  1313



>ref|XP_001969437.1| GG23957 [Drosophila erecta]
 gb|EDV58496.1| GG23957 [Drosophila erecta]
Length=2724

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 4/72 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1189  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSL  1246

Query  66    CKPGQFASWXIT  31
              +PG  A+W IT
Sbjct  1247  VEPGSTATWPIT  1258



>ref|XP_002089068.1| GE26196 [Drosophila yakuba]
 gb|EDW88780.1| GE26196 [Drosophila yakuba]
Length=2725

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 4/72 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSL  1247

Query  66    CKPGQFASWXIT  31
              +PG  A+W IT
Sbjct  1248  VEPGSTATWPIT  1259



>ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
 gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
Length=2686

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YTIR  +   R+ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1151  FAIDLGL--WLIPSCYTIRHARGYGRSALRNWLFQVSKDGVNWTTLYTHTDDTSLNEPGS  1208

Query  51    FASWXITGP  25
              ASW +  P
Sbjct  1209  TASWPLDPP  1217



>ref|XP_002036468.1| GM11846 [Drosophila sechellia]
 gb|EDW52391.1| GM11846 [Drosophila sechellia]
Length=2725

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 4/72 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1247

Query  66    CKPGQFASWXIT  31
              +PG  A+W IT
Sbjct  1248  VEPGSTATWPIT  1259



>ref|XP_002078905.1| GD22285 [Drosophila simulans]
 gb|EDX04490.1| GD22285 [Drosophila simulans]
Length=2404

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 4/72 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1024  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1081

Query  66    CKPGQFASWXIT  31
              +PG  A+W IT
Sbjct  1082  VEPGSTATWPIT  1093



>ref|XP_001963078.1| GF14121 [Drosophila ananassae]
 gb|EDV32299.1| GF14121 [Drosophila ananassae]
Length=2704

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   Y++R  +  +R+ +R+W  QG  DG+ WT L  H DD++ 
Sbjct  1175  NKKAWFAIDLGV--YIIPTAYSLRHARGYARSALRNWLLQGSKDGIVWTTLSTHVDDKSL  1232

Query  66    CKPGQFASWXITGP  25
               PG  A+W I+ P
Sbjct  1233  VDPGSTATWPISCP  1246



>ref|XP_002004091.1| GI19489 [Drosophila mojavensis]
 gb|EDW13533.1| GI19489 [Drosophila mojavensis]
Length=2647

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 4/71 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W+ Q   DG+NWT L  H DD++ 
Sbjct  1121  NKKAWFSIDLGV--YILPTAYTLRHARGYGRSALRNWHLQASKDGINWTTLINHVDDKSL  1178

Query  66    CKPGQFASWXI  34
              +PG  A+W I
Sbjct  1179  SEPGSTATWPI  1189



>ref|XP_009860152.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ciona intestinalis]
Length=2647

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = -3

Query  219   IDLGYDHQLMCNYYTIRQDG--SRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQFA  46
             I L +  Q++   Y++R     SR+ +R+W  Q   DG NWT L  H +D++  +PG  A
Sbjct  1165  IALDFGLQIIPTKYSLRHSRGYSRSALRNWLFQASNDGKNWTTLVTHTNDKSLNQPGSTA  1224

Query  45    SWXI  34
             SW I
Sbjct  1225  SWSI  1228



>ref|XP_011314687.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Fopius 
arisanus]
Length=2365

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1193  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1250

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1251  TATWTLEAP  1259



>ref|XP_011314680.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fopius 
arisanus]
Length=2587

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1193  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1250

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1251  TATWTLEAP  1259



>ref|XP_011314684.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Fopius 
arisanus]
Length=2547

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1153  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1210

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1211  TATWTLEAP  1219



>ref|XP_011314679.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fopius 
arisanus]
Length=2591

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1193  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1250

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1251  TATWTLEAP  1259



>ref|XP_011406508.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Amphimedon 
queenslandica]
Length=2146

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = -3

Query  183   YYTIRQD---GSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQFASWXITGP  25
             +Y++R     G+R+ +RSW+ Q   DGV WT +  H +D +  +PG  ASW ++ P
Sbjct  1085  HYSLRHSRGYGNRSALRSWDFQVSKDGVTWTTVYSHVNDNSLNEPGSTASWSLSPP  1140



>ref|XP_011267641.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Camponotus 
floridanus]
Length=2548

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1142  FSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDCSLNEPGS  1199

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1200  TATWTLDPPS  1209



>gb|EFN60527.1| E3 ubiquitin-protein ligase HECTD1 [Camponotus floridanus]
Length=2551

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1142  FSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDCSLNEPGS  1199

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1200  TATWTLDPPS  1209



>ref|XP_011314681.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fopius 
arisanus]
Length=2579

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1181  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1238

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1239  TATWTLEAP  1247



>ref|XP_011267639.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Camponotus 
floridanus]
Length=2586

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1180  FSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDCSLNEPGS  1237

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1238  TATWTLDPPS  1247



>ref|XP_011267637.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Camponotus 
floridanus]
Length=2598

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1192  FSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDCSLNEPGS  1249

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1250  TATWTLDPPS  1259



>ref|XP_011314688.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X9 [Fopius 
arisanus]
Length=2535

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1141  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1198

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1199  TATWTLEAP  1207



>ref|XP_011267642.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Camponotus 
floridanus]
Length=2530

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1192  FSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDCSLNEPGS  1249

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1250  TATWTLDPPS  1259



>ref|XP_011314685.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Fopius 
arisanus]
Length=2539

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1141  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1198

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1199  TATWTLEAP  1207



>ref|XP_011267640.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Camponotus 
floridanus]
Length=2560

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ N YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1154  FSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDCSLNEPGS  1211

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1212  TATWTLDPPS  1221



>ref|XP_011314686.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Fopius 
arisanus]
Length=2524

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1193  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1250

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1251  TATWTLEAP  1259



>ref|XP_011314682.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fopius 
arisanus]
Length=2551

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1153  FSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEPGS  1210

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1211  TATWTLEAP  1219



>ref|WP_029637034.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=223

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  LMCNYYTIR-QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQFASWXITGPNP  19
            L CNYY+IR +     ++R+W  QG  DG  W +L V  ++ T   P Q+ S+ IT  N 
Sbjct  132  LKCNYYSIRNRSNVDHYLRNWKFQGSNDGSVWADLDVRTNNITLSSPSQWLSFPITTTNF  191

Query  18   LLPFRF  1
               FR 
Sbjct  192  YTQFRL  197



>gb|AAQ23602.1| LP05936p [Drosophila melanogaster]
Length=2727

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 4/71 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1247

Query  66    CKPGQFASWXI  34
              +PG  A+W I
Sbjct  1248  VEPGSTATWPI  1258



>ref|NP_609369.1| CG5604 [Drosophila melanogaster]
 gb|AAF52899.1| CG5604 [Drosophila melanogaster]
Length=2727

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 4/71 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  QG  DG  WT L  H DD++ 
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1247

Query  66    CKPGQFASWXI  34
              +PG  A+W I
Sbjct  1248  VEPGSTATWPI  1258



>ref|XP_003739715.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Metaseiulus 
occidentalis]
Length=2249

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++  +YT+R  +   R+ +R+W  QG  D +NWT L  H+DD +  +PG 
Sbjct  1090  FSIDLGV--WIVPTHYTLRHARGYGRSALRNWVLQGSRDALNWTTLYTHQDDCSLNEPGS  1147

Query  51    FASWXI  34
              A+W +
Sbjct  1148  TATWKL  1153



>ref|XP_002052386.1| GJ21961 [Drosophila virilis]
 gb|EDW64541.1| GJ21961 [Drosophila virilis]
Length=2710

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 4/71 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  Q   DG+NWT L  H DD++ 
Sbjct  1181  NKKAWFSIDLGV--CIVPTAYTLRHARGYGRSALRNWLLQASKDGINWTTLISHVDDKSL  1238

Query  66    CKPGQFASWXI  34
              +PG  A+W I
Sbjct  1239  AEPGSTATWPI  1249



>ref|XP_008547990.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Microplitis 
demolitor]
Length=2569

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + Y++R  +   ++ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1168  FSIDLGV--WLIPSAYSLRHARGYGKSALRNWMFQASKDGVNWTTLYTHIDDCSLNEPGS  1225

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1226  TATWTLEPPS  1235



>ref|XP_008547994.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Microplitis 
demolitor]
Length=2563

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + Y++R  +   ++ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1168  FSIDLGV--WLIPSAYSLRHARGYGKSALRNWMFQASKDGVNWTTLYTHIDDCSLNEPGS  1225

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1226  TATWTLEPPS  1235



>ref|XP_008547992.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Microplitis 
demolitor]
Length=2567

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + Y++R  +   ++ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1168  FSIDLGV--WLIPSAYSLRHARGYGKSALRNWMFQASKDGVNWTTLYTHIDDCSLNEPGS  1225

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1226  TATWTLEPPS  1235



>ref|XP_008547995.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Microplitis 
demolitor]
Length=2557

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + Y++R  +   ++ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1162  FSIDLGV--WLIPSAYSLRHARGYGKSALRNWMFQASKDGVNWTTLYTHIDDCSLNEPGS  1219

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1220  TATWTLEPPS  1229



>ref|XP_008547989.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Microplitis 
demolitor]
Length=2573

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + Y++R  +   ++ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1168  FSIDLGV--WLIPSAYSLRHARGYGKSALRNWMFQASKDGVNWTTLYTHIDDCSLNEPGS  1225

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1226  TATWTLEPPS  1235



>ref|XP_008547993.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Microplitis 
demolitor]
Length=2567

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    L+ + Y++R  +   ++ +R+W  Q   DGVNWT L  H DD +  +PG 
Sbjct  1162  FSIDLGV--WLIPSAYSLRHARGYGKSALRNWMFQASKDGVNWTTLYTHIDDCSLNEPGS  1219

Query  51    FASWXITGPN  22
              A+W +  P+
Sbjct  1220  TATWTLEPPS  1229



>ref|XP_003699429.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Megachile rotundata]
Length=2534

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ + YT+R  +   R+ +R+W  Q   DGV WT L  H DD +  +PG 
Sbjct  1139  FSIDLGV--WIIPSAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDDPSLNEPGS  1196

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1197  TATWTLEPP  1205



>ref|XP_003394975.1| PREDICTED: LOW QUALITY PROTEIN: e3 ubiquitin-protein ligase HECTD1-like 
[Bombus terrestris]
Length=2541

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ + YT+R  +   R+ +R+W  Q   DG+ WT L  H DD +  +PG 
Sbjct  1139  FSIDLGV--WIIPSAYTLRHARGYGRSALRNWMFQASKDGIIWTTLYAHVDDSSLNEPGS  1196

Query  51    FASWXITGP  25
              ASW +  P
Sbjct  1197  TASWTLEPP  1205



>ref|XP_002014386.1| GL19165 [Drosophila persimilis]
 gb|EDW28382.1| GL19165 [Drosophila persimilis]
Length=2719

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  Q   DGV WT L  H DD++ 
Sbjct  1189  NKKAYFAIDLGV--FIVPTAYTLRHARGYGRSALRNWLLQASKDGVCWTTLSTHIDDKSL  1246

Query  66    CKPGQFASWXITGPNPLLPFR  4
              +PG  A+W I   +  + +R
Sbjct  1247  LEPGSTATWSINCASDSVGYR  1267



>gb|KFB39857.1| AGAP009511-PA-like protein [Anopheles sinensis]
Length=3042

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  S + IDLG    ++   YT+R  +   R+ +R+W  Q   DGVNW     H DD++ 
Sbjct  1219  NKKSWFAIDLGM--YIIPTAYTLRHARGYGRSALRNWMFQLSKDGVNWVTALTHTDDKSL  1276

Query  66    CKPGQFASWXITGPN  22
              +PG   +W I  P+
Sbjct  1277  AEPGSTCTWPIDCPS  1291



>ref|XP_001992956.1| GH13561 [Drosophila grimshawi]
 gb|EDV98881.1| GH13561 [Drosophila grimshawi]
Length=2746

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 4/71 (6%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  + + IDLG    ++   YT+R  +   R+ +R+W  Q   D VNWT L  H DD++ 
Sbjct  1193  NKKAWFAIDLGV--YIVPTAYTLRHARGYGRSALRNWLLQASKDSVNWTTLISHVDDKSL  1250

Query  66    CKPGQFASWXI  34
              +PG  A+W I
Sbjct  1251  VEPGSTATWPI  1261



>ref|XP_310184.4| AGAP009511-PA [Anopheles gambiae str. PEST]
 gb|EAA05937.5| AGAP009511-PA [Anopheles gambiae str. PEST]
Length=2929

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 4/74 (5%)
 Frame = -3

Query  240   NISSXWXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTX  67
             N  S + IDLG    ++   YT+R  +   R+ +R+W  Q   DGV+W  L  H DD++ 
Sbjct  1241  NKKSWFAIDLGI--FILPTAYTLRHARGYGRSALRNWLFQMSKDGVSWVTLLTHTDDKSL  1298

Query  66    CKPGQFASWXITGP  25
              +PG   +W I  P
Sbjct  1299  AEPGSTCTWPIDCP  1312



>gb|KDR14371.1| E3 ubiquitin-protein ligase HECTD1 [Zootermopsis nevadensis]
Length=2759

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ + YT+R  +   R+ +R+W  Q   DG+NWT L  H DD +  +PG 
Sbjct  1198  FAIDLGL--WVLPSSYTLRHARGYGRSALRNWLFQVSKDGLNWTTLYTHMDDGSLNEPGS  1255

Query  51    FASWXITGP  25
              +SW +  P
Sbjct  1256  TSSWPLEPP  1264



>ref|XP_004989701.1| hypothetical protein PTSG_12883 [Salpingoeca rosetta]
 gb|EGD78378.1| hypothetical protein PTSG_12883 [Salpingoeca rosetta]
Length=2036

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 29/84 (35%), Positives = 43/84 (51%), Gaps = 7/84 (8%)
 Frame = -3

Query  240   NISSXW-XIDLGYDHQLMCNYYTIRQDG--SRAFMRSWNXQGXTDGVNWTNLRVHKDDQT  70
             N  S W  IDLG    +  ++YT+R     S + +R+W+ +G  +G  W  LR H+ D+ 
Sbjct  968   NNKSGWVSIDLGL--LIKPSHYTLRHATGYSSSALRTWSLEGSDNGKEWFTLREHEKDEH  1025

Query  69    XCKPGQFASWXITG--PNPLLPFR  4
                PG   +W IT   P P+  FR
Sbjct  1026  LRSPGDTHTWEITTAPPRPVCMFR  1049



>ref|XP_006624251.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X8 
[Apis dorsata]
Length=2578

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ + YT+R  +   R+ +R+W  Q   DG+ WT L  H DD +  +PG 
Sbjct  1180  FSIDLGV--WIIPSAYTLRHARGYGRSALRNWMFQASKDGIIWTTLYAHVDDSSLNEPGS  1237

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1238  TATWTLEPP  1246



>ref|XP_008211005.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Nasonia 
vitripennis]
Length=2579

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++   YT+R  +   ++ +R+W  Q   DG+NWT +  H DD +  +PG 
Sbjct  1173  FSIDLGV--WIIPTAYTLRHARGYGKSALRNWMLQASKDGINWTTIYTHVDDCSLNEPGS  1230

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1231  TATWTLEPP  1239



>ref|XP_008211004.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Nasonia 
vitripennis]
Length=2589

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++   YT+R  +   ++ +R+W  Q   DG+NWT +  H DD +  +PG 
Sbjct  1173  FSIDLGV--WIIPTAYTLRHARGYGKSALRNWMLQASKDGINWTTIYTHVDDCSLNEPGS  1230

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1231  TATWTLEPP  1239



>ref|XP_006624246.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Apis dorsata]
Length=2590

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  225   WXIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNXQGXTDGVNWTNLRVHKDDQTXCKPGQ  52
             + IDLG    ++ + YT+R  +   R+ +R+W  Q   DG+ WT L  H DD +  +PG 
Sbjct  1192  FSIDLGV--WIIPSAYTLRHARGYGRSALRNWMFQASKDGIIWTTLYAHVDDSSLNEPGS  1249

Query  51    FASWXITGP  25
              A+W +  P
Sbjct  1250  TATWTLEPP  1258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090