BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016D14

Length=727
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFS41246.1|  cinnamoyl-CoA hydratase-dehydrogenase                   251   1e-74   Petunia x hybrida [garden petunia]
ref|XP_009608928.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    251   2e-74   Nicotiana tomentosiformis
ref|XP_009766308.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    251   3e-74   Nicotiana sylvestris
gb|AFK48400.1|  unknown                                                 235   3e-74   Lotus japonicus
ref|XP_009803575.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    250   5e-74   Nicotiana sylvestris
ref|XP_004242934.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    247   7e-73   Solanum lycopersicum
ref|XP_004251613.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    246   1e-72   Solanum lycopersicum
ref|XP_006352155.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    245   4e-72   Solanum tuberosum [potatoes]
ref|XP_009595622.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    244   7e-72   Nicotiana tomentosiformis
ref|XP_009371481.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    229   9e-72   
ref|XP_003620604.1|  Peroxisomal fatty acid beta-oxidation multif...    241   6e-71   Medicago truncatula
gb|KDO42235.1|  hypothetical protein CISIN_1g004726mg                   238   7e-71   Citrus sinensis [apfelsine]
ref|XP_006451189.1|  hypothetical protein CICLE_v10007590mg             241   7e-71   
ref|XP_006353465.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    241   9e-71   Solanum tuberosum [potatoes]
ref|XP_006451188.1|  hypothetical protein CICLE_v10007590mg             241   1e-70   Citrus clementina [clementine]
ref|XP_002514279.1|  3-hydroxyacyl-CoA dehyrogenase, putative           240   3e-70   Ricinus communis
gb|KHN45635.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    239   4e-70   Glycine soja [wild soybean]
ref|XP_003534202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    239   4e-70   Glycine max [soybeans]
ref|XP_007152846.1|  hypothetical protein PHAVU_004G164800g             238   1e-69   Phaseolus vulgaris [French bean]
gb|KDO42232.1|  hypothetical protein CISIN_1g004726mg                   238   1e-69   Citrus sinensis [apfelsine]
gb|KDO42231.1|  hypothetical protein CISIN_1g004726mg                   238   1e-69   Citrus sinensis [apfelsine]
gb|KDO42229.1|  hypothetical protein CISIN_1g004726mg                   238   1e-69   Citrus sinensis [apfelsine]
ref|XP_006475648.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    238   1e-69   Citrus sinensis [apfelsine]
ref|XP_003528905.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    237   3e-69   Glycine max [soybeans]
gb|AHB60730.1|  3-hydroxyacyl-CoA dehydrogenase                         228   3e-69   Populus x canadensis [Canadian poplar]
gb|KHN20673.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    237   3e-69   Glycine soja [wild soybean]
gb|ABK96102.1|  unknown                                                 228   4e-69   Populus trichocarpa [western balsam poplar]
gb|KJB27144.1|  hypothetical protein B456_004G280500                    235   5e-69   Gossypium raimondii
ref|XP_011078309.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    236   6e-69   Sesamum indicum [beniseed]
gb|KJB27143.1|  hypothetical protein B456_004G280500                    235   1e-68   Gossypium raimondii
gb|EYU29809.1|  hypothetical protein MIMGU_mgv1a002065mg                234   4e-68   Erythranthe guttata [common monkey flower]
gb|KDO42228.1|  hypothetical protein CISIN_1g004726mg                   233   7e-68   Citrus sinensis [apfelsine]
ref|XP_004512985.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    231   1e-67   
ref|XP_007204255.1|  hypothetical protein PRUPE_ppa002052mg             233   1e-67   Prunus persica
ref|XP_007013128.1|  Enoyl-CoA hydratase/isomerase family               232   2e-67   
emb|CDP03312.1|  unnamed protein product                                232   2e-67   Coffea canephora [robusta coffee]
ref|XP_004512984.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    231   4e-67   Cicer arietinum [garbanzo]
ref|XP_008242673.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    231   5e-67   Prunus mume [ume]
gb|KJB64950.1|  hypothetical protein B456_010G073100                    228   5e-67   Gossypium raimondii
ref|XP_008337363.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    231   6e-67   
gb|KJB64949.1|  hypothetical protein B456_010G073100                    228   6e-67   Gossypium raimondii
gb|KDP33693.1|  hypothetical protein JCGZ_07264                         231   8e-67   Jatropha curcas
ref|XP_007013129.1|  Enoyl-CoA hydratase/isomerase family               231   8e-67   
ref|XP_006352154.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    231   1e-66   Solanum tuberosum [potatoes]
dbj|BAD93971.1|  AIM1 protein                                           214   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254066.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    229   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002324426.2|  hypothetical protein POPTR_0018s08940g             229   6e-66   
gb|KJB64948.1|  hypothetical protein B456_010G073100                    228   7e-66   Gossypium raimondii
ref|XP_010089223.1|  Peroxisomal fatty acid beta-oxidation multif...    228   7e-66   Morus notabilis
ref|XP_004287395.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    228   8e-66   Fragaria vesca subsp. vesca
ref|XP_010089224.1|  Peroxisomal fatty acid beta-oxidation multif...    228   8e-66   
ref|XP_011048390.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    228   9e-66   Populus euphratica
ref|XP_009374040.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    228   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_011048389.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    227   2e-65   Populus euphratica
ref|XP_009371440.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    227   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_008354515.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    223   5e-65   
ref|XP_008390228.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    225   1e-64   
ref|XP_010050568.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    221   1e-64   
ref|XP_010688243.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    224   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002284283.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    224   3e-64   Vitis vinifera
gb|EYU32938.1|  hypothetical protein MIMGU_mgv1a002041mg                223   5e-64   Erythranthe guttata [common monkey flower]
gb|KHG01746.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    223   6e-64   Gossypium arboreum [tree cotton]
ref|XP_009129069.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    222   8e-64   Brassica rapa
ref|XP_010433148.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    222   1e-63   Camelina sativa [gold-of-pleasure]
gb|KCW79923.1|  hypothetical protein EUGRSUZ_C01265                     222   2e-63   Eucalyptus grandis [rose gum]
ref|NP_194630.1|  fatty acid beta-oxidation multifunctional prote...    221   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|ADU15551.1|  MFP                                                     221   2e-63   Gossypium hirsutum [American cotton]
ref|XP_010438362.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    221   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010541187.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    220   5e-63   
ref|XP_002867428.1|  hypothetical protein ARALYDRAFT_491857             219   1e-62   
emb|CDY06852.1|  BnaC01g09510D                                          219   1e-62   
emb|CDY69211.1|  BnaCnng62430D                                          217   1e-62   Brassica napus [oilseed rape]
emb|CDY35240.1|  BnaA01g07910D                                          219   1e-62   Brassica napus [oilseed rape]
emb|CAN66465.1|  hypothetical protein VITISV_006222                     220   2e-62   Vitis vinifera
ref|XP_006412890.1|  hypothetical protein EUTSA_v10024533mg             218   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_009137821.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    218   3e-62   Brassica rapa
gb|KFK29448.1|  hypothetical protein AALP_AA7G135800                    218   4e-62   Arabis alpina [alpine rockcress]
ref|XP_006283211.1|  hypothetical protein CARUB_v10004242mg             218   5e-62   Capsella rubella
emb|CDX97462.1|  BnaC08g13270D                                          217   6e-62   
ref|XP_010047906.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    217   8e-62   Eucalyptus grandis [rose gum]
ref|XP_009109066.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    216   3e-61   Brassica rapa
ref|XP_010447902.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    213   2e-60   Camelina sativa [gold-of-pleasure]
gb|KJB07187.1|  hypothetical protein B456_001G006400                    213   2e-60   Gossypium raimondii
gb|KJB07188.1|  hypothetical protein B456_001G006400                    213   3e-60   Gossypium raimondii
emb|CDX92908.1|  BnaC07g41660D                                          212   1e-59   
ref|XP_010100830.1|  Peroxisomal fatty acid beta-oxidation multif...    208   2e-58   
ref|XP_009409458.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    206   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008458462.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    204   3e-57   Cucumis melo [Oriental melon]
ref|XP_010925875.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    204   4e-57   Elaeis guineensis
ref|XP_006833340.1|  hypothetical protein AMTR_s00109p00083880          202   2e-56   Amborella trichopoda
ref|XP_008775812.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    202   2e-56   Phoenix dactylifera
gb|KGN60609.1|  hypothetical protein Csa_2G003610                       201   3e-56   Cucumis sativus [cucumbers]
ref|XP_004164759.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    201   4e-56   
ref|XP_004139346.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    201   5e-56   Cucumis sativus [cucumbers]
ref|XP_010915852.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    200   9e-56   Elaeis guineensis
ref|XP_006833339.1|  hypothetical protein AMTR_s00109p00082150          199   3e-55   Amborella trichopoda
ref|XP_008800762.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    199   4e-55   Phoenix dactylifera
ref|XP_009413815.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    198   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413814.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    198   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA27004.1|  TO52-1rc                                                182   4e-54   Taraxacum officinale [dandelion]
ref|XP_006354399.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    195   6e-54   Solanum tuberosum [potatoes]
gb|ABR18131.1|  unknown                                                 193   3e-53   Picea sitchensis
gb|AFW65775.1|  hypothetical protein ZEAMMB73_546088                    188   3e-53   
ref|XP_009787311.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    192   6e-53   Nicotiana sylvestris
ref|XP_007012079.1|  Enoyl-CoA hydratase/isomerase family isoform 2     191   1e-52   
ref|XP_007012081.1|  Enoyl-CoA hydratase/isomerase family, putati...    191   1e-52   
gb|AFW70929.1|  hypothetical protein ZEAMMB73_939282                    179   2e-52   
ref|XP_007012078.1|  Peroxisomal fatty acid beta-oxidation multif...    191   2e-52   
ref|XP_009604119.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    190   5e-52   Nicotiana tomentosiformis
ref|XP_006365183.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    189   7e-52   Solanum tuberosum [potatoes]
ref|XP_010325170.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    189   1e-51   Solanum lycopersicum
gb|EEE56720.1|  hypothetical protein OsJ_06222                          180   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008679760.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    187   3e-51   
ref|XP_006647155.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    187   5e-51   Oryza brachyantha
ref|XP_002451943.1|  hypothetical protein SORBIDRAFT_04g010370          186   1e-50   Sorghum bicolor [broomcorn]
ref|NP_001148087.1|  LOC100281695                                       184   7e-50   
ref|XP_004952203.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    184   8e-50   Setaria italica
ref|XP_004952202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    183   2e-49   
dbj|BAJ93145.1|  predicted protein                                      182   3e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91250.1|  predicted protein                                      182   3e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04391.1|  predicted protein                                      182   3e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046536.1|  Os02g0274100                                       181   5e-49   
gb|AAL35606.1|AF442962_1  peroxisomal multifunctional protein           181   5e-49   Oryza sativa [red rice]
gb|EEC72899.1|  hypothetical protein OsI_06722                          181   6e-49   Oryza sativa Indica Group [Indian rice]
gb|AAQ13901.1|  multifunctional protein                                 181   6e-49   Oryza sativa [red rice]
emb|CDM81268.1|  unnamed protein product                                181   7e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003572416.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    176   5e-47   Brachypodium distachyon [annual false brome]
ref|XP_004952201.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    173   5e-46   
ref|XP_002978003.1|  hypothetical protein SELMODRAFT_176660             172   6e-46   Selaginella moellendorffii
ref|XP_002966745.1|  hypothetical protein SELMODRAFT_168461             172   6e-46   Selaginella moellendorffii
gb|KJB60709.1|  hypothetical protein B456_009G321300                    160   2e-45   Gossypium raimondii
ref|XP_001765398.1|  predicted protein                                  164   9e-43   
gb|ACN27387.1|  unknown                                                 154   9e-42   Zea mays [maize]
ref|XP_009381090.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    160   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK24476.1|  unknown                                                 160   1e-41   Picea sitchensis
ref|XP_008645489.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    149   2e-41   
ref|XP_006644156.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    158   9e-41   Oryza brachyantha
ref|XP_009393205.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    157   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW80681.1|  hypothetical protein ZEAMMB73_867373                    155   2e-40   
ref|XP_004968710.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    156   3e-40   Setaria italica
gb|ACN35901.1|  unknown                                                 155   1e-39   Zea mays [maize]
ref|NP_001152306.1|  glyoxysomal fatty acid beta-oxidation multif...    155   2e-39   Zea mays [maize]
ref|XP_008784762.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    152   5e-39   
ref|XP_001773623.1|  predicted protein                                  153   5e-39   
ref|XP_003550336.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    153   6e-39   Glycine max [soybeans]
ref|XP_004508202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    153   6e-39   Cicer arietinum [garbanzo]
ref|XP_008784760.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    153   7e-39   Phoenix dactylifera
ref|XP_008784761.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    152   8e-39   Phoenix dactylifera
ref|XP_003569321.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    153   8e-39   Brachypodium distachyon [annual false brome]
gb|AES91892.2|  glyoxysomal fatty acid beta-oxidation MFP-A protein     152   1e-38   Medicago truncatula
ref|XP_003609695.1|  Glyoxysomal fatty acid beta-oxidation multif...    152   1e-38   
dbj|BAJ86175.1|  predicted protein                                      152   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010921650.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    151   3e-38   Elaeis guineensis
ref|XP_008649523.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    151   3e-38   Zea mays [maize]
ref|XP_008649524.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   3e-38   Zea mays [maize]
gb|KEH37224.1|  glyoxysomal fatty acid beta-oxidation MFP-A protein     151   3e-38   Medicago truncatula
gb|KHN02955.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    150   4e-38   Glycine soja [wild soybean]
ref|XP_003529561.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   4e-38   Glycine max [soybeans]
ref|XP_010931678.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    150   5e-38   Elaeis guineensis
gb|EMT14631.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    148   6e-38   
ref|XP_002439650.1|  hypothetical protein SORBIDRAFT_09g017970          150   6e-38   Sorghum bicolor [broomcorn]
gb|KDO71720.1|  hypothetical protein CISIN_1g008576mg                   147   7e-38   Citrus sinensis [apfelsine]
emb|CDM81353.1|  unnamed protein product                                150   8e-38   Triticum aestivum [Canadian hard winter wheat]
gb|EMT06606.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    150   8e-38   
ref|XP_007154174.1|  hypothetical protein PHAVU_003G096400g             150   8e-38   Phaseolus vulgaris [French bean]
gb|KJB84050.1|  hypothetical protein B456_N005500                       140   8e-38   Gossypium raimondii
ref|XP_004173119.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    148   9e-38   
ref|NP_001234975.1|  peroxisomal fatty acid beta-oxidation multif...    150   1e-37   
ref|XP_004487834.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    149   1e-37   Cicer arietinum [garbanzo]
gb|KHN03349.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    149   1e-37   Glycine soja [wild soybean]
dbj|BAJ85471.1|  predicted protein                                      149   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61353.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    149   1e-37   Triticum urartu
ref|XP_006600114.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    149   2e-37   Glycine max [soybeans]
gb|KJB72710.1|  hypothetical protein B456_011G191800                    149   2e-37   Gossypium raimondii
gb|KJB84048.1|  hypothetical protein B456_N005500                       140   2e-37   Gossypium raimondii
gb|KJB72711.1|  hypothetical protein B456_011G191800                    149   2e-37   Gossypium raimondii
ref|XP_003578000.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    149   2e-37   Brachypodium distachyon [annual false brome]
ref|XP_010039870.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    149   2e-37   Eucalyptus grandis [rose gum]
gb|KJB72706.1|  hypothetical protein B456_011G191800                    148   3e-37   Gossypium raimondii
gb|KDO71719.1|  hypothetical protein CISIN_1g008576mg                   147   3e-37   Citrus sinensis [apfelsine]
gb|KDO71723.1|  hypothetical protein CISIN_1g008576mg                   147   3e-37   Citrus sinensis [apfelsine]
gb|KGN47431.1|  hypothetical protein Csa_6G319770                       148   4e-37   Cucumis sativus [cucumbers]
gb|KHG21753.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    148   4e-37   Gossypium arboreum [tree cotton]
gb|EPS70422.1|  hypothetical protein M569_04343                         137   5e-37   Genlisea aurea
gb|KCW61184.1|  hypothetical protein EUGRSUZ_H039482                    146   6e-37   Eucalyptus grandis [rose gum]
ref|XP_007221966.1|  hypothetical protein PRUPE_ppa002036mg             147   7e-37   Prunus persica
gb|KJB18729.1|  hypothetical protein B456_003G067500                    136   7e-37   Gossypium raimondii
ref|XP_006419532.1|  hypothetical protein CICLE_v10004429mg             147   7e-37   Citrus clementina [clementine]
ref|XP_008810214.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    147   9e-37   Phoenix dactylifera
gb|EEC79068.1|  hypothetical protein OsI_19644                          147   9e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001042973.1|  Os01g0348600                                       147   1e-36   
ref|XP_002314377.1|  MULTIFUNCTIONAL family protein                     147   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008458439.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    146   1e-36   Cucumis melo [Oriental melon]
ref|XP_008223215.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    146   1e-36   Prunus mume [ume]
gb|EEE63425.1|  hypothetical protein OsJ_18237                          146   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008458418.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    146   2e-36   Cucumis melo [Oriental melon]
ref|XP_010259502.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    146   2e-36   Nelumbo nucifera [Indian lotus]
gb|AAT38103.1|  putative glyoxysomal fatty acid beta-oxidation mu...    146   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010024717.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    146   2e-36   Eucalyptus grandis [rose gum]
ref|XP_011010197.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    146   2e-36   Populus euphratica
gb|KCW61185.1|  hypothetical protein EUGRSUZ_H039482                    146   2e-36   Eucalyptus grandis [rose gum]
ref|XP_009769326.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    146   2e-36   Nicotiana sylvestris
dbj|BAG16526.1|  putative glyoxysomal fatty acid beta-oxidation m...    146   2e-36   Capsicum chinense [bonnet pepper]
ref|XP_006840485.1|  hypothetical protein AMTR_s00045p00190660          146   2e-36   
gb|EMS51968.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    145   4e-36   Triticum urartu
gb|KJB34649.1|  hypothetical protein B456_006G076600                    145   4e-36   Gossypium raimondii
ref|XP_009622777.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    145   4e-36   Nicotiana tomentosiformis
ref|XP_001780666.1|  predicted protein                                  145   4e-36   
ref|XP_006349823.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    145   6e-36   Solanum tuberosum [potatoes]
gb|AIL29217.1|  fatty acid beta-oxidation multifunctional protein       145   7e-36   Camellia oleifera [abura-tsubaki]
ref|XP_008390640.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    144   8e-36   
ref|XP_002270067.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    144   8e-36   Vitis vinifera
ref|XP_004252912.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    144   9e-36   Solanum lycopersicum
ref|XP_006380155.1|  hypothetical protein POPTR_0008s22410g             144   9e-36   
ref|XP_002882497.1|  hypothetical protein ARALYDRAFT_478006             144   9e-36   
ref|XP_011003910.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    144   9e-36   Populus euphratica
ref|XP_010314711.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    144   9e-36   Solanum lycopersicum
gb|KDP27817.1|  hypothetical protein JCGZ_18897                         144   9e-36   Jatropha curcas
ref|XP_006489051.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    144   1e-35   
ref|XP_006380154.1|  MULTIFUNCTIONAL family protein                     144   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_007154175.1|  hypothetical protein PHAVU_003G096500g             144   1e-35   Phaseolus vulgaris [French bean]
ref|XP_009623955.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    144   1e-35   Nicotiana tomentosiformis
emb|CBI22983.3|  unnamed protein product                                144   1e-35   Vitis vinifera
ref|XP_004296857.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    144   1e-35   Fragaria vesca subsp. vesca
emb|CDO98847.1|  unnamed protein product                                144   2e-35   Coffea canephora [robusta coffee]
ref|XP_007035631.1|  Multifunctional protein 2                          143   2e-35   
ref|XP_006297065.1|  hypothetical protein CARUB_v10013066mg             143   2e-35   Capsella rubella
ref|XP_006654304.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    143   2e-35   Oryza brachyantha
ref|XP_010486216.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    143   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010445439.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    142   2e-35   Camelina sativa [gold-of-pleasure]
emb|CDY08028.1|  BnaC03g34950D                                          143   2e-35   Brassica napus [oilseed rape]
ref|XP_011071437.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    143   3e-35   Sesamum indicum [beniseed]
sp|O49809.2|MFPA_BRANA  RecName: Full=Glyoxysomal fatty acid beta...    143   3e-35   Brassica napus [oilseed rape]
ref|XP_010464276.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    143   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010321770.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    144   3e-35   
ref|NP_187342.1|  fatty acid beta-oxidation multifunctional prote...    143   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962329.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    143   3e-35   Setaria italica
emb|CDX74076.1|  BnaA03g29710D                                          143   3e-35   
ref|XP_009134933.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    143   3e-35   Brassica rapa
gb|EEC78551.1|  hypothetical protein OsI_18514                          139   4e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010445530.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    142   4e-35   Camelina sativa [gold-of-pleasure]
emb|CAA55910.1|  protein MFP-b                                          141   4e-35   Cucumis sativus [cucumbers]
ref|XP_010105147.1|  Glyoxysomal fatty acid beta-oxidation multif...    142   5e-35   Morus notabilis
gb|EYU45545.1|  hypothetical protein MIMGU_mgv1a002038mg                142   7e-35   Erythranthe guttata [common monkey flower]
ref|XP_009352290.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    142   8e-35   Pyrus x bretschneideri [bai li]
ref|XP_004168411.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    142   8e-35   
ref|XP_010524718.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    141   1e-34   Tarenaya hassleriana [spider flower]
gb|KGN47371.1|  hypothetical protein Csa_6G306330                       141   1e-34   Cucumis sativus [cucumbers]
ref|XP_004168410.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    141   1e-34   
gb|EMS65926.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    140   2e-34   Triticum urartu
ref|XP_006342814.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    140   2e-34   
emb|CEF97273.1|  6-phosphogluconate dehydrogenase,C-terminal-like       140   3e-34   Ostreococcus tauri
gb|EYU42227.1|  hypothetical protein MIMGU_mgv1a002069mg                140   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_006407895.1|  hypothetical protein EUTSA_v10020152mg             140   3e-34   Eutrema salsugineum [saltwater cress]
gb|KHG21889.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    140   4e-34   Gossypium arboreum [tree cotton]
gb|AFW77662.1|  hypothetical protein ZEAMMB73_186479                    129   4e-34   
ref|XP_006355812.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    140   4e-34   Solanum tuberosum [potatoes]
ref|XP_010547011.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    140   4e-34   Tarenaya hassleriana [spider flower]
gb|EEE59589.1|  hypothetical protein OsJ_11897                          139   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054687.1|  Os05g0155000                                       139   4e-34   
ref|XP_009787309.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    129   5e-34   Nicotiana sylvestris
gb|KCW61179.1|  hypothetical protein EUGRSUZ_H03943                     138   5e-34   Eucalyptus grandis [rose gum]
ref|XP_008340793.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    139   5e-34   
ref|XP_010321853.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    138   6e-34   
gb|KFK38149.1|  hypothetical protein AALP_AA3G075600                    139   6e-34   Arabis alpina [alpine rockcress]
gb|EMT31909.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    139   7e-34   
emb|CDY05296.1|  BnaC05g45070D                                          139   8e-34   
ref|XP_009124621.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    139   8e-34   Brassica rapa
gb|EPS73418.1|  hypothetical protein M569_01334                         139   8e-34   Genlisea aurea
ref|XP_007050972.1|  Multifunctional protein 2, putative isoform 3      138   9e-34   
ref|XP_010693603.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    139   9e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004240549.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    139   1e-33   Solanum lycopersicum
emb|CDY34924.1|  BnaA01g32550D                                          139   1e-33   Brassica napus [oilseed rape]
ref|XP_005844329.1|  hypothetical protein CHLNCDRAFT_59763              138   1e-33   Chlorella variabilis
ref|XP_003078359.1|  putative tetrafunct (ISS)                          140   1e-33   
ref|XP_009147124.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    138   1e-33   Brassica rapa
emb|CDY24662.1|  BnaA05g30610D                                          138   1e-33   Brassica napus [oilseed rape]
ref|XP_007050970.1|  Multifunctional protein 2, putative isoform 1      138   2e-33   
ref|XP_005643487.1|  putative glyoxysomal fatty acid beta-oxidati...    138   2e-33   Coccomyxa subellipsoidea C-169
ref|XP_011082449.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    137   3e-33   
ref|XP_011082447.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    137   5e-33   
ref|XP_011082448.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    137   5e-33   
ref|XP_004148210.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    135   1e-32   
dbj|BAG80663.1|  multifunctional protein                                131   2e-31   
gb|KJB49894.1|  hypothetical protein B456_008G144100                    131   3e-31   
ref|XP_004150500.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    118   7e-30   
ref|XP_007512071.1|  predicted protein                                  128   7e-30   
ref|XP_002977962.1|  hypothetical protein SELMODRAFT_176615             126   2e-29   
ref|XP_002966785.1|  hypothetical protein SELMODRAFT_439712             126   2e-29   
ref|XP_004962328.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    126   4e-29   
ref|XP_004338982.1|  acetylCoA C-acetyltransferase subfamily protein    124   6e-29   
ref|XP_001417042.1|  predicted protein                                  125   7e-29   
gb|EMS59767.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    124   2e-28   
ref|XP_002504050.1|  predicted protein                                  123   3e-28   
ref|XP_008361958.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    114   7e-28   
gb|EMS66784.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    122   8e-28   
ref|XP_001699366.1|  hypothetical protein CHLREDRAFT_132158             121   1e-27   
ref|XP_003054896.1|  predicted protein                                  117   2e-26   
gb|EMT19952.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    117   3e-26   
ref|XP_011398680.1|  Glyoxysomal fatty acid beta-oxidation multif...    117   4e-26   
ref|XP_002949054.1|  hypothetical protein VOLCADRAFT_74021              116   9e-26   
gb|EMT05771.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    114   2e-25   
ref|WP_027731020.1|  hypothetical protein                             98.2    3e-21   
ref|WP_035815975.1|  fatty-acid oxidation protein subunit alpha         102   5e-21   
ref|WP_004579186.1|  fatty oxidation complex alpha subunit              102   7e-21   
ref|WP_028260073.1|  fatty-acid oxidation protein subunit alpha         100   3e-20   
gb|ETR74816.1|  3-hydroxyacyl-CoA dehydrogenase                       99.0    8e-20   
ref|WP_034470091.1|  hypothetical protein                             98.6    9e-20   
gb|KDD75648.1|  3-hydroxyacyl-CoA dehydrogenase                       98.6    1e-19   
ref|WP_027730293.1|  MULTISPECIES: fatty-acid oxidation protein s...  97.8    2e-19   
ref|WP_018904875.1|  3-hydroxyacyl-CoA dehydrogenase                  97.8    2e-19   
gb|KJB72707.1|  hypothetical protein B456_011G191800                  97.8    2e-19   
ref|WP_041931356.1|  fatty-acid oxidation protein subunit alpha       97.1    3e-19   
gb|AEA68310.1|  putative multifunctional fatty acid oxidation com...  97.1    3e-19   
ref|XP_002516945.1|  3-hydroxyacyl-CoA dehyrogenase, putative         96.3    4e-19   
ref|WP_013959065.1|  fatty-acid oxidation protein subunit alpha       95.9    7e-19   
ref|XP_006355813.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  95.9    9e-19   
ref|WP_035022381.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    95.1    2e-18   
ref|WP_039321209.1|  fatty-acid oxidation protein subunit alpha       92.8    7e-18   
ref|WP_022672829.1|  3-hydroxyacyl-CoA dehydrogenase                  92.8    9e-18   
ref|WP_018458274.1|  hypothetical protein                             90.5    1e-17   
gb|AAV32217.1|  putative fatty acid beta-oxidation multifunctiona...  92.0    1e-17   
ref|WP_036133872.1|  3-hydroxyacyl-CoA dehydrogenase                  92.0    2e-17   
dbj|GAC19735.1|  3-hydroxyacyl-CoA dehydrogenase                      91.7    2e-17   
ref|WP_041340659.1|  3-hydroxyacyl-CoA dehydrogenase                  91.7    2e-17   
ref|WP_034899198.1|  3-hydroxyacyl-CoA dehydrogenase                  91.7    2e-17   
ref|WP_039989632.1|  3-hydroxyacyl-CoA dehydrogenase                  91.3    2e-17   
dbj|GAC37336.1|  3-hydroxyacyl-CoA dehydrogenase                      91.7    2e-17   
ref|WP_008177054.1|  3-hydroxyacyl-CoA dehydrogenase                  91.3    2e-17   
gb|KDO71724.1|  hypothetical protein CISIN_1g008576mg                 90.9    3e-17   
ref|WP_026094877.1|  3-hydroxyacyl-CoA dehydrogenase                  91.3    3e-17   
ref|WP_010142012.1|  3-hydroxyacyl-CoA dehydrogenase, NAD-binding     91.3    3e-17   
ref|WP_008940340.1|  fatty oxidation complex alpha subunit            90.9    3e-17   
ref|WP_043342508.1|  fatty-acid oxidation protein subunit alpha       90.9    3e-17   
ref|WP_014249824.1|  3-hydroxyacyl-CoA dehydrogenase                  90.9    3e-17   
ref|WP_041645923.1|  3-hydroxyacyl-CoA dehydrogenase                  90.9    3e-17   
gb|ADP99705.1|  fatty oxidation complex alpha subunit                 90.9    4e-17   
ref|WP_012138386.1|  fatty oxidation complex alpha subunit            90.5    5e-17   
ref|WP_028793041.1|  3-hydroxyacyl-CoA dehydrogenase                  90.1    7e-17   
ref|WP_007669566.1|  3-hydroxyacyl-CoA dehydrogenase                  89.7    9e-17   
ref|WP_042273743.1|  3-hydroxyacyl-CoA dehydrogenase                  89.7    1e-16   
ref|WP_006993799.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    89.4    1e-16   
ref|WP_011574730.1|  3-hydroxyacyl-CoA dehydrogenase                  89.4    1e-16   
ref|WP_008642514.1|  MULTISPECIES: short chain enoyl-CoA hydratas...  89.4    1e-16   
ref|WP_035250311.1|  3-hydroxyacyl-CoA dehydrogenase                  89.4    1e-16   
ref|WP_026377146.1|  3-hydroxyacyl-CoA dehydrogenase                  89.0    2e-16   
dbj|GAM98244.1|  enoyl-CoA hydratase                                  89.0    2e-16   
ref|WP_019560772.1|  3-hydroxyacyl-CoA dehydrogenase                  89.0    2e-16   
ref|WP_007988043.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    89.0    2e-16   
gb|EWM26347.1|  3-hydroxyacyl-CoA dehydrogenase nad-binding protein   89.0    2e-16   
ref|WP_017512090.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    88.6    2e-16   
ref|WP_015931893.1|  3-hydroxyacyl-CoA dehydrogenase                  88.2    3e-16   
ref|WP_014872449.1|  3-hydroxyacyl-CoA dehydrogenase                  88.2    3e-16   
ref|WP_013753694.1|  3-hydroxyacyl-CoA dehydrogenase                  88.2    3e-16   
gb|ETO12139.1|  hypothetical protein RFI_25238                        85.9    3e-16   
ref|WP_018404526.1|  3-hydroxyacyl-CoA dehydrogenase                  87.8    4e-16   
ref|WP_029306557.1|  3-hydroxyacyl-CoA dehydrogenase                  87.8    4e-16   
ref|WP_011519516.1|  3-hydroxyacyl-CoA dehydrogenase                  87.8    4e-16   
ref|WP_006577820.1|  NAD-binding 3-hydroxyacyl-CoA dehydrogenase      87.8    4e-16   
ref|WP_027528013.1|  3-hydroxyacyl-CoA dehydrogenase                  87.4    5e-16   
ref|WP_036202130.1|  3-hydroxyacyl-CoA dehydrogenase                  87.4    5e-16   
ref|WP_007106530.1|  3-hydroxyacyl-CoA dehydrogenase                  87.4    5e-16   
ref|WP_010811694.1|  NAD-binding 3-hydroxyacyl-CoA dehydrogenase      87.0    6e-16   
ref|WP_015443445.1|  putative fatty acid oxidation complex alpha ...  87.0    6e-16   
ref|WP_011866661.1|  3-hydroxyacyl-CoA dehydrogenase                  87.0    7e-16   
ref|WP_031404435.1|  3-hydroxyacyl-CoA dehydrogenase                  86.7    8e-16   
dbj|BAQ48919.1|  3-hydroxyacyl-CoA dehydrogenase                      86.7    1e-15   
ref|WP_027549550.1|  3-hydroxyacyl-CoA dehydrogenase                  86.3    1e-15   
ref|WP_027830456.1|  3-hydroxyacyl-CoA dehydrogenase                  86.3    1e-15   
gb|EJZ30544.1|  3-hydroxyacyl-CoA dehydrogenase                       85.9    2e-15   
ref|WP_029047497.1|  hypothetical protein                             82.0    2e-15   
ref|WP_023008970.1|  3-hydroxyacyl-CoA dehydrogenase                  85.9    2e-15   
ref|XP_007050971.1|  Multifunctional protein 2, putative isoform 2    85.9    2e-15   
ref|WP_028179416.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    85.9    2e-15   
ref|WP_025899532.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    2e-15   
ref|WP_028166754.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    2e-15   
ref|XP_005703692.1|  peroxisomal fatty acid beta-oxidation multif...  86.3    2e-15   
ref|WP_018646807.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    2e-15   
ref|WP_024517657.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    2e-15   
ref|XP_004342583.1|  peroxisomal bifunctional enzyme                  85.5    2e-15   
ref|WP_035883534.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    2e-15   
ref|WP_035711308.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    2e-15   
ref|WP_017512120.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    85.5    3e-15   
ref|WP_037011746.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    3e-15   
ref|WP_024763685.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    3e-15   
ref|WP_011519029.1|  3-hydroxyacyl-CoA dehydrogenase                  85.5    3e-15   
ref|WP_008648532.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_038492239.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_044331727.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_007349479.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_019051910.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_029009055.1|  hypothetical protein                             85.1    3e-15   
ref|WP_026229441.1|  fatty-acid oxidation protein subunit alpha       85.1    3e-15   
ref|WP_025575808.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_008928352.1|  3-hydroxyacyl-CoA dehydrogenase                  85.1    3e-15   
ref|WP_037472207.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    4e-15   
ref|WP_017181722.1|  3-hydroxyacyl-CoA dehydrogenase                  84.7    4e-15   
ref|WP_012827487.1|  3-hydroxyacyl-CoA dehydrogenase                  84.7    4e-15   
ref|WP_028173800.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    84.7    4e-15   
ref|WP_011090545.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    84.7    4e-15   
ref|WP_027543334.1|  3-hydroxyacyl-CoA dehydrogenase                  84.7    4e-15   
ref|WP_008971283.1|  3-hydroxyacyl-CoA dehydrogenase                  84.7    4e-15   
ref|WP_042697813.1|  3-hydroxyacyl-CoA dehydrogenase                  84.7    4e-15   
ref|WP_018912999.1|  hypothetical protein                             84.7    5e-15   
ref|WP_024510808.1|  3-hydroxyacyl-CoA dehydrogenase                  84.7    5e-15   
ref|WP_022985129.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    5e-15   
ref|WP_018454715.1|  hypothetical protein                             83.2    5e-15   
ref|WP_028138568.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    5e-15   
ref|WP_033370966.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    5e-15   
ref|WP_040848868.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    5e-15   
ref|WP_027530245.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    5e-15   
ref|WP_035997962.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    5e-15   
ref|WP_009523682.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    5e-15   
ref|WP_024340580.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    5e-15   
dbj|GAB54826.1|  3-hydroxyacyl-CoA dehydrogenase                      84.3    6e-15   
ref|WP_027575846.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    6e-15   
ref|WP_008965217.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    6e-15   
ref|WP_008135687.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    6e-15   
ref|WP_024006990.1|  3-hydroxyacyl-CoA dehydrogenase                  84.3    6e-15   
ref|WP_027561239.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    84.0    7e-15   
ref|WP_040520219.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_029941276.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_036021523.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_006609555.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_011616775.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_012046885.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_036036767.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_007151322.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    7e-15   
ref|WP_028311032.1|  hypothetical protein                             84.0    8e-15   
ref|WP_009802986.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    8e-15   
ref|WP_013077944.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    8e-15   
ref|WP_029707462.1|  3-hydroxyacyl-CoA dehydrogenase                  84.0    8e-15   
ref|XP_005538607.1|  fusion protein of glyoxysomal fatty acid oxi...  84.3    8e-15   
ref|WP_028151936.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    8e-15   
ref|WP_027582087.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    8e-15   
ref|WP_038957950.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    8e-15   
ref|WP_003302546.1|  enoyl-CoA hydratase                              83.6    9e-15   
ref|WP_028157363.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_039156164.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_044590513.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_019407373.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_033919961.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_014498263.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_006913995.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_015669693.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_025033922.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    9e-15   
ref|WP_009029961.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    1e-14   
ref|WP_025514720.1|  hypothetical protein                             79.7    1e-14   
ref|WP_024688317.1|  3-hydroxybutyryl-CoA epimerase                   83.6    1e-14   
ref|WP_021689539.1|  putative fatty acid oxidation complex alpha ...  83.6    1e-14   
ref|WP_009451635.1|  3-hydroxyacyl-CoA dehydrogenase                  83.6    1e-14   
ref|WP_019963865.1|  hypothetical protein                             83.2    1e-14   
ref|WP_015315085.1|  3-hydroxyacyl-CoA dehydrogenase                  83.2    1e-14   
ref|WP_041097743.1|  3-hydroxyacyl-CoA dehydrogenase                  83.2    1e-14   
gb|EHK66367.1|  short chain enoyl-CoA hydratase / 3-hydroxyacyl-C...  83.2    1e-14   
ref|WP_043518158.1|  3-hydroxyacyl-CoA dehydrogenase                  83.2    1e-14   
gb|EGF31685.1|  Enoyl-CoA hydratase                                   77.4    1e-14   
ref|WP_018262915.1|  3-hydroxyacyl-CoA dehydrogenase                  83.2    1e-14   
ref|WP_012330224.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    1e-14   
ref|WP_027515409.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
gb|KJC47921.1|  3-hydroxyacyl-CoA dehydrogenase                       82.8    2e-14   
emb|CBA26305.1|  Peroxisomal bifunctional enzyme                      82.8    2e-14   
gb|KJC54623.1|  3-hydroxyacyl-CoA dehydrogenase                       82.8    2e-14   
ref|WP_017517683.1|  hypothetical protein                             82.8    2e-14   
ref|WP_014107147.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
ref|WP_007599715.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
ref|WP_007605322.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
ref|WP_014439592.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
gb|AFK63394.1|  multifunctional: 3-hydroxybutyryl-CoA epimerase, ...  77.8    2e-14   
ref|WP_027570168.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
ref|WP_043248038.1|  3-hydroxyacyl-CoA dehydrogenase                  82.8    2e-14   
emb|CBJ27233.1|  enoyl-Coenzyme A hydratase/3-hydroxyacyl Coenzym...  82.8    2e-14   
ref|WP_008842912.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_038446669.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_017875631.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_012565776.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_032857866.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|XP_005718521.1|  Fatty acid beta-oxydation multifunctional pr...  82.8    2e-14   
ref|WP_017245866.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_007155731.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_014595385.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_023784166.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_035867724.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_011911348.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    2e-14   
ref|WP_023771849.1|  MULTISPECIES: 3-hydroxyacyl-CoA dehydrogenase    82.4    2e-14   
ref|WP_028969478.1|  3-hydroxyacyl-CoA dehydrogenase                  82.0    3e-14   
ref|WP_041332951.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    3e-14   
ref|WP_013256921.1|  3-hydroxyacyl-CoA dehydrogenase                  82.4    3e-14   
ref|WP_040038802.1|  3-hydroxyacyl-CoA dehydrogenase                  82.0    3e-14   
ref|WP_007155112.1|  3-hydroxyacyl-CoA dehydrogenase                  82.0    3e-14   
ref|WP_018063907.1|  hypothetical protein                             78.2    3e-14   
ref|WP_028093795.1|  3-hydroxyacyl-CoA dehydrogenase                  82.0    3e-14   
ref|WP_016847572.1|  hypothetical protein                             81.6    3e-14   
ref|WP_019140936.1|  3-hydroxyacyl-CoA dehydrogenase                  81.6    4e-14   
ref|WP_043312557.1|  3-hydroxyacyl-CoA dehydrogenase                  81.6    4e-14   
ref|WP_041231213.1|  3-hydroxyacyl-CoA dehydrogenase                  81.6    4e-14   
ref|WP_041558827.1|  3-hydroxyacyl-CoA dehydrogenase                  81.6    4e-14   
emb|CCA92170.1|  3-hydroxyacyl-CoA dehydrogenase NAD-binding          81.6    4e-14   
ref|WP_012137998.1|  3-hydroxyacyl-CoA dehydrogenase                  81.6    4e-14   
gb|AFZ66759.1|  3-hydroxyacyl-CoA dehydrogenase                       81.6    4e-14   



>gb|AFS41246.1| cinnamoyl-CoA hydratase-dehydrogenase [Petunia x hybrida]
Length=724

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 2/163 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA +DRT++SPL+DLLIKSGRNGKNNGKG+YIYEKGSKP+PD SVLP++E+SRRLT
Sbjct  548  KEFGSAFSDRTFKSPLIDLLIKSGRNGKNNGKGFYIYEKGSKPRPDLSVLPIIEESRRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGI  205
            V+WADTVGA HIY SL KWSELY  GNFFKPSRFLEERA KGI
Sbjct  668  VFWADTVGAGHIYKSLTKWSELY--GNFFKPSRFLEERATKGI  708



>ref|XP_009608928.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nicotiana tomentosiformis]
Length=724

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA  DRT++SPLLDLLIKSGRNGKNNGKGYYIY+KG KPKPDPSVLP++E+SRRLT
Sbjct  548  KEFASAFPDRTFKSPLLDLLIKSGRNGKNNGKGYYIYKKGEKPKPDPSVLPIIEESRRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP+SVTDQEIVEMILFPVVNEACRVL++G+VVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPLSVTDQEIVEMILFPVVNEACRVLEDGVVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA HIY SLKKWSELY  GNFFKPSRFLEERA  GI L
Sbjct  668  VFWADTVGAGHIYKSLKKWSELY--GNFFKPSRFLEERAANGIPL  710



>ref|XP_009766308.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
Length=724

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA +DRT++SPL+DLLIKSGRNGKNNGKGYYIYEKG KP+PD +VLP+VE+SRRLT
Sbjct  548  KEFGSAFSDRTFKSPLIDLLIKSGRNGKNNGKGYYIYEKGRKPRPDFTVLPIVEESRRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA HIY SLKKWSELY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADTVGAGHIYRSLKKWSELY--GNFFKPSRFLEERATKGIPL  710



>gb|AFK48400.1| unknown [Lotus japonicus]
Length=181

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT+++ LL+LLIKSGRNGKNNGKGYY+YEKGSKPKPD S+LP +E+SRRL 
Sbjct  5    KEFTTAFPDRTFRTTLLELLIKSGRNGKNNGKGYYVYEKGSKPKPDASILPTIEESRRLC  64

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTDQEIVEMILFP+VNE+CR+L+EG+V+RASDLD+AS+LGMSFPSYRGGI
Sbjct  65   NIMPGGKPISVTDQEIVEMILFPIVNESCRILEEGVVIRASDLDIASVLGMSFPSYRGGI  124

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA H+Y+SLKKW+ELY  GNFFKPSR+LEERALKGI L
Sbjct  125  VFWADMVGANHVYSSLKKWTELY--GNFFKPSRYLEERALKGIPL  167



>ref|XP_009803575.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nicotiana sylvestris]
Length=725

 Score =   250 bits (638),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 2/163 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA  DRT++SP+LDLLIKSGRNGKNNGKGYYIY+KG KPKPDPSVLP++E+SRRLT
Sbjct  548  KEFASAFPDRTFKSPMLDLLIKSGRNGKNNGKGYYIYKKGEKPKPDPSVLPIIEESRRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTDQEIVEMILFPVVNEACRVL++G+VVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLEDGVVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGI  205
            V+WADTVGA HIY SLKKWSELY  GNFFKPSRFLEERA  G+
Sbjct  668  VFWADTVGADHIYKSLKKWSELY--GNFFKPSRFLEERAANGV  708



>ref|XP_004242934.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum lycopersicum]
Length=723

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA +DRT++SPL+DLLIKSGRNGKNNGKGYYIYEKG KP+PD +VLP++E+SRRL 
Sbjct  548  KEFRSAFSDRTFKSPLIDLLIKSGRNGKNNGKGYYIYEKGRKPRPDFTVLPIIEESRRLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPIS+TDQEIVEMILFPVVNEACRVLDEGIVVRASDLDV S+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISITDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVTSVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA HIY SLKKWSELY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADTVGAGHIYRSLKKWSELY--GNFFKPSRFLEERATKGIPL  710



>ref|XP_004251613.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Solanum lycopersicum]
Length=724

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA  DR + SPLLDLLIKSGRNGKNNGKGYYIY+KG KP+PDPSVLP++E+SRRLT
Sbjct  548  KEYSSAFPDRVFMSPLLDLLIKSGRNGKNNGKGYYIYKKGEKPRPDPSVLPIIEESRRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPIS+TDQEIVEMILFPVVNEACRVLDEG+VVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISITDQEIVEMILFPVVNEACRVLDEGVVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+W DTVGA HIY SL+KWSE+Y  GNFFKPS+FLEERA KGI L
Sbjct  668  VFWGDTVGAGHIYKSLRKWSEVY--GNFFKPSKFLEERAAKGIPL  710



>ref|XP_006352155.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Solanum tuberosum]
Length=724

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 152/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA +DRT++SPL+DLLIKSGRNGKNNGKGYYIYEKGSKP+PD +VLP++E+SR+L 
Sbjct  548  KEFRSAFSDRTFKSPLIDLLIKSGRNGKNNGKGYYIYEKGSKPRPDFTVLPIIEESRKLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDV S+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVTSVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA +IY SLKKWSELY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADTVGAGYIYRSLKKWSELY--GNFFKPSRFLEERATKGIPL  710



>ref|XP_009595622.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana tomentosiformis]
Length=724

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 152/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA +DRT++SPL++LLIKSGRNGKNNGKGYYIYEKG KP+PD +VLP++E+SRRLT
Sbjct  548  KEFGSAFSDRTFKSPLINLLIKSGRNGKNNGKGYYIYEKGRKPRPDFTVLPIIEESRRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NVMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA  IY SLKKWSELY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADTVGAGRIYRSLKKWSELY--GNFFKPSRFLEERATKGIPL  710



>ref|XP_009371481.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Pyrus x bretschneideri]
Length=197

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K L  A  DRT++SPL+++LIK+GRNGKNNGKGYYIY KGSKPKPD SVLPL+E+SRR+T
Sbjct  21   KELSRAFPDRTFKSPLVEILIKNGRNGKNNGKGYYIYAKGSKPKPDFSVLPLIEESRRVT  80

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP++VTDQEI+EM+LFP VNEACR+LDEGIV+RA+DLD+AS+LGMSFPSYRGGI
Sbjct  81   NIMPGGKPLTVTDQEILEMMLFPAVNEACRILDEGIVIRAADLDIASVLGMSFPSYRGGI  140

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  HIY SLKKWS LY  GNFFKPSRFLEERA KG+ L
Sbjct  141  VFWADQVGPKHIYASLKKWSGLY--GNFFKPSRFLEERATKGLPL  183



>ref|XP_003620604.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Medicago truncatula]
 gb|AES76822.1| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=722

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    + A RT+ +PLLDLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSVLP+VE+SRRL+
Sbjct  546  KEFAGSFAGRTFPTPLLDLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSVLPIVEESRRLS  605

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPIS+TDQEIVEMILFPVVNEACRVL+EGIV+RASDLD+AS+LGMSFPSYRGGI
Sbjct  606  NIMPNGKPISITDQEIVEMILFPVVNEACRVLEEGIVIRASDLDIASVLGMSFPSYRGGI  665

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIY+SLKKWS+LY  GNF+KPSR+LEERA KGI L
Sbjct  666  VFWADLVGAKHIYSSLKKWSQLY--GNFYKPSRYLEERATKGIPL  708



>gb|KDO42235.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=563

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  387  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  446

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLD AS+LGMSFPSYRGGI
Sbjct  447  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDDASVLGMSFPSYRGGI  506

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  507  VFWADAVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  549



>ref|XP_006451189.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
 gb|ESR64429.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
Length=703

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  527  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  586

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLDVAS+LGMSFPSYRGGI
Sbjct  587  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDVASVLGMSFPSYRGGI  646

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  647  VFWADVVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  689



>ref|XP_006353465.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum tuberosum]
Length=724

 Score =   241 bits (615),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 148/161 (92%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA  DR ++SPLLDLLIKSGRNGKNNGKGYYIY+KG K +PDPSVLP++E+SRRLTNIMP
Sbjct  552  SAFPDRIFKSPLLDLLIKSGRNGKNNGKGYYIYKKGEKARPDPSVLPIIEESRRLTNIMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPIS+TDQEIVEMILFPVVNEACRVLDEG+V+R SDLDVAS+LGMSFPSYRGGIV+W 
Sbjct  612  GGKPISITDQEIVEMILFPVVNEACRVLDEGVVIRPSDLDVASVLGMSFPSYRGGIVFWG  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DTVGA HIY SL+KWSELY  GNFFKPS+FLEERA KGI L
Sbjct  672  DTVGAGHIYKSLRKWSELY--GNFFKPSKFLEERAAKGIPL  710



>ref|XP_006451188.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
 gb|ESR64428.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
Length=724

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  548  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLDVAS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDVASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADVVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  710



>ref|XP_002514279.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
 gb|EEF48233.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
Length=724

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 152/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL+DLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSV+P++++S+RLT
Sbjct  548  KEFATAFPDRTFKSPLVDLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSVIPIIQESQRLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPIS++DQEIVEMI FP+VNEACRVL+EG+VVRASDLD+AS+LGMSFPSYRGGI
Sbjct  608  NIMPNGKPISISDQEIVEMIFFPIVNEACRVLEEGVVVRASDLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVG  HIYTSLKKWS LY  GNF+KPSRFLEERALKG+ L
Sbjct  668  VFWADTVGPKHIYTSLKKWSLLY--GNFYKPSRFLEERALKGMPL  710



>gb|KHN45635.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Glycine soja]
Length=724

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A +DR ++SPLLDLLIKSGRNGKNNGKGYYIYEK  KPKPDPS+LP++E+SRRL 
Sbjct  548  KVFADAFSDRIFKSPLLDLLIKSGRNGKNNGKGYYIYEKAGKPKPDPSILPIIEESRRLC  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPISVTDQEIVEMILFPVVNEACRVL++G+V+RASDLD+AS+LGMSFP+YRGGI
Sbjct  608  NIMPNGKPISVTDQEIVEMILFPVVNEACRVLEDGVVIRASDLDIASVLGMSFPNYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIYTSLKKW++LY  GNF+KPSR+LEERALKGI L
Sbjct  668  VFWADLVGANHIYTSLKKWAQLY--GNFYKPSRYLEERALKGIPL  710



>ref|XP_003534202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Glycine max]
Length=724

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A +DR ++SPLLDLLIKSGRNGKNNGKGYYIYEK  KPKPDPS+LP++E+SRRL 
Sbjct  548  KVFADAFSDRIFKSPLLDLLIKSGRNGKNNGKGYYIYEKAGKPKPDPSILPIIEESRRLC  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPISVTDQEIVEMILFPVVNEACRVL++G+V+RASDLD+AS+LGMSFP+YRGGI
Sbjct  608  NIMPNGKPISVTDQEIVEMILFPVVNEACRVLEDGVVIRASDLDIASVLGMSFPNYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIYTSLKKW++LY  GNF+KPSR+LEERALKGI L
Sbjct  668  VFWADLVGANHIYTSLKKWAQLY--GNFYKPSRYLEERALKGIPL  710



>ref|XP_007152846.1| hypothetical protein PHAVU_004G164800g [Phaseolus vulgaris]
 gb|ESW24840.1| hypothetical protein PHAVU_004G164800g [Phaseolus vulgaris]
Length=724

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 152/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A +DR ++SPLLDLLIKSGRNGKNNGKGYYIYEKGSKPKPDPS+LP++E+SRR+ 
Sbjct  548  KVFADAFSDRVFKSPLLDLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSILPIIEESRRVC  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPISVTDQEIVEMILFPVVNEACRVL++G+V+RASDLD+AS+LGMSFP+YRGGI
Sbjct  608  NIMPNGKPISVTDQEIVEMILFPVVNEACRVLEDGVVIRASDLDIASVLGMSFPNYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIYTSLKKW++LY  GNF+KPS++LEERALKGI L
Sbjct  668  VFWADLVGANHIYTSLKKWTQLY--GNFYKPSKYLEERALKGIPL  710



>gb|KDO42232.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=733

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  548  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLD AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDDASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADAVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  710



>gb|KDO42231.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=721

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  545  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLD AS+LGMSFPSYRGGI
Sbjct  605  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDDASVLGMSFPSYRGGI  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  665  VFWADAVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  707



>gb|KDO42229.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
 gb|KDO42230.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=724

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  548  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLD AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDDASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADAVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  710



>ref|XP_006475648.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Citrus sinensis]
Length=724

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  548  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLD AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDDASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  668  VFWADVVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  710



>ref|XP_003528905.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Glycine max]
Length=724

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A +DR ++SPLLDLLIKSGRNGKNNGKGYYIYEKG KPKPDPS+LP++E+SRRL 
Sbjct  548  KVFADAFSDRIFKSPLLDLLIKSGRNGKNNGKGYYIYEKGGKPKPDPSILPIIEESRRLC  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPIS+TDQEIVEMILFPVVNEACRVL++G+V+RASDLD+AS+LGMSFP+YRGGI
Sbjct  608  NIMPNGKPISITDQEIVEMILFPVVNEACRVLEDGVVIRASDLDIASVLGMSFPNYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HI+TSLKKW++LY  GNF+KPSR+LEERALKGI L
Sbjct  668  VFWADLVGANHIFTSLKKWAQLY--GNFYKPSRYLEERALKGIPL  710



>gb|AHB60730.1| 3-hydroxyacyl-CoA dehydrogenase [Populus x canadensis]
Length=335

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT+QSPL+DLL+KSGRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL 
Sbjct  159  KEFANAFPDRTFQSPLIDLLVKSGRNGKTNGKGYYIYEKGSKPRPDPSVLPIIEESRRLA  218

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPI++TD+EIVEM+LFPVVNEACRVLDEG+VVRASDLD AS+LGMSFPSYRGGI
Sbjct  219  NIMPNGKPINITDKEIVEMVLFPVVNEACRVLDEGVVVRASDLDTASVLGMSFPSYRGGI  278

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  H+Y SLKKWS+ +  G+F+KPS+FLEERA  GI L
Sbjct  279  VFWADLVGPKHVYDSLKKWSQRF--GDFYKPSKFLEERATGGIPL  321



>gb|KHN20673.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Glycine soja]
Length=724

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A +DR ++SPLLDLLIKSGRNGKNNGKGYYIYEKG KPKPDPS+LP++E+SRRL 
Sbjct  548  KVFADAFSDRIFKSPLLDLLIKSGRNGKNNGKGYYIYEKGGKPKPDPSILPIIEESRRLC  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPIS+TDQEIVEMILFPVVNEACRVL++G+V+RASDLD+AS+LGMSFP+YRGGI
Sbjct  608  NIMPNGKPISITDQEIVEMILFPVVNEACRVLEDGVVIRASDLDIASVLGMSFPNYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HI+TSLKKW++LY  GNF+KPSR+LEERALKGI L
Sbjct  668  VFWADLVGANHIFTSLKKWAQLY--GNFYKPSRYLEERALKGIPL  710



>gb|ABK96102.1| unknown [Populus trichocarpa]
Length=335

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -2

Query  696  EKNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRL  517
            EK   +A  DRT+QSPL+ LL+KSGRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL
Sbjct  158  EKEFANAFPDRTFQSPLIHLLVKSGRNGKTNGKGYYIYEKGSKPRPDPSVLPIIEESRRL  217

Query  516  TNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGG  337
             NIMP GKPI++TD+EIVEM+LFPVVNEACRVLDEG+VVRASDLD AS+LGMSFPSYRGG
Sbjct  218  ANIMPNGKPINITDKEIVEMVLFPVVNEACRVLDEGVVVRASDLDTASVLGMSFPSYRGG  277

Query  336  IVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            IV+WAD VG  H+Y SLKKWS+ +  G+F+KPS+FLEERA  GI L
Sbjct  278  IVFWADLVGPKHVYDSLKKWSQRF--GDFYKPSKFLEERATGGIPL  321



>gb|KJB27144.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
 gb|KJB27145.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
Length=643

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A +DR ++SPLL+LL+K GRNGKNNGKGYYIYEKGSKPKPDPSVL ++E+SRRLTN+MPG
Sbjct  472  AFSDRIFESPLLELLVKEGRNGKNNGKGYYIYEKGSKPKPDPSVLSIIEESRRLTNVMPG  531

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+E++EMILFPVVNEACRVLDEG+VVRASDLDVAS+LGMSFPSYRGGIV+WAD
Sbjct  532  GKPISVTDREVLEMILFPVVNEACRVLDEGVVVRASDLDVASVLGMSFPSYRGGIVFWAD  591

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
             VGA H+Y SLKKWSE+Y  G+F+KPS+FLEERA+KGI L
Sbjct  592  MVGANHVYRSLKKWSEMY--GSFYKPSKFLEERAMKGIPL  629



>ref|XP_011078309.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Sesamum indicum]
Length=724

 Score =   236 bits (603),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 149/157 (95%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RT++SPL+ LLIK+GRNGK+NGKGYYIYE+GSKPKPDPSVLP++E+SRRLTNIMPGGKP
Sbjct  556  ERTFESPLVKLLIKNGRNGKSNGKGYYIYERGSKPKPDPSVLPIIEESRRLTNIMPGGKP  615

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            ISVTD+EIVEMILFPVVNEACRVLD+G+VVRASDLD+AS+LGMSFPSYRGGI++WADT+G
Sbjct  616  ISVTDEEIVEMILFPVVNEACRVLDDGVVVRASDLDIASVLGMSFPSYRGGIIFWADTIG  675

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A  +Y SL+KWSELY  GNFF+PSRFLEERA +GI L
Sbjct  676  ANRVYRSLQKWSELY--GNFFRPSRFLEERATRGIPL  710



>gb|KJB27143.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
Length=724

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A +DR ++SPLL+LL+K GRNGKNNGKGYYIYEKGSKPKPDPSVL ++E+SRRLTN+MPG
Sbjct  553  AFSDRIFESPLLELLVKEGRNGKNNGKGYYIYEKGSKPKPDPSVLSIIEESRRLTNVMPG  612

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+E++EMILFPVVNEACRVLDEG+VVRASDLDVAS+LGMSFPSYRGGIV+WAD
Sbjct  613  GKPISVTDREVLEMILFPVVNEACRVLDEGVVVRASDLDVASVLGMSFPSYRGGIVFWAD  672

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
             VGA H+Y SLKKWSE+Y  G+F+KPS+FLEERA+KGI L
Sbjct  673  MVGANHVYRSLKKWSEMY--GSFYKPSKFLEERAMKGIPL  710



>gb|EYU29809.1| hypothetical protein MIMGU_mgv1a002065mg [Erythranthe guttata]
Length=720

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 150/157 (96%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            DRT++SPLL+LLI++GRNGK NGKGYY+YEKGSKPKPD SVLP++E+SRRLTN+MPGGKP
Sbjct  552  DRTFESPLLNLLIQNGRNGKCNGKGYYVYEKGSKPKPDSSVLPVIEESRRLTNVMPGGKP  611

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            ISVTD+EIV+MILFPVVNEACRVLD+GIV+RASDLDVAS+LGMSFPSYRGG+++WADT+G
Sbjct  612  ISVTDEEIVKMILFPVVNEACRVLDDGIVIRASDLDVASILGMSFPSYRGGVIFWADTIG  671

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A H+YTSL+KWS+LY  GNFF+PS+FLEERA +GI L
Sbjct  672  ADHVYTSLEKWSKLY--GNFFRPSKFLEERAKRGIPL  706



>gb|KDO42228.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=725

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 148/166 (89%), Gaps = 3/166 (2%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR++QSPL+DLL+KSGRNGK NGKG Y YEKGSKPKPDPSVLP++E+ RRL+
Sbjct  548  KEFDKAFPDRSFQSPLVDLLLKSGRNGKANGKGLYTYEKGSKPKPDPSVLPIIEECRRLS  607

Query  513  NIMPGGK-PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGG  337
            NIMPGGK PISVT++EIVEMILFPVVNE+CRVL+EGIVVRASDLD AS+LGMSFPSYRGG
Sbjct  608  NIMPGGKVPISVTEKEIVEMILFPVVNESCRVLEEGIVVRASDLDDASVLGMSFPSYRGG  667

Query  336  IVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            IV+WAD VGA ++YTSLKKWS+LY  GNFFKPSRFLEERA KGI L
Sbjct  668  IVFWADAVGANYVYTSLKKWSQLY--GNFFKPSRFLEERATKGIPL  711



>ref|XP_004512985.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Cicer arietinum]
Length=655

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA  DRT Q+PL+DL+IKSGRNGKNNGKGYY YEKGSKPKPD SVLP++E+SRRL+
Sbjct  479  KEFSSAFPDRTLQTPLVDLMIKSGRNGKNNGKGYYTYEKGSKPKPDLSVLPIIEESRRLS  538

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MP GK +SVTDQEIVEMILFPVVNEACRVL+EG+V+RASDLD+AS+LGMSFPSYRGGI
Sbjct  539  NLMPSGKALSVTDQEIVEMILFPVVNEACRVLEEGVVIRASDLDIASVLGMSFPSYRGGI  598

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIY SL+KW++LY  GNF+KPSR+LEERA KGI L
Sbjct  599  VFWADLVGANHIYNSLQKWTQLY--GNFYKPSRYLEERATKGIPL  641



>ref|XP_007204255.1| hypothetical protein PRUPE_ppa002052mg [Prunus persica]
 gb|EMJ05454.1| hypothetical protein PRUPE_ppa002052mg [Prunus persica]
Length=724

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL+++LIK GRNGKNNGKGYYIYEKGSKPKPD SVLP++E+SRR+T
Sbjct  548  KEFATAFPDRTFRSPLVEILIKHGRNGKNNGKGYYIYEKGSKPKPDLSVLPIIEESRRVT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP+SVTDQEI+EMILFPVVNEACR+LDEGIVVRASDLD+AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPLSVTDQEILEMILFPVVNEACRILDEGIVVRASDLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD VG  HIY SLKKWS +Y  GNF++PSRFLEERA+KG+ L
Sbjct  668  IFWADLVGPKHIYDSLKKWSGVY--GNFYRPSRFLEERAMKGVPL  710



>ref|XP_007013128.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
 gb|EOY30747.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
Length=724

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL++LL+KSGRNGKNNGKGYYIYEKGSKPKPDPSVLP++E+ R+ T
Sbjct  548  KEFANAFPDRTFRSPLIELLVKSGRNGKNNGKGYYIYEKGSKPKPDPSVLPIIEECRKHT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             IMP GKPISV+D+EI+EM+LFPVVNEACRVLDEG+VVRASDLD+AS+LGMSFPSYRGG+
Sbjct  608  KIMPNGKPISVSDKEILEMVLFPVVNEACRVLDEGVVVRASDLDIASVLGMSFPSYRGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA H+Y SLKKWSE+Y  G+F+KPS+FLEERALKGI L
Sbjct  668  VFWADTVGANHVYKSLKKWSEMY--GSFYKPSKFLEERALKGIPL  710



>emb|CDP03312.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 148/161 (92%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA A RT++S L+DLLIK+GRNGK+N KGYYIY+KGSK KPDPSVLP++++SR+L N+MP
Sbjct  552  SAFAGRTFESSLVDLLIKNGRNGKSNRKGYYIYQKGSKAKPDPSVLPIIDESRKLANLMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPISVTDQE+VEMILFPVVNE+CRVLDEGIV+RASDLDVAS+LGMSFP+YRGGIV+WA
Sbjct  612  GGKPISVTDQEVVEMILFPVVNESCRVLDEGIVIRASDLDVASVLGMSFPTYRGGIVFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +IY  LKKWSE Y  GNF+KPSRFLEERAL+GI L
Sbjct  672  DTIGADYIYKKLKKWSEAY--GNFYKPSRFLEERALRGIPL  710



>ref|XP_004512984.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Cicer arietinum]
Length=724

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA  DRT Q+PL+DL+IKSGRNGKNNGKGYY YEKGSKPKPD SVLP++E+SRRL+
Sbjct  548  KEFSSAFPDRTLQTPLVDLMIKSGRNGKNNGKGYYTYEKGSKPKPDLSVLPIIEESRRLS  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MP GK +SVTDQEIVEMILFPVVNEACRVL+EG+V+RASDLD+AS+LGMSFPSYRGGI
Sbjct  608  NLMPSGKALSVTDQEIVEMILFPVVNEACRVLEEGVVIRASDLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIY SL+KW++LY  GNF+KPSR+LEERA KGI L
Sbjct  668  VFWADLVGANHIYNSLQKWTQLY--GNFYKPSRYLEERATKGIPL  710



>ref|XP_008242673.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Prunus mume]
Length=724

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL+++LIK GRNGKNNGKGYYIY KGSKPKPD SVLP++E+SRR+T
Sbjct  548  KEFATAFPDRTFRSPLVEILIKHGRNGKNNGKGYYIYVKGSKPKPDLSVLPIIEESRRVT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP+SVTDQEI+EMILFPVVNEACR+LDEGI VRASDLD+AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPLSVTDQEILEMILFPVVNEACRILDEGIAVRASDLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD VG  HIY SLKKWS +Y  GNF++PSRFLEERA+KG+ L
Sbjct  668  IFWADLVGPKHIYDSLKKWSGVY--GNFYRPSRFLEERAMKGVPL  710



>gb|KJB64950.1| hypothetical protein B456_010G073100 [Gossypium raimondii]
Length=557

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DRT++SPL +LL+K+GRNGK+NGKG+Y++EKGSKPKPDPSVLP+V++SR+L NIMPG
Sbjct  384  AFPDRTFRSPLTELLLKNGRNGKSNGKGFYVHEKGSKPKPDPSVLPIVDESRKLMNIMPG  443

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EI EM+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSY GGI++WAD
Sbjct  444  GKPISVTDEEITEMVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYCGGIMFWAD  503

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG+ HIY SLKKWSE+Y  G++FKPSR+LEERA+KGI L
Sbjct  504  TVGSKHIYLSLKKWSEMY--GSYFKPSRYLEERAMKGIPL  541



>ref|XP_008337363.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=724

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DRT++SPL+++LIK+GRNGKNNGKGYYIYEKGSKPKPDPSVLPL+E+SRR+T
Sbjct  548  KEFSGAFPDRTFRSPLVEILIKNGRNGKNNGKGYYIYEKGSKPKPDPSVLPLIEESRRVT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP++VTDQ+I+E+ILFPVVNEACR+LDEGIV+RA+DLD+AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPLTVTDQDILEVILFPVVNEACRILDEGIVIRAADLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            V+WAD VG  HIY SLKKWS +Y  GNFFKPSRFLEERA +G
Sbjct  668  VFWADLVGPKHIYASLKKWSGVY--GNFFKPSRFLEERATRG  707



>gb|KJB64949.1| hypothetical protein B456_010G073100 [Gossypium raimondii]
Length=563

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DRT++SPL +LL+K+GRNGK+NGKG+Y++EKGSKPKPDPSVLP+V++SR+L NIMPG
Sbjct  390  AFPDRTFRSPLTELLLKNGRNGKSNGKGFYVHEKGSKPKPDPSVLPIVDESRKLMNIMPG  449

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EI EM+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSY GGI++WAD
Sbjct  450  GKPISVTDEEITEMVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYCGGIMFWAD  509

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG+ HIY SLKKWSE+Y  G++FKPSR+LEERA+KGI L
Sbjct  510  TVGSKHIYLSLKKWSEMY--GSYFKPSRYLEERAMKGIPL  547



>gb|KDP33693.1| hypothetical protein JCGZ_07264 [Jatropha curcas]
Length=718

 Score =   231 bits (588),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT+ SPL++LLIKSGRNGKN+GKGYYI+EKG KPKPDPSVLP++E+ RRLT
Sbjct  541  KEFANAFPDRTFSSPLVELLIKSGRNGKNSGKGYYIHEKGRKPKPDPSVLPIIEECRRLT  600

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPI++TDQEI+EM+LFPVVNEACRVLDE +VVRASDLD AS+LGMSFPSYRGGI
Sbjct  601  NIMPNGKPINITDQEILEMVLFPVVNEACRVLDERVVVRASDLDTASVLGMSFPSYRGGI  660

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VGA HIY SLKKWS+ Y  GNF+KPS++LEERALKG+ L
Sbjct  661  VFWADLVGAKHIYASLKKWSQSY--GNFYKPSKYLEERALKGMPL  703



>ref|XP_007013129.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
 gb|EOY30748.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
Length=745

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL +LL+K+GRNGK+NGKG+YIYEKGS+PKPDPSVLP++E+SR+L 
Sbjct  569  KEFANAFPDRTFRSPLTELLLKNGRNGKSNGKGFYIYEKGSRPKPDPSVLPIIEESRQLM  628

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTD+EI+EM+LFP VNEAC VLDEG+V RASDLDVAS+LGMSFPSYRGGI
Sbjct  629  NIMPGGKPISVTDKEILEMLLFPAVNEACLVLDEGVVARASDLDVASVLGMSFPSYRGGI  688

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADTVG+ HIYTSLK+WSE+Y  G+FFKPSRFLEERA+KG+ L
Sbjct  689  MFWADTVGSNHIYTSLKRWSEIY--GSFFKPSRFLEERAVKGMPL  731



>ref|XP_006352154.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Solanum tuberosum]
Length=749

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 139/190 (73%), Gaps = 27/190 (14%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekG--------------------  574
            K   SA +DRT++SPL+DLLIKSGRNG                                 
Sbjct  548  KEFRSAFSDRTFKSPLIDLLIKSGRNGNVASLYLLCCCFTVLLFTIDTGFAGKNNGKGYY  607

Query  573  -----SKPKPDPSVLPLVEQSRRLTNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEG  409
                 SKP+PD +VLP++E+SR+L NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEG
Sbjct  608  IYEKGSKPRPDFTVLPIIEESRKLANIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEG  667

Query  408  IVVRASDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFL  229
            IVVRASDLDV S+LGMSFPSYRGGIV+WADTVGA +IY SLKKWSELY  GNFFKPSRFL
Sbjct  668  IVVRASDLDVTSVLGMSFPSYRGGIVFWADTVGAGYIYRSLKKWSELY--GNFFKPSRFL  725

Query  228  EERALKGIRL  199
            EERA KGI L
Sbjct  726  EERATKGIPL  735



>dbj|BAD93971.1| AIM1 protein [Arabidopsis thaliana]
Length=163

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = -2

Query  660  YQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKPISV  481
            ++SP+ +LL+KSGRNGK NG+GYYIYEKGSKPKPDPSVL +VE+SR+LTNIMPGGKPISV
Sbjct  2    FRSPMTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSIVEKSRKLTNIMPGGKPISV  61

Query  480  TDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVGAMH  301
            TD+EIVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WADTVG  +
Sbjct  62   TDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADTVGPKY  121

Query  300  IYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            IY  LKK SE Y  G+FFKPSR+LEERA+ G+ L
Sbjct  122  IYERLKKLSETY--GSFFKPSRYLEERAMNGMLL  153



>ref|XP_010254066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nelumbo nucifera]
Length=727

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   ++  DR ++SPL+DLL+KSGRNGKNNGKGYY +EKGSKPKPDPSV+P++E+ RRL+
Sbjct  548  KEFATSFPDRAFKSPLVDLLVKSGRNGKNNGKGYYTFEKGSKPKPDPSVVPIIEEFRRLS  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPI+V+DQEIVEM+LFPVVNEACRVLDE +VVRASDLD+AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPITVSDQEIVEMVLFPVVNEACRVLDERVVVRASDLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYG-IGNFFKPSRFLEERALKGIRL  199
            V+WAD++G+ +IY+SLKKWSE YG +  FFKP RFLEERA KG+ L
Sbjct  668  VFWADSIGSGYIYSSLKKWSETYGSVSGFFKPCRFLEERAAKGMPL  713



>ref|XP_002324426.2| hypothetical protein POPTR_0018s08940g [Populus trichocarpa]
 gb|EEF02991.2| hypothetical protein POPTR_0018s08940g [Populus trichocarpa]
Length=763

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -2

Query  696  EKNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRL  517
            EK   +A  DRT+QSPL+ LL+KSGRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL
Sbjct  586  EKEFANAFPDRTFQSPLIHLLVKSGRNGKTNGKGYYIYEKGSKPRPDPSVLPIIEESRRL  645

Query  516  TNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGG  337
             NIMP GKPI++TD+EIVEM+LFPVVNEACRVLDEG+VVRASDLD AS+LGMSFPSYRGG
Sbjct  646  ANIMPNGKPINITDKEIVEMVLFPVVNEACRVLDEGVVVRASDLDTASVLGMSFPSYRGG  705

Query  336  IVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            IV+WAD VG  H+Y SLKKWS+ +  G+F+KPS+FLEERA  GI L
Sbjct  706  IVFWADLVGPKHVYDSLKKWSQRF--GDFYKPSKFLEERATGGIPL  749



>gb|KJB64948.1| hypothetical protein B456_010G073100 [Gossypium raimondii]
Length=723

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DRT++SPL +LL+K+GRNGK+NGKG+Y++EKGSKPKPDPSVLP+V++SR+L NIMPG
Sbjct  550  AFPDRTFRSPLTELLLKNGRNGKSNGKGFYVHEKGSKPKPDPSVLPIVDESRKLMNIMPG  609

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EI EM+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSY GGI++WAD
Sbjct  610  GKPISVTDEEITEMVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYCGGIMFWAD  669

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG+ HIY SLKKWSE+Y  G++FKPSR+LEERA+KGI L
Sbjct  670  TVGSKHIYLSLKKWSEMY--GSYFKPSRYLEERAMKGIPL  707



>ref|XP_010089223.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB37512.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=724

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SP+++LL+KSGRNGKNNGKGYYIYEKGS+PKPDP +LP++E+SR+LT
Sbjct  548  KVFANAFPDRTFKSPIIELLLKSGRNGKNNGKGYYIYEKGSRPKPDPKILPVLEESRQLT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTDQEI+EMILFPVVNEACRVL+E +VVRASDLD+A++ GMSFPSYRGGI
Sbjct  608  NIMPGGKPISVTDQEILEMILFPVVNEACRVLEEEVVVRASDLDIAAVFGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            VYWAD VGA HIY+SLKKWS+ Y  G+F+KPSRFLEERA +G+ L
Sbjct  668  VYWADAVGAKHIYSSLKKWSDKY--GSFYKPSRFLEERATRGVLL  710



>ref|XP_004287395.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Fragaria vesca subsp. vesca]
Length=723

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   S+  DRT++SPL++LL+K+GRNGKNNGKGYY YEKGSKPKPD SVLP++E+SRR+T
Sbjct  548  KEFASSFPDRTFKSPLVELLVKNGRNGKNNGKGYYTYEKGSKPKPDLSVLPIIEESRRIT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MPGGKP+SVTDQEI+E+ILFPVVNEACR+LDEG+V+RA+DLD+AS+LGMSFPSYRGGI
Sbjct  608  NMMPGGKPLSVTDQEILEIILFPVVNEACRILDEGVVIRAADLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            V+WAD VG  HIY +LKKWS +Y  G+FFKPSRFLEERA+KG
Sbjct  668  VFWADLVGPKHIYATLKKWSGVY--GDFFKPSRFLEERAMKG  707



>ref|XP_010089224.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB37513.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=702

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  ++A  +RT++SPL++LL++SGRNGKNNGKGYYIYEKGS+PKPD ++LP++E+SR+LT
Sbjct  526  KEFINAFPERTFKSPLIELLVQSGRNGKNNGKGYYIYEKGSQPKPDLTILPIIEESRQLT  585

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPG KPISVTDQEIVEMILFPVVNEACRVL+EGIVVRASDLD+AS+LGMSFPSYRGGI
Sbjct  586  NIMPGKKPISVTDQEIVEMILFPVVNEACRVLEEGIVVRASDLDIASVLGMSFPSYRGGI  645

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V WAD VG  H+Y+SLKKWSE Y  G+FFKPSR+LEERA KGI L
Sbjct  646  VCWADMVGPRHVYSSLKKWSEAY--GDFFKPSRYLEERATKGIPL  688



>ref|XP_011048390.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 isoform X2 [Populus euphratica]
Length=724

 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT+QSPL+DLL+K+GRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL 
Sbjct  548  KEFANAFPDRTFQSPLIDLLVKNGRNGKTNGKGYYIYEKGSKPRPDPSVLPIIEESRRLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPI++TD+EIVEM+LFPVVNEACRVLDEG+VVRASDLD AS+LGMSFPSYRGGI
Sbjct  608  NIMPDGKPINITDKEIVEMVLFPVVNEACRVLDEGVVVRASDLDTASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  H+Y SLKKWS+ +  G+F+KPS+FLEERA  GI L
Sbjct  668  VFWADLVGPKHVYDSLKKWSQRF--GDFYKPSKFLEERATGGIPL  710



>ref|XP_009374040.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Pyrus x bretschneideri]
Length=734

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL+++LIK+GRNGKNNGKGYYIYEKGSKPKPDPSVL L+E+SRR+T
Sbjct  558  KEFSAAFPDRTFRSPLVEILIKNGRNGKNNGKGYYIYEKGSKPKPDPSVLSLIEESRRVT  617

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP++VTDQ+I+E+ILFPVVNEACR+LDEGIV+RA+DLD+AS+LGMSFPSYRGGI
Sbjct  618  NIMPGGKPLTVTDQDILEVILFPVVNEACRILDEGIVIRAADLDIASVLGMSFPSYRGGI  677

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  HIY SLKKWS +Y  G+FFKPSRFLEERA +G+ L
Sbjct  678  VFWADMVGPKHIYASLKKWSGVY--GDFFKPSRFLEERATRGLPL  720



>ref|XP_011048389.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 isoform X1 [Populus euphratica]
Length=748

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT+QSPL+DLL+K+GRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL 
Sbjct  548  KEFANAFPDRTFQSPLIDLLVKNGRNGKTNGKGYYIYEKGSKPRPDPSVLPIIEESRRLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKPI++TD+EIVEM+LFPVVNEACRVLDEG+VVRASDLD AS+LGMSFPSYRGGI
Sbjct  608  NIMPDGKPINITDKEIVEMVLFPVVNEACRVLDEGVVVRASDLDTASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  H+Y SLKKWS+ +  G+F+KPS+FLEERA  GI L
Sbjct  668  VFWADLVGPKHVYDSLKKWSQRF--GDFYKPSKFLEERATGGIPL  710



>ref|XP_009371440.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Pyrus x bretschneideri]
Length=724

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K L  A  DRT++SPL+++LIK+GRNGKNNGKGYYIYEKGSKPKPD SVLPL+E+SRR+T
Sbjct  548  KELSRAFPDRTFKSPLVEILIKNGRNGKNNGKGYYIYEKGSKPKPDFSVLPLIEESRRVT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP++VTDQEI+EM+LFP VNEACR+LDEGIV RA+DLD+AS+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPLTVTDQEILEMMLFPAVNEACRILDEGIVFRAADLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  HIY SLKKWS  Y  GNFFKPSRFLEERA +G+ L
Sbjct  668  VFWADLVGPKHIYASLKKWSGTY--GNFFKPSRFLEERATRGLPL  710



>ref|XP_008354515.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like, partial [Malus domestica]
Length=575

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K L  A  DRT++SPL+++LIK+GRNGKNNGKGYY+YEKGSKPKPD SVLPL+E+SRR++
Sbjct  399  KELSHAFPDRTFKSPLVEILIKNGRNGKNNGKGYYVYEKGSKPKPDLSVLPLIEESRRVS  458

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMP GKP++VTDQEI+EM+LFP VNEACR+LDEGIV+RASDLD+AS+LGMSFPSYRGGI
Sbjct  459  NIMPDGKPLTVTDQEILEMMLFPAVNEACRILDEGIVIRASDLDIASVLGMSFPSYRGGI  518

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  HIY SLK WS  Y  GNFFKPSRFLEERA +G+ L
Sbjct  519  VFWADLVGPKHIYASLKXWSGTY--GNFFKPSRFLEERATRGLPL  561



>ref|XP_008390228.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=724

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K L  A  DRT++SPL+++LIK+GRNGKNNGK YY+YEK SKPKPD SVLPL+E+SRR+T
Sbjct  548  KELSRAFPDRTFKSPLVEILIKNGRNGKNNGKXYYVYEKXSKPKPDLSVLPLIEESRRVT  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N MPGGKP++VTDQEI+EM+LFP VNEACR+LDEGIV+RASDLD+AS+LGMSFPSYRGGI
Sbjct  608  NXMPGGKPLTVTDQEILEMMLFPAVNEACRILDEGIVIRASDLDIASVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG   IY SLKKWS LY  GNFFKPSRFLEERA  G+ L
Sbjct  668  VFWADQVGPKXIYASLKKWSGLY--GNFFKPSRFLEERATXGLPL  710



>ref|XP_010050568.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Eucalyptus grandis]
Length=563

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A A RTY+SPLL+LLI+SGRNGKNNGKGYYIYEKG KP PDPSV P++E+SRR+ 
Sbjct  387  KVFADAFAGRTYRSPLLELLIRSGRNGKNNGKGYYIYEKGRKPVPDPSVQPIIEESRRIA  446

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP+SV++QEIVEM+LFPVVNEACRVLDE +V+RASDLD+AS+LGMSFPS+RGG+
Sbjct  447  NIMPGGKPLSVSEQEIVEMLLFPVVNEACRVLDEEVVIRASDLDIASVLGMSFPSFRGGL  506

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+W D VG  HIY +LKKWSELY  GNF++PSRFLEERA KGI L
Sbjct  507  VFWGDLVGPNHIYKNLKKWSELY--GNFYRPSRFLEERATKGIPL  549



>ref|XP_010688243.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Beta vulgaris subsp. vulgaris]
Length=722

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRTYQS L++LL+K GRNGKNNGKGYYIYEKGSKPKPD SVLP++E+SRRL+
Sbjct  547  KEFQAAFPDRTYQSSLVELLVKDGRNGKNNGKGYYIYEKGSKPKPDFSVLPIIEESRRLS  606

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             IMPGGKPISV+DQEI+ MI FPVVNEACRVLDEG+VVRASDLDVAS+LGMSFPSYRGG+
Sbjct  607  KIMPGGKPISVSDQEILGMIFFPVVNEACRVLDEGVVVRASDLDVASVLGMSFPSYRGGL  666

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            V+WAD VG  HIY  LKKWS LY  GNFFKPSRFLEER  KG
Sbjct  667  VFWADAVGPSHIYNCLKKWSNLY--GNFFKPSRFLEERVSKG  706



>ref|XP_002284283.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Vitis vinifera]
 emb|CBI28049.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A   RT++SPL++LL+K+GRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL 
Sbjct  548  KEFATAFQGRTFESPLVNLLLKNGRNGKQNGKGYYIYEKGSKPRPDPSVLPIIEESRRLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISV +QEI+EMILFPVVNEACRVLDEG+VVRASDLD+ S+LGMSFPSYRGGI
Sbjct  608  NIMPGGKPISVANQEILEMILFPVVNEACRVLDEGVVVRASDLDITSVLGMSFPSYRGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  +IYT LKKWS +Y  G FFKPS +LE+RA KGI L
Sbjct  668  VFWADEVGPYYIYTCLKKWSAMY--GTFFKPSSYLEQRATKGIPL  710



>gb|EYU32938.1| hypothetical protein MIMGU_mgv1a002041mg [Erythranthe guttata]
Length=723

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            DRT+ +PL++LLI++GRNGKNNGKGYY YEKGSKPKPDP+VLP++E+SRRLTNIMP GKP
Sbjct  555  DRTFATPLVELLIENGRNGKNNGKGYYTYEKGSKPKPDPAVLPIIEESRRLTNIMPNGKP  614

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            ISVTD+E+VEMILFPVVNEACRVLD+G+VVRASDLD+AS+LGMSFPSYRGGI++WADT+G
Sbjct  615  ISVTDEEVVEMILFPVVNEACRVLDDGVVVRASDLDIASVLGMSFPSYRGGIIFWADTIG  674

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A  +Y SL+KWSE Y  G FFKPS++LEERA +GI L
Sbjct  675  ADRLYRSLQKWSEAY--GKFFKPSKYLEERATRGIPL  709



>gb|KHG01746.1| Peroxisomal fatty acid beta-oxidation multifunctional AIM1 -like 
protein [Gossypium arboreum]
Length=723

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT++SPL +LL+K+GRNGK+NGKG+Y++EKGSKPKPDPSVLP+V++SR+  
Sbjct  545  KEYENAFPDRTFRSPLTELLLKNGRNGKSNGKGFYVHEKGSKPKPDPSVLPIVDESRKFM  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISVTD+EI EM+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSYRGGI
Sbjct  605  NIMPGGKPISVTDEEITEMVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYRGGI  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADTVG+ HIY SLKK SE+Y  G++FKPS +LEERA+KG+ L
Sbjct  665  MFWADTVGSKHIYLSLKKLSEMY--GSYFKPSSYLEERAMKGMPL  707



>ref|XP_009129069.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Brassica rapa]
Length=722

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR ++SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPDPSVL +VE+SR+LTNIMPG
Sbjct  554  AYGDRMFRSPLTELLVKSGRNGKINGRGYYIYEKGSKPKPDPSVLSVVEESRKLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGGI++WAD
Sbjct  614  GKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGIIFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPSR+LEERA+ G+ L
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSRYLEERAMNGMLL  711



>ref|XP_010433148.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Camelina sativa]
Length=721

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 144/158 (91%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR ++SPL +LL+KSGRNGK NG+G+YIYEKGSKPKPDPSVL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFKSPLTELLLKSGRNGKINGRGFYIYEKGSKPKPDPSVLSVVEESRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            PISV+D++IVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WAD V
Sbjct  616  PISVSDKDIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADMV  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LK+ SE+Y  G FFKPSR+LEERA+KG+RL
Sbjct  676  GPKYIYERLKRLSEMY--GGFFKPSRYLEERAMKGMRL  711



>gb|KCW79923.1| hypothetical protein EUGRSUZ_C01265 [Eucalyptus grandis]
Length=724

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A A RTY+SPLL+LLI+SGRNGKNNGKGYYIYEKG KP PDPSV P++E+SRR+ 
Sbjct  548  KVFADAFAGRTYRSPLLELLIRSGRNGKNNGKGYYIYEKGRKPVPDPSVQPIIEESRRIA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKP+SV++QEIVEM+LFPVVNEACRVLDE +V+RASDLD+AS+LGMSFPS+RGG+
Sbjct  608  NIMPGGKPLSVSEQEIVEMLLFPVVNEACRVLDEEVVIRASDLDIASVLGMSFPSFRGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+W D VG  HIY +LKKWSELY  GNF++PSRFLEERA KGI L
Sbjct  668  VFWGDLVGPNHIYKNLKKWSELY--GNFYRPSRFLEERATKGIPL  710



>ref|NP_194630.1| fatty acid beta-oxidation multifunctional protein AIM1 [Arabidopsis 
thaliana]
 sp|Q9ZPI6.1|AIM1_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1; AltName: Full=Protein ABNORMAL INFLORESCENCE 
MERISTEM 1; Short=AtAIM1; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA 
dehydrogenase [Arabidopsis thaliana]
 gb|AAD18041.1| AIM1 protein [Arabidopsis thaliana]
 emb|CAB43915.1| AIM1 protein [Arabidopsis thaliana]
 emb|CAB79659.1| AIM1 protein [Arabidopsis thaliana]
 gb|AAL24297.1| AIM1 protein [Arabidopsis thaliana]
 gb|AAL59895.1| putative AIM1 protein [Arabidopsis thaliana]
 gb|AAM20293.1| putative AIM1 protein [Arabidopsis thaliana]
 gb|AEE85572.1| fatty acid beta-oxidation multifunctional protein AIM1 [Arabidopsis 
thaliana]
Length=721

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR ++SP+ +LL+KSGRNGK NG+GYYIYEKGSKPKPDPSVL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFRSPMTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSIVEKSRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            PISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WADTV
Sbjct  616  PISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADTV  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LKK SE Y  G+FFKPSR+LEERA+ G+ L
Sbjct  676  GPKYIYERLKKLSETY--GSFFKPSRYLEERAMNGMLL  711



>gb|ADU15551.1| MFP [Gossypium hirsutum]
Length=721

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 145/160 (91%), Gaps = 6/160 (4%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A +DR ++SPLL+LL K GRNGKNNGKGYYIYEKGSKPKPDPSVL ++E+SRRLTNIMPG
Sbjct  554  AFSDRIFKSPLLELLAKDGRNGKNNGKGYYIYEKGSKPKPDPSVLSIIEESRRLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+E++EMILFPVVNEACRVLDEG+VVRASDLDVAS+LGMSFPSYRGGIV+WAD
Sbjct  614  GKPISVTDREVLEMILFPVVNEACRVLDEGVVVRASDLDVASVLGMSFPSYRGGIVFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
             VGA H+Y +LKKWS     GN +KPS+FLEERA+KGI L
Sbjct  674  MVGANHVYRNLKKWS-----GN-YKPSKFLEERAMKGIPL  707



>ref|XP_010438362.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Camelina sativa]
Length=721

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR ++SPL +LL+KSGRNGK NG+G+YIYE GSKPKPDPSVL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFKSPLTELLLKSGRNGKINGRGFYIYENGSKPKPDPSVLSVVEESRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            P+SV+D++IVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WAD V
Sbjct  616  PLSVSDKDIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADMV  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LK+ SE+Y  G FFKPSR+LEERA+KG+RL
Sbjct  676  GPKYIYERLKRLSEMY--GGFFKPSRYLEERAMKGMRL  711



>ref|XP_010541187.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Tarenaya hassleriana]
Length=741

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR ++SPL +LLIK+GRNGKNNGKG+YIYEKGSKP+PDPSV P++E+SR+L NIMPG
Sbjct  568  AYGDRIFKSPLTELLIKNGRNGKNNGKGFYIYEKGSKPRPDPSVRPVIEESRKLVNIMPG  627

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GK I+V+D+EI+EMI+FPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WAD
Sbjct  628  GKSITVSDKEILEMIMFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWAD  687

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +IY  LKK SE YG G FFKPSRFLEERA+KG+ L
Sbjct  688  TVGAKYIYERLKKLSETYG-GGFFKPSRFLEERAMKGMLL  726



>ref|XP_002867428.1| hypothetical protein ARALYDRAFT_491857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43687.1| hypothetical protein ARALYDRAFT_491857 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR ++SP+ +LL+KSGRNGK NGKGYYIYEKGSKPKPDPSVL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFRSPMTELLLKSGRNGKINGKGYYIYEKGSKPKPDPSVLSIVEESRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            PISV+D+EIVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WADTV
Sbjct  616  PISVSDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADTV  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LK+ SE Y  G+FFKPSR+LEERA+ G+ L
Sbjct  676  GPKYIYERLKRLSETY--GSFFKPSRYLEERAMNGMLL  711



>emb|CDY06852.1| BnaC01g09510D [Brassica napus]
Length=722

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR ++SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPD SVL +VE+SR+LTNIMPG
Sbjct  554  AYGDRMFRSPLTELLVKSGRNGKINGRGYYIYEKGSKPKPDSSVLSVVEESRKLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
             KPISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGGI++WAD
Sbjct  614  EKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGIIFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPSR+LEERA+ G+RL
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSRYLEERAMNGMRL  711



>emb|CDY69211.1| BnaCnng62430D, partial [Brassica napus]
Length=610

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR ++SPL +LL+KSGRNGK NG+GYYIY+KGSKPKPDPSVL +VE+SRRLTNIMPG
Sbjct  443  AFGDRMFRSPLTELLLKSGRNGKINGRGYYIYQKGSKPKPDPSVLSVVEESRRLTNIMPG  502

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPI+VTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGG+++WAD
Sbjct  503  GKPITVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGVLFWAD  562

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G+FFKPS++LEE A++G+ L
Sbjct  563  TVGPKYIYERLKRLSETY--GDFFKPSKYLEEMAMRGMLL  600



>emb|CDY35240.1| BnaA01g07910D [Brassica napus]
Length=722

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR ++SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPD SVL +VE+SR+LTNIMPG
Sbjct  554  AYGDRMFRSPLTELLLKSGRNGKINGRGYYIYEKGSKPKPDSSVLSVVEESRKLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGGI++WAD
Sbjct  614  GKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGIIFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPSR+LEERA+ G+ L
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSRYLEERAMNGMLL  711



>emb|CAN66465.1| hypothetical protein VITISV_006222 [Vitis vinifera]
Length=859

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A   RT++SPL++LL+K+GRNGK NGKGYYIYEKGSKP+PDPSVLP++E+SRRL 
Sbjct  633  KEFATAFQGRTFESPLVNLLLKNGRNGKQNGKGYYIYEKGSKPRPDPSVLPIIEESRRLA  692

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGGKPISV +QEI+EMILFPVVNEACRVLDEG+VVRASDLD+ S+LGMSFPSYRGGI
Sbjct  693  NIMPGGKPISVXNQEILEMILFPVVNEACRVLDEGVVVRASDLDITSVLGMSFPSYRGGI  752

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGI  205
            V+WAD VG  + YT LKKWS +Y  G FFKPS +LE+RA KGI
Sbjct  753  VFWADEVGPYYXYTCLKKWSAMY--GTFFKPSSYLEQRATKGI  793



>ref|XP_006412890.1| hypothetical protein EUTSA_v10024533mg [Eutrema salsugineum]
 gb|ESQ54343.1| hypothetical protein EUTSA_v10024533mg [Eutrema salsugineum]
Length=721

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR + SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPDPSV+ +VE+SR+LTNIMPG
Sbjct  554  AYGDRMFSSPLTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVISVVEESRKLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGG+++WAD
Sbjct  614  GKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGLLFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPSR+LEERA+ G+ L
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSRYLEERAMNGMLL  711



>ref|XP_009137821.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Brassica rapa]
Length=700

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR ++SPL +LL+KSGRNGK NG+GYYIY+KGSKPKPDPSVL +VE+SRRLTNIMPG
Sbjct  533  AFGDRMFRSPLTELLLKSGRNGKINGRGYYIYQKGSKPKPDPSVLSVVEESRRLTNIMPG  592

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPI+VTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGG+++WAD
Sbjct  593  GKPITVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGVLFWAD  652

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G+FFKPS++LEE A++G+ L
Sbjct  653  TVGPKYIYERLKRLSETY--GDFFKPSKYLEEMAMRGMLL  690



>gb|KFK29448.1| hypothetical protein AALP_AA7G135800 [Arabis alpina]
Length=721

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR + SPL  LL+KSGRNGK NG+GYYIYEKGSKPKPDPSVL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFNSPLTALLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSIVEESRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            PISVT++EIVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WADTV
Sbjct  616  PISVTEKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADTV  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LKK SE Y  G+F+KPSR+LEERA+ G+ L
Sbjct  676  GPKYIYERLKKLSETY--GSFYKPSRYLEERAMNGLLL  711



>ref|XP_006283211.1| hypothetical protein CARUB_v10004242mg [Capsella rubella]
 gb|EOA16109.1| hypothetical protein CARUB_v10004242mg [Capsella rubella]
Length=721

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR ++SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPDPSVL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFRSPLTELLLKSGRNGKINGRGYYIYEKGSKPKPDPSVLSVVEESRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            PISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLD+AS+LGMSFPSYRGGIV+WAD +
Sbjct  616  PISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADMI  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LK+ SE Y  G+FFKPSR+LEERA KG+ L
Sbjct  676  GPKYIYERLKEMSETY--GSFFKPSRYLEERATKGMPL  711



>emb|CDX97462.1| BnaC08g13270D [Brassica napus]
Length=721

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR + SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPD SVL +VE+SR+LTNIMPG
Sbjct  554  AYGDRMFSSPLTELLLKSGRNGKINGRGYYIYEKGSKPKPDSSVLSVVEESRKLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPISVTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGG+++WAD
Sbjct  614  GKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGLLFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPSR+LEERA KG+ L
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSRYLEERATKGMLL  711



>ref|XP_010047906.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Eucalyptus grandis]
 gb|KCW79920.1| hypothetical protein EUGRSUZ_C01261 [Eucalyptus grandis]
Length=724

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A A RTY SPLL+LLI+SGRNGKNNGKGYYIYEKG KP PDPSV P++E+SRR+ 
Sbjct  548  KVFADAFAGRTYGSPLLELLIRSGRNGKNNGKGYYIYEKGCKPVPDPSVQPIIEESRRIA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPGG P+SV++QEIVEM+LFPVVNEACRVLDE +V+RASDLD+AS+LGMSFPS+RGG+
Sbjct  608  NIMPGGNPLSVSEQEIVEMLLFPVVNEACRVLDEEVVIRASDLDIASVLGMSFPSFRGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+W D VG  HIY SLKKWSELY  GNF++PSRFLEERA K I L
Sbjct  668  VFWGDLVGPNHIYKSLKKWSELY--GNFYRPSRFLEERATKCIPL  710



>ref|XP_009109066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Brassica rapa]
 emb|CDY66477.1| BnaA08g30740D [Brassica napus]
Length=721

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  DR + SPL +LL+KSGRNGK NG+GYYIYEKGSKPKPD SVL +VE+SR+LTNIMPG
Sbjct  554  AYGDRMFVSPLTELLLKSGRNGKINGRGYYIYEKGSKPKPDSSVLSVVEESRKLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKPI+VTD+EIVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGG+++WAD
Sbjct  614  GKPITVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGLLFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPSR+LEERA KG+ L
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSRYLEERATKGMLL  711



>ref|XP_010447902.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Camelina sativa]
Length=721

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
             DR + SPL +LL+KSGRNGK NG+G+YIYEKGSKPKPDP VL +VE+SR+LTNIMPGGK
Sbjct  556  GDRMFNSPLTELLLKSGRNGKINGRGFYIYEKGSKPKPDPQVLSIVEESRKLTNIMPGGK  615

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
            P SV+D+EIVEMILFPVVNEACRVLDEG+V+RA+DLD+AS+LGMSFPSYRGGIV+WAD V
Sbjct  616  PRSVSDKEIVEMILFPVVNEACRVLDEGVVIRAADLDIASVLGMSFPSYRGGIVFWADMV  675

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G  +IY  LK+ SE Y  G FFKPSR+LEERA+KG+ L
Sbjct  676  GPKYIYERLKRLSETY--GGFFKPSRYLEERAMKGMLL  711



>gb|KJB07187.1| hypothetical protein B456_001G006400 [Gossypium raimondii]
Length=721

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR + SPL++L +K+GRNGK NGKGYYIYEKGSKPKPDPS+LP++E+ RR T
Sbjct  543  KEFAKAFPDRVFMSPLIELFMKNGRNGKINGKGYYIYEKGSKPKPDPSILPIIEECRRQT  602

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +MP GKPI+++D+EI+EM+LFPVVNEACRVLDE +VVRASDLD  S+LGMSFPS+RGGI
Sbjct  603  KLMPAGKPITISDKEILEMVLFPVVNEACRVLDEEVVVRASDLDTTSVLGMSFPSHRGGI  662

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA H+Y SLK+WSE Y  G+F+KPS++LEERA+KGI L
Sbjct  663  VFWADTVGANHVYKSLKEWSEAY--GSFYKPSKYLEERAIKGIPL  705



>gb|KJB07188.1| hypothetical protein B456_001G006400 [Gossypium raimondii]
Length=719

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    A  DR + SPL++L +K+GRNGK NGKGYYIYEKGSKPKPDPS+LP++E+ RR T
Sbjct  543  KEFAKAFPDRVFMSPLIELFMKNGRNGKINGKGYYIYEKGSKPKPDPSILPIIEECRRQT  602

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +MP GKPI+++D+EI+EM+LFPVVNEACRVLDE +VVRASDLD  S+LGMSFPS+RGGI
Sbjct  603  KLMPAGKPITISDKEILEMVLFPVVNEACRVLDEEVVVRASDLDTTSVLGMSFPSHRGGI  662

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WADTVGA H+Y SLK+WSE Y  G+F+KPS++LEERA+KGI L
Sbjct  663  VFWADTVGANHVYKSLKEWSEAY--GSFYKPSKYLEERAIKGIPL  705



>emb|CDX92908.1| BnaC07g41660D [Brassica napus]
Length=787

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  D+ ++SPL +LL+KSGRNGK NG+GYYIY+KGSKPKPDPSVL +VE+SR LTNIMPG
Sbjct  554  AFGDQMFRSPLTELLLKSGRNGKINGRGYYIYQKGSKPKPDPSVLSVVEESRTLTNIMPG  613

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GK I+VTD++IVEMILFPVVNEACRVLDEG+V+RASDLDVAS+LGMSFPSYRGG+++WAD
Sbjct  614  GKAITVTDKDIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMSFPSYRGGVLFWAD  673

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVG  +IY  LK+ SE Y  G FFKPS++LEERA++G+ L
Sbjct  674  TVGPKYIYERLKRLSETY--GGFFKPSKYLEERAMRGMLL  711



>ref|XP_010100830.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB84763.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=830

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  ++A  +RT++SPL++LL++SGRNGKNNGKGYYIYEKGS+PKPD ++LP++E+SR+LT
Sbjct  627  KEFINAFPERTFKSPLIELLVQSGRNGKNNGKGYYIYEKGSQPKPDLTILPIIEESRQLT  686

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NIMPG KPISVTDQEIVEMILFPVVNEACRVL+EGIVVRASDLD+AS+LGMSFPSYRGGI
Sbjct  687  NIMPGKKPISVTDQEIVEMILFPVVNEACRVLEEGIVVRASDLDIASVLGMSFPSYRGGI  746

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLE  226
            V WAD VG  H+Y+SLKKWSE Y  G+FFKPS    
Sbjct  747  VCWADMVGPRHVYSSLKKWSEAY--GDFFKPSSLFN  780



>ref|XP_009409458.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Musa acuminata subsp. malaccensis]
Length=725

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA   RT+QS L++L++KSGRNGKNNGKGYYIYEKG KPKPDPSV  ++E+SRRL N+MP
Sbjct  552  SAFRGRTFQSQLVELMVKSGRNGKNNGKGYYIYEKGQKPKPDPSVQAIIEESRRLANVMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPI++ DQE++EMI FPVVNEACRV DEG+V+RASDLD++S+LGM FP YRGGI++WA
Sbjct  612  GGKPITINDQEVLEMIFFPVVNEACRVTDEGVVIRASDLDISSVLGMGFPRYRGGIIFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+G+ +IY  L KW+  Y  GNFFKPS +LEERA KG+ L
Sbjct  672  DTIGSGYIYAKLNKWANSY--GNFFKPSAYLEERATKGLPL  710



>ref|XP_008458462.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Cucumis melo]
Length=724

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   ++  DR   SPL+DL+ K+GR+GKNNG+GYYIYEKGS+PKPDPS+LP++E+SRR+ 
Sbjct  548  KEFSASFPDRVLFSPLVDLMRKNGRDGKNNGRGYYIYEKGSRPKPDPSILPIIEESRRIA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MP GKPI+++DQ+I+EM+LFPVVNE CRV++EGIVVR SDL+VA++LGMSFPSYRGG+
Sbjct  608  NLMPSGKPIAISDQQILEMVLFPVVNEGCRVVEEGIVVRPSDLNVATVLGMSFPSYRGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++W D VG  H+Y SLKKWSE Y  G+FFKPS++LEERA KGI L
Sbjct  668  LFWGDLVGPKHVYASLKKWSEQY--GDFFKPSKYLEERAAKGIPL  710



>ref|XP_010925875.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Elaeis guineensis]
Length=725

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA   RT+QS L+ LL ++GRNGK+NGKG+YIYEKGSKPKPDPS+  +VE+SRR  NIMP
Sbjct  552  SAFRGRTFQSDLVKLLAENGRNGKSNGKGFYIYEKGSKPKPDPSIQAIVEESRRRANIMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPI V+DQEI+EM+ FPVVNEACRV+DE +VVRASDLD+AS+LGM FP YRGGIV+WA
Sbjct  612  GGKPIIVSDQEILEMVFFPVVNEACRVMDERVVVRASDLDIASVLGMGFPRYRGGIVFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DTVGA +IY+ LKKW+E+Y  G FFKPS +LEERA KG+ L
Sbjct  672  DTVGAGYIYSRLKKWAEIY--GGFFKPSSYLEERANKGLPL  710



>ref|XP_006833340.1| hypothetical protein AMTR_s00109p00083880 [Amborella trichopoda]
 gb|ERM98618.1| hypothetical protein AMTR_s00109p00083880 [Amborella trichopoda]
Length=721

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   SA   RT+ SPL+ ++++ GR+GK NGKGYY+YEKGSKPK DP+VLP++E+SRR  
Sbjct  545  KEFASAFVGRTFTSPLVSIMMEKGRSGKKNGKGYYLYEKGSKPKADPNVLPIIEESRRQV  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NI+PGGKPI V+D+EI+EMI FPVVNEACRVL EGIVVRASDLD++S+LGM FP YRGGI
Sbjct  605  NILPGGKPIMVSDREILEMIFFPVVNEACRVLSEGIVVRASDLDISSVLGMGFPKYRGGI  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD+VG  HIY+SLKKW++ Y  G F++P  FLEERA KGI L
Sbjct  665  VFWADSVGPTHIYSSLKKWAKAY--GAFYEPCLFLEERAKKGIPL  707



>ref|XP_008775812.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Phoenix dactylifera]
Length=725

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA   RT++S L++LL+++GRNGK+NGKG+YIYEKGSKPKPDPS+  +VE+SRR TNIMP
Sbjct  552  SAFKGRTFESDLVELLVENGRNGKSNGKGFYIYEKGSKPKPDPSIQAIVEESRRRTNIMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPI ++DQEI+EMI FP VNEACRV+DE IVVRASDLD+AS+LGM FP YRGGIV+WA
Sbjct  612  GGKPIILSDQEILEMIFFPAVNEACRVMDERIVVRASDLDIASVLGMGFPRYRGGIVFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DTVGA +I + LKKW+E+Y  G FFKPS +LEERA KG+ L
Sbjct  672  DTVGADYINSRLKKWAEVY--GGFFKPSSYLEERASKGLPL  710



>gb|KGN60609.1| hypothetical protein Csa_2G003610 [Cucumis sativus]
Length=660

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   ++  DR   SPL+DL+ K+GR+GKNNGKGYYIYEKGS+PKPDPS+ P++E++RR+ 
Sbjct  484  KEFSASFPDRVLFSPLVDLMRKNGRDGKNNGKGYYIYEKGSRPKPDPSIAPILEETRRIA  543

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MP GKPI+++DQ+I+EM+LFPVVNE CRV++EGIVVR SDL+VA++LGMSFPSYRGG+
Sbjct  544  NLMPSGKPIAISDQQILEMVLFPVVNEGCRVVEEGIVVRPSDLNVATVLGMSFPSYRGGL  603

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++W D VG  H+Y SLKKWSE Y  G+FFKPS++LEERA KGI L
Sbjct  604  LFWGDLVGPKHVYASLKKWSEQY--GDFFKPSKYLEERAAKGIPL  646



>ref|XP_004164759.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Cucumis sativus]
Length=719

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   ++  DR   SPL+DL+ K+GR+GKNNGKGYYIYEKGS+PKPDPS+ P++E++RR+ 
Sbjct  543  KEFSASFPDRVLFSPLVDLMRKNGRDGKNNGKGYYIYEKGSRPKPDPSIAPILEETRRIA  602

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MP GKPI+++DQ+I+EM+LFPVVNE CRV++EGIVVR SDL+VA++LGMSFPSYRGG+
Sbjct  603  NLMPSGKPIAISDQQILEMVLFPVVNEGCRVVEEGIVVRPSDLNVATVLGMSFPSYRGGL  662

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++W D VG  H+Y SLKKWSE Y  G+FFKPS++LEERA KGI L
Sbjct  663  LFWGDLVGPKHVYASLKKWSEQY--GDFFKPSKYLEERAAKGIPL  705



>ref|XP_004139346.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Cucumis sativus]
Length=724

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   ++  DR   SPL+DL+ K+GR+GKNNGKGYYIYEKGS+PKPDPS+ P++E++RR+ 
Sbjct  548  KEFSASFPDRVLFSPLVDLMRKNGRDGKNNGKGYYIYEKGSRPKPDPSIAPILEETRRIA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N+MP GKPI+++DQ+I+EM+LFPVVNE CRV++EGIVVR SDL+VA++LGMSFPSYRGG+
Sbjct  608  NLMPSGKPIAISDQQILEMVLFPVVNEGCRVVEEGIVVRPSDLNVATVLGMSFPSYRGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++W D VG  H+Y SLKKWSE Y  G+FFKPS++LEERA KGI L
Sbjct  668  LFWGDLVGPKHVYASLKKWSEQY--GDFFKPSKYLEERAAKGIPL  710



>ref|XP_010915852.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Elaeis guineensis]
Length=725

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA   RT++S L++LL ++GR+GK+NGKG+YI+EKGSKPKPDPS+  +VE+SRR TNIMP
Sbjct  552  SAFKGRTFKSDLIELLAENGRHGKSNGKGFYIHEKGSKPKPDPSIQSIVEESRRRTNIMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPI ++DQEI EMI FPVVNEACRV+DE IVVRASDLD+AS+LGM FP YRGGIV+WA
Sbjct  612  GGKPIILSDQEIQEMIFFPVVNEACRVMDERIVVRASDLDIASVLGMGFPRYRGGIVFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DTVGA +I + LKKW+E+Y  G FFKP+ +LEERA KG+ L
Sbjct  672  DTVGADYINSRLKKWAEVY--GGFFKPASYLEERAKKGLPL  710



>ref|XP_006833339.1| hypothetical protein AMTR_s00109p00082150 [Amborella trichopoda]
 gb|ERM98617.1| hypothetical protein AMTR_s00109p00082150 [Amborella trichopoda]
Length=721

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K + SA   RT+  PL+ ++++ GR+GK NGKGYY+YEKGSKPK DP+VLP++E+SR+  
Sbjct  545  KEIASAFEGRTFIFPLVQIMMEKGRSGKKNGKGYYLYEKGSKPKVDPNVLPIIEESRKRV  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NI+PGGKPI+V+D EI+EMILFPVVNEACRVL EGIV+RASDLD++S+LGM FP YRGGI
Sbjct  605  NILPGGKPITVSDCEILEMILFPVVNEACRVLSEGIVLRASDLDISSILGMGFPKYRGGI  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD VG  HIY+SLKKW+E+Y  G F++P  FLEERA KGI L
Sbjct  665  VFWADLVGPAHIYSSLKKWAEVY--GGFYEPCLFLEERAKKGIPL  707



>ref|XP_008800762.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Phoenix dactylifera]
Length=725

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            SA   R ++S L+ LL+++GRNGK+NGKG+YI+EKGSKPKPDPS+  +VE+SRR  N+MP
Sbjct  552  SAFRGRMFRSDLVKLLVENGRNGKSNGKGFYIHEKGSKPKPDPSIQAIVEESRRRANVMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKPI V+DQEI+EM+ FP VNEACRV+DE +VVRASDLD+AS+LGM FP YRGGIV+WA
Sbjct  612  GGKPIIVSDQEILEMVFFPAVNEACRVMDERVVVRASDLDIASVLGMGFPRYRGGIVFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DTVGA +IY+ LKKW+E+Y  G FF+PS +LEERA KG+ L
Sbjct  672  DTVGAGYIYSRLKKWAEIY--GGFFRPSSYLEERANKGLPL  710



>ref|XP_009413815.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=682

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            S+   RT +S L+ L++K GRNGKNNGKGYYIYE+G  PKPD SV P++E+ RR  N+MP
Sbjct  509  SSFRGRTLESELVGLMVKHGRNGKNNGKGYYIYERGQNPKPDSSVQPIIEECRRRANVMP  568

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQE++EMI FPVVNEACRVL EG+V++ASDLDVAS+LGMSFP+YRGGIVYWA
Sbjct  569  GGKPVTLSDQEVLEMIFFPVVNEACRVLAEGVVIQASDLDVASVLGMSFPNYRGGIVYWA  628

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            D+VG+  IY  L KW+ELY  GNFFKPS +LEERA+KG+ L
Sbjct  629  DSVGSSSIYEKLNKWTELY--GNFFKPSPYLEERAMKGLPL  667



>ref|XP_009413814.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            S+   RT +S L+ L++K GRNGKNNGKGYYIYE+G  PKPD SV P++E+ RR  N+MP
Sbjct  552  SSFRGRTLESELVGLMVKHGRNGKNNGKGYYIYERGQNPKPDSSVQPIIEECRRRANVMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQE++EMI FPVVNEACRVL EG+V++ASDLDVAS+LGMSFP+YRGGIVYWA
Sbjct  612  GGKPVTLSDQEVLEMIFFPVVNEACRVLAEGVVIQASDLDVASVLGMSFPNYRGGIVYWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            D+VG+  IY  L KW+ELY  GNFFKPS +LEERA+KG+ L
Sbjct  672  DSVGSSSIYEKLNKWTELY--GNFFKPSPYLEERAMKGLPL  710



>gb|ABA27004.1| TO52-1rc [Taraxacum officinale]
Length=129

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = -2

Query  573  SKPKPDPSVLPLVEQSRRLTNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRA  394
            SKPKPDP + P++E+++R  NIMPGGK ISVTD+EIVEMILFPVVNEACRVL EG+VVRA
Sbjct  20   SKPKPDPQMFPIIEEAKRQVNIMPGGKAISVTDKEIVEMILFPVVNEACRVLGEGVVVRA  79

Query  393  SDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKKWSELYGIGNFFKPS  238
            SDLDVAS+LGMSFPSYRGGIV+W D VGA HIY SLKKWSE Y    F+KPS
Sbjct  80   SDLDVASVLGMSFPSYRGGIVFWGDLVGAKHIYASLKKWSEKY--SKFYKPS  129



>ref|XP_006354399.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum tuberosum]
Length=712

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K   +A  DRT+Q PL+ L++ +GR GK NG+GYY+Y+KG  P+PD SVL +VE+SRRL 
Sbjct  547  KEFAAAFPDRTFQCPLVQLMMANGRTGKKNGRGYYLYKKGKIPEPDLSVLQIVEESRRLA  606

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            +IMPGG+PISV DQEIVEM+ FPVVNEACRV++E +VVRASDLDVAS+ GM FPS RGGI
Sbjct  607  SIMPGGEPISVMDQEIVEMLFFPVVNEACRVIEERVVVRASDLDVASVHGMKFPSERGGI  666

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +YWAD++GA +IY  LK WS+ Y  G+FFKPS+FL+ERA KGI L
Sbjct  667  MYWADSIGAEYIYARLKYWSKAY--GSFFKPSQFLQERATKGIPL  709



>gb|ABR18131.1| unknown [Picea sitchensis]
Length=723

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = -2

Query  723  QDMV---LLLQ*EKNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDP  553
            QD+V   + L+  K  ++A ADRT+ SPL  L+I++ R G+ NGKGYY+Y++  + +P P
Sbjct  535  QDLVGYGVSLEVGKQFVTAFADRTFTSPLTQLMIENKRAGEKNGKGYYVYDEKRRARPAP  594

Query  552  SVLPLVEQSRRLTNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVAS  373
             V  ++EQS ++T IMPGGK + VTD+EI+EMI FPVVNEACRVLDEGI  +ASDLDV+ 
Sbjct  595  EVKEIIEQSIKITKIMPGGKAVVVTDREILEMIFFPVVNEACRVLDEGIASKASDLDVSV  654

Query  372  LLGMSFPSYRGGIVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +LGM FPSYRGGIV+WAD+VGA HIY+SLKKW E Y  G  FKP  +LEERA +GI L
Sbjct  655  VLGMGFPSYRGGIVFWADSVGAGHIYSSLKKWYESY--GGLFKPCAYLEERAARGIPL  710



>gb|AFW65775.1| hypothetical protein ZEAMMB73_546088 [Zea mays]
Length=407

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  +R   S L+DL++K GR GK NGKGYYIYEKG KPKPDPSV  ++E+ R+  N MPG
Sbjct  235  AFGERNLDSDLVDLMVKDGRQGKVNGKGYYIYEKGGKPKPDPSVKHVIEEYRKHANTMPG  294

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKP+++TDQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP YRGG+V+WAD
Sbjct  295  GKPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKYRGGLVFWAD  354

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +I++ L KW+E+Y  G FFKPS +LE+RA  G+ L
Sbjct  355  TVGAPYIHSKLSKWAEIY--GPFFKPSSYLEQRAKSGVPL  392



>ref|XP_009787311.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
 ref|XP_009787312.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
Length=710

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  ++A  DR +QSPL+ L++++GR GK NGKGYY Y+KGSKP+ D SV+ +VE+S R T
Sbjct  544  KEFVAAFPDRAFQSPLVQLMVENGREGKKNGKGYYTYKKGSKPEADHSVIQVVEESMRFT  603

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NI PGGKPISVTD+EI+EMI FPVVNEACRV++EGIVVRASD+D+AS+ G  FPS  GG+
Sbjct  604  NIAPGGKPISVTDEEILEMIFFPVVNEACRVIEEGIVVRASDIDIASVHGFKFPSETGGV  663

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+G+ +IY+ LK W E Y  G+F+KPS FLE+RA KG+ L
Sbjct  664  MFWADTIGSEYIYSKLKTWHEAY--GDFYKPSTFLEQRAAKGLPL  706



>ref|XP_007012079.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 ref|XP_007012080.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 gb|EOY29698.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 gb|EOY29699.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
Length=716

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K + +   DRT+QS L  L+++ GR GK+NGKGYYI+EKGSKPKPD +V P+VE+SRR+T
Sbjct  550  KEMAATFPDRTFQSALHGLMLQHGRQGKSNGKGYYIFEKGSKPKPDYTVQPIVEESRRIT  609

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N++    PIS++DQEIVEMI FPVVNE CR+++EG++ RAS+LDVAS+LG +FPS  GGI
Sbjct  610  NLVE--NPISISDQEIVEMIFFPVVNEGCRIIEEGVIARASELDVASVLGFNFPSRLGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+GA +IYTSLKKWS LY  G FF+PSRFLEERA+KGI L
Sbjct  668  MFWADTIGAKYIYTSLKKWSALY--GPFFRPSRFLEERAMKGIPL  710



>ref|XP_007012081.1| Enoyl-CoA hydratase/isomerase family, putative isoform 4 [Theobroma 
cacao]
 gb|EOY29700.1| Enoyl-CoA hydratase/isomerase family, putative isoform 4 [Theobroma 
cacao]
Length=726

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K + +   DRT+QS L  L+++ GR GK+NGKGYYI+EKGSKPKPD +V P+VE+SRR+T
Sbjct  550  KEMAATFPDRTFQSALHGLMLQHGRQGKSNGKGYYIFEKGSKPKPDYTVQPIVEESRRIT  609

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N++    PIS++DQEIVEMI FPVVNE CR+++EG++ RAS+LDVAS+LG +FPS  GGI
Sbjct  610  NLVE--NPISISDQEIVEMIFFPVVNEGCRIIEEGVIARASELDVASVLGFNFPSRLGGI  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+GA +IYTSLKKWS LY  G FF+PSRFLEERA+KGI L
Sbjct  668  MFWADTIGAKYIYTSLKKWSALY--GPFFRPSRFLEERAMKGIPL  710



>gb|AFW70929.1| hypothetical protein ZEAMMB73_939282 [Zea mays]
Length=159

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = -2

Query  573  SKPKPDPSVLPLVEQSRRLTNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRA  394
            +KPKPDPSV  ++E+ R+  N MPGGKP+++ DQ+I+EMI FPVVNEACRV+DE +V+RA
Sbjct  22   AKPKPDPSVKHVIEEYRKQANTMPGGKPVTLMDQDILEMIFFPVVNEACRVMDENVVIRA  81

Query  393  SDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERAL  214
            SDLD+AS+LGM FP YRGG+V+WADTVGA +I++ L KW+E+Y  G FFKPS +LE+RA 
Sbjct  82   SDLDIASVLGMGFPKYRGGLVFWADTVGAPYIHSKLSKWAEMY--GPFFKPSSYLEQRAK  139

Query  213  KGIRL  199
             G+ L
Sbjct  140  SGVPL  144



>ref|XP_007012078.1| Peroxisomal fatty acid beta-oxidation multifunctional protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29697.1| Peroxisomal fatty acid beta-oxidation multifunctional protein, 
putative isoform 1 [Theobroma cacao]
Length=812

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K + +   DRT+QS L  L+++ GR GK+NGKGYYI+EKGSKPKPD +V P+VE+SRR+T
Sbjct  646  KEMAATFPDRTFQSALHGLMLQHGRQGKSNGKGYYIFEKGSKPKPDYTVQPIVEESRRIT  705

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            N++    PIS++DQEIVEMI FPVVNE CR+++EG++ RAS+LDVAS+LG +FPS  GGI
Sbjct  706  NLVE--NPISISDQEIVEMIFFPVVNEGCRIIEEGVIARASELDVASVLGFNFPSRLGGI  763

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+GA +IYTSLKKWS LY  G FF+PSRFLEERA+KGI L
Sbjct  764  MFWADTIGAKYIYTSLKKWSALY--GPFFRPSRFLEERAMKGIPL  806



>ref|XP_009604119.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana tomentosiformis]
Length=710

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  ++A  DR +QSPL+ L++++GR GK NGKGYY Y+KGSKP+ D SV+ ++E+S R T
Sbjct  544  KEFVAAFPDRAFQSPLVQLMVENGREGKKNGKGYYTYKKGSKPEADHSVIQVIEESMRYT  603

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NI PGGKPI+VTD+EI+EMI FPVVNEACRV++EGIVVRASD+D+AS+ G  FPS  GG+
Sbjct  604  NIAPGGKPIAVTDEEILEMIFFPVVNEACRVIEEGIVVRASDIDIASVHGFKFPSETGGV  663

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+G+ +IY+ LK W E Y  G+F+KPS FLE+RA KG+ L
Sbjct  664  MFWADTIGSEYIYSKLKTWHEAY--GDFYKPSTFLEQRAAKGLPL  706



>ref|XP_006365183.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365184.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Solanum tuberosum]
Length=710

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            +  ++A  DR +QSPL+ L++++GR GK NGKGYY Y KGSKP+ D SVL +VE+S RLT
Sbjct  544  EEFVAAYPDRAFQSPLVQLMVENGREGKKNGKGYYTYNKGSKPEADHSVLQIVEESMRLT  603

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NI P GKPISVTD+EI+EMI FPVVNEACRV++EGIVVRASD+D+AS+ G  FPS  GG+
Sbjct  604  NIAPAGKPISVTDEEILEMIFFPVVNEACRVIEEGIVVRASDIDIASVHGFKFPSETGGV  663

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+G  +IY+ LK W E Y  G+FFKPS FLE++A KG+ L
Sbjct  664  MFWADTIGCEYIYSKLKGWYEAY--GDFFKPSTFLEQKAAKGLPL  706



>ref|XP_010325170.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum lycopersicum]
Length=710

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            +  ++A  DR +QSPL+ L++++GR GK NGKGYY Y K SKP+ D SVL +VE+S RLT
Sbjct  544  EEFVAAYPDRAFQSPLVQLMVENGREGKKNGKGYYTYNKRSKPEADHSVLQIVEESMRLT  603

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            NI P GKPISVTD+EI+EMI FPVVNEACRV++EGIVVRASD+D+AS+ G  FP+  GG+
Sbjct  604  NIAPAGKPISVTDEEILEMIFFPVVNEACRVIEEGIVVRASDIDIASVHGFKFPTETGGV  663

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WADT+G+ +IY+ LK W E Y  G+FFKPS FLE++A KG+ L
Sbjct  664  MFWADTIGSEYIYSKLKGWYEAY--GDFFKPSTFLEQKAAKGLPL  706



>gb|EEE56720.1| hypothetical protein OsJ_06222 [Oryza sativa Japonica Group]
Length=273

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R   S L+DL++++GR GK+NGKGYY+YEKG KPKPDPSV  ++++ RR    MP
Sbjct  100  AAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVVIDEYRRCAKTMP  159

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WA
Sbjct  160  GGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMGFPKFRGGLVFWA  219

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +I++ L KW+E+Y  G+FFKPS +LE+RA + + L
Sbjct  220  DTIGAPYIHSKLSKWTEIY--GDFFKPSSYLEDRAKRSLPL  258



>ref|XP_008679760.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Zea mays]
Length=731

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  +R   S L+DL++K GR GK NGKGYYIYEKG KPKPDPSV  ++E+ R+  N MPG
Sbjct  559  AFGERNLDSDLVDLMVKDGRQGKVNGKGYYIYEKGGKPKPDPSVKHVIEEYRKHANTMPG  618

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKP+++TDQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP YRGG+V+WAD
Sbjct  619  GKPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKYRGGLVFWAD  678

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +I++ L KW+E+Y  G FFKPS +LE+RA  G+ L
Sbjct  679  TVGAPYIHSKLSKWAEIY--GPFFKPSSYLEQRAKSGVPL  716



>ref|XP_006647155.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Oryza brachyantha]
Length=726

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R + S L+DL++K+GR GK+NGKGYYIYEKG KPKPDPSV  ++E+ RR    +P
Sbjct  553  AAFGTRNFDSNLVDLMVKNGRQGKSNGKGYYIYEKGGKPKPDPSVQVVIEEYRRHVKTIP  612

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GG+P++++DQEI+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WA
Sbjct  613  GGQPVTLSDQEILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMGFPKFRGGLVFWA  672

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +IY+ L KW+E+Y  G+FFKPS +LEERA + + L
Sbjct  673  DTIGAPYIYSKLSKWAEIY--GDFFKPSSYLEERAKRNLSL  711



>ref|XP_002451943.1| hypothetical protein SORBIDRAFT_04g010370 [Sorghum bicolor]
 gb|EES04919.1| hypothetical protein SORBIDRAFT_04g010370 [Sorghum bicolor]
Length=727

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  +R   S L+DL++K GR GK NGKGYYIYEKG KPKPDPSV  ++E+ ++  N MPG
Sbjct  555  AFGERNLNSNLVDLMVKDGRQGKVNGKGYYIYEKGGKPKPDPSVKHVLEEYQKQANTMPG  614

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKP+++TDQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP YRGG+V+WAD
Sbjct  615  GKPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKYRGGLVFWAD  674

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +I++ L KW+E+Y  G FFKPS +LE+RA  G+ L
Sbjct  675  TVGAPYIHSKLSKWAEIY--GPFFKPSSYLEQRAKSGVPL  712



>ref|NP_001148087.1| LOC100281695 [Zea mays]
 gb|ACG29687.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Zea mays]
Length=727

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  +R   S L+ L++K GR GK N KGYYIYEKG+KPKPDPSV  ++E+ R+  N MPG
Sbjct  555  AFGERNLGSNLVGLMVKDGRQGKVNAKGYYIYEKGAKPKPDPSVKHVIEEYRKQANTMPG  614

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKP+++ DQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP YRGG+V+WAD
Sbjct  615  GKPVTLMDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKYRGGLVFWAD  674

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +I++ L KW+E+Y  G FFKPS +LE+RA  G+ L
Sbjct  675  TVGAPYIHSKLSKWAEMY--GPFFKPSSYLEQRAKSGVPL  712



>ref|XP_004952203.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X2 [Setaria italica]
Length=727

 Score =   184 bits (466),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  +R   S L+DL++K GR GK NGKGYYIYEKG KPKPDPSV  ++E+ R+    MPG
Sbjct  555  AFGERNLDSDLVDLMVKDGRQGKMNGKGYYIYEKGGKPKPDPSVQHVIEEYRKRAKTMPG  614

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKP+++TDQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WAD
Sbjct  615  GKPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKFRGGLVFWAD  674

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +IY+ L KW+E+Y  G +FKPS +LE+RA  G+ L
Sbjct  675  TVGAPYIYSKLSKWAEIY--GPYFKPSPYLEQRAKSGVPL  712



>ref|XP_004952202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X1 [Setaria italica]
Length=799

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPG  499
            A  +R   S L+DL++K GR GK NGKGYYIYEKG KPKPDPSV  ++E+ R+    MPG
Sbjct  555  AFGERNLDSDLVDLMVKDGRQGKMNGKGYYIYEKGGKPKPDPSVQHVIEEYRKRAKTMPG  614

Query  498  GKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWAD  319
            GKP+++TDQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WAD
Sbjct  615  GKPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKFRGGLVFWAD  674

Query  318  TVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            TVGA +IY+ L KW+E+Y  G +FKPS +LE+RA  G+ L
Sbjct  675  TVGAPYIYSKLSKWAEIY--GPYFKPSPYLEQRAKSGVPL  712



>dbj|BAJ93145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R + S L+DL+ ++GR GK+NGKGYY+YEKG++PKPDPSV  ++++ RR    MP
Sbjct  555  AAFGTRNFDSVLVDLMAETGRQGKSNGKGYYLYEKGARPKPDPSVQNVIDEYRRQAKTMP  614

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EM+ FPVVNEACRV+DE +V+RA+DLD+AS+LGM FP YRGG+++WA
Sbjct  615  GGKPVTLSDQDILEMVFFPVVNEACRVMDENVVIRAADLDIASVLGMGFPKYRGGLIFWA  674

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            DTVGA +I++ L KW+E+Y  G+FFKPS +LEERA  G
Sbjct  675  DTVGASYIHSKLSKWAEMY--GDFFKPSLYLEERAKSG  710



>dbj|BAJ91250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=692

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R + S L+DL+ ++GR GK+NGKGYY+YEKG++PKPDPSV  ++++ RR    MP
Sbjct  519  AAFGTRNFDSVLVDLMAETGRQGKSNGKGYYLYEKGARPKPDPSVQNVIDEYRRQAKTMP  578

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EM+ FPVVNEACRV+DE +V+RA+DLD+AS+LGM FP YRGG+++WA
Sbjct  579  GGKPVTLSDQDILEMVFFPVVNEACRVMDENVVIRAADLDIASVLGMGFPKYRGGLIFWA  638

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            DTVGA +I++ L KW+E+Y  G+FFKPS +LEERA  G
Sbjct  639  DTVGASYIHSKLSKWAEMY--GDFFKPSLYLEERAKSG  674



>dbj|BAK04391.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88897.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R + S L+DL+ ++GR GK+NGKGYY+YEKG++PKPDPSV  ++++ RR    MP
Sbjct  555  AAFGTRNFDSVLVDLMAETGRQGKSNGKGYYLYEKGARPKPDPSVQNVIDEYRRQAKTMP  614

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EM+ FPVVNEACRV+DE +V+RA+DLD+AS+LGM FP YRGG+++WA
Sbjct  615  GGKPVTLSDQDILEMVFFPVVNEACRVMDENVVIRAADLDIASVLGMGFPKYRGGLIFWA  674

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            DTVGA +I++ L KW+E+Y  G+FFKPS +LEERA  G
Sbjct  675  DTVGASYIHSKLSKWAEMY--GDFFKPSLYLEERAKSG  710



>ref|NP_001046536.1| Os02g0274100 [Oryza sativa Japonica Group]
 sp|Q8W1L6.2|MFP_ORYSJ RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein; Short=MFP; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Oryza sativa Japonica Group]
 dbj|BAD21833.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Oryza sativa Japonica Group]
 dbj|BAF08450.1| Os02g0274100 [Oryza sativa Japonica Group]
 gb|AGH17543.1| 3-hydroxyacyl-CoA dehydrogenase [Oryza sativa]
Length=726

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R   S L+DL++++GR GK+NGKGYY+YEKG KPKPDPSV  ++++ RR    MP
Sbjct  553  AAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVVIDEYRRCAKTMP  612

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WA
Sbjct  613  GGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMGFPKFRGGLVFWA  672

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +I++ L KW+E+Y  G+FFKPS +LE+RA + + L
Sbjct  673  DTIGAPYIHSKLSKWTEIY--GDFFKPSSYLEDRAKRSLPL  711



>gb|AAL35606.1|AF442962_1 peroxisomal multifunctional protein [Oryza sativa]
Length=725

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R   S L+DL++++GR GK+NGKGYY+YEKG KPKPDPSV  ++++ RR    MP
Sbjct  552  AAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVVIDEYRRCAKTMP  611

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WA
Sbjct  612  GGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMGFPKFRGGLVFWA  671

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +I++ L KW+E+Y  G+FFKPS +LE+RA + + L
Sbjct  672  DTIGAPYIHSKLSKWTEIY--GDFFKPSSYLEDRAKRSLPL  710



>gb|EEC72899.1| hypothetical protein OsI_06722 [Oryza sativa Indica Group]
Length=726

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R   S L+DL++++GR GK+NGKGYY+YEKG KPKPDPSV  ++++ RR    MP
Sbjct  553  AAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVVIDEYRRCAKTMP  612

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WA
Sbjct  613  GGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMGFPKFRGGLVFWA  672

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +I++ L KW+E+Y  G+FFKPS +LE+RA + + L
Sbjct  673  DTIGAPYIHSKLSKWTEIY--GDFFKPSSYLEDRAKRSLPL  711



>gb|AAQ13901.1| multifunctional protein [Oryza sativa]
Length=718

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R   S L+DL++++GR GK+NGKGYY+YEKG KPKPDPSV  ++++ RR    MP
Sbjct  545  AAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVVIDEYRRCAKTMP  604

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP +RGG+V+WA
Sbjct  605  GGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMGFPKFRGGLVFWA  664

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            DT+GA +I++ L KW+E+Y  G+FFKPS +LE+RA + + L
Sbjct  665  DTIGAPYIHSKLSKWTEIY--GDFFKPSSYLEDRAKRSLPL  703



>emb|CDM81268.1| unnamed protein product [Triticum aestivum]
Length=726

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R + S L+DL++++GR GK+NGKGYY+YEKG+KPKPDP+V  ++++ R+    MP
Sbjct  553  AAFGTRNFNSVLVDLMVETGRQGKSNGKGYYLYEKGAKPKPDPNVQHVIDEYRKQAKTMP  612

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP++++DQ+I+EM+ FPVVNEACRV+DE +V++A+DLD+AS+LGM FP YRGG+V+WA
Sbjct  613  GGKPVTLSDQDILEMVFFPVVNEACRVMDENVVIKAADLDIASVLGMGFPKYRGGLVFWA  672

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            DTVGA +I++ L KW+E Y  G+FFKPS +LEERA  G
Sbjct  673  DTVGASYIHSKLSKWAEAY--GDFFKPSSYLEERAKSG  708



>ref|XP_003572416.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Brachypodium distachyon]
Length=726

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A   R + S L+ L+ + GR GK NGKGYY+YEKG KPKPDPSV  ++++ R+    MP
Sbjct  553  AAFGTRNFDSDLVVLMAEDGRQGKINGKGYYLYEKGGKPKPDPSVQHVIDEYRKRAKTMP  612

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
             GKP++++DQ+I+EM+ FPVVNEACRV+DE +V+RASDLD+AS+LGM FP YRGG+++WA
Sbjct  613  DGKPVTLSDQDILEMVFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKYRGGLIFWA  672

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            DTVGA +IY+ L KW+ELY  G+FFKPS +LE+RA  G
Sbjct  673  DTVGASYIYSKLTKWAELY--GDFFKPSLYLEDRAKSG  708



>ref|XP_004952201.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Setaria italica]
Length=727

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 126/159 (79%), Gaps = 2/159 (1%)
 Frame = -2

Query  681  SAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMP  502
            +A  +R +   L+DL+++ GR GK+NGKGYYIYEKG KPKPDPSV  ++E+ R     MP
Sbjct  554  AAFGERNFSCDLMDLMVQDGRQGKSNGKGYYIYEKGRKPKPDPSVQHVIEEYRNRAKTMP  613

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
            GGKP+ +TD +I+EMI FPVVNEACRV+DE +V++ASDLD+AS+LGM FP YRGG+++WA
Sbjct  614  GGKPVILTDLDILEMIFFPVVNEACRVMDENVVIQASDLDIASVLGMGFPKYRGGLIFWA  673

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGI  205
            DTVGA +I++ L +W+E+YG   FFKPS +L +RA  GI
Sbjct  674  DTVGAPYIHSRLIQWAEIYGA--FFKPSSYLGQRAKSGI  710



>ref|XP_002978003.1| hypothetical protein SELMODRAFT_176660 [Selaginella moellendorffii]
 gb|EFJ20660.1| hypothetical protein SELMODRAFT_176660 [Selaginella moellendorffii]
Length=721

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            +  L++  +R Y S +  L+    R G+ N KG+Y+Y++  KP+P P +   V++SR+L 
Sbjct  548  QQYLNSFPERVYVSQIFPLMFSDKRLGEGNRKGFYLYDEKRKPRPAPELQGYVDKSRQLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +MPGGKPI++TD+EIVEMILFPVVNEACRVL+EG+VV+ASDLD+A++LGM FP Y+GG+
Sbjct  608  KLMPGGKPINITDKEIVEMILFPVVNEACRVLEEGVVVKASDLDIATVLGMGFPPYKGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD +GA +I + LK+WSE Y  G FF+PS FL+ RA +G +L
Sbjct  668  VFWADMIGAGYIASKLKEWSETY--GKFFQPSPFLQARASQGGKL  710



>ref|XP_002966745.1| hypothetical protein SELMODRAFT_168461 [Selaginella moellendorffii]
 gb|EFJ32772.1| hypothetical protein SELMODRAFT_168461 [Selaginella moellendorffii]
Length=721

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            +  L++  +R Y S +  L+    R G+ N KG+Y+Y++  KP+P P +   V++SR+L 
Sbjct  548  QQYLNSFPERVYVSQIFPLMFSDKRLGEGNRKGFYLYDEKRKPRPAPELQGYVDKSRQLA  607

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +MPGGKPI++TD+EIVEMILFPVVNEACRVL+EG+VV+ASDLD+A++LGM FP Y+GG+
Sbjct  608  KLMPGGKPINITDKEIVEMILFPVVNEACRVLEEGVVVKASDLDIATVLGMGFPPYKGGL  667

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            V+WAD +GA +I + LK+WSE Y  G FF+PS FL+ RA +G +L
Sbjct  668  VFWADMIGAGYIASKLKEWSETY--GKFFQPSPFLQARASQGGKL  710



>gb|KJB60709.1| hypothetical protein B456_009G321300 [Gossypium raimondii]
Length=140

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 2/99 (2%)
 Frame = -2

Query  495  KPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADT  316
            +PISVTD+EI EM+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSY GGI++WAD 
Sbjct  28   QPISVTDEEITEMVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYCGGIMFWADI  87

Query  315  VGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            VG+ HIY SLKKWSE Y  G++FKPSR+LEERA+KG+ L
Sbjct  88   VGSKHIYLSLKKWSERY--GSYFKPSRYLEERAMKGMPL  124



>ref|XP_001765398.1| predicted protein [Physcomitrella patens]
 gb|EDQ69861.1| predicted protein [Physcomitrella patens]
Length=722

 Score =   164 bits (414),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + A  DR Y S LL  ++++ R G+ N KG+Y+Y++  K +P P +  ++++S+  + 
Sbjct  550  QFVKAFPDRVYVSKLLPRMLEAQRLGEQNRKGFYVYDEKRKARPAPEIKEIIKESQAESG  609

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            IMP GKP+++TD++IVEMI+FPVVNEACRVL E IVV+ASDLD+AS+LGM FP YRGGIV
Sbjct  610  IMPNGKPLAMTDKDIVEMIMFPVVNEACRVLAEKIVVQASDLDIASVLGMGFPPYRGGIV  669

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
             WAD VGA +I + L  W+  Y  G FFKP  FLEERA  G+RL
Sbjct  670  CWADIVGAKYICSRLDTWARAY--GGFFKPCAFLEERAASGVRL  711



>gb|ACN27387.1| unknown [Zea mays]
Length=269

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S LL L+++  R G+   KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  104  ERVYKSMLLPLMMEGNRAGEATQKGFYKYEGKRKATPDPEIMKYIEKSRSMAGVTPDPEL  163

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG+++WAD++G
Sbjct  164  MKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMHWADSIG  223

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G FFKP  +L ERA KGI L
Sbjct  224  AKYIHGKLEEWTKRY--GGFFKPCSYLAERAAKGIPL  258



>ref|XP_009381090.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Musa acuminata subsp. malaccensis]
Length=723

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            L +  +R Y+S L+ ++++  R G+   KG+Y Y+   K  PDP ++  +E+SR +  + 
Sbjct  553  LQSFPERVYKSMLMSIMVEDKRTGEATRKGFYKYDGKRKASPDPELMKYIEKSRNMAGVT  612

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
            P  + + + D++IVEM+ FPVVNEACRVLDEGI V+ASDLD+AS++GM FP YRGGI++W
Sbjct  613  PNPELMKLPDKDIVEMVFFPVVNEACRVLDEGIAVKASDLDIASIMGMGFPPYRGGIMFW  672

Query  324  ADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ADT+GA +I+  L+ WS++Y  G+FFKP  +L ERA KGI L
Sbjct  673  ADTLGANYIFERLEAWSKMY--GDFFKPCSYLTERAAKGIPL  712



>gb|ABK24476.1| unknown [Picea sitchensis]
Length=726

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ ++++  R G+   KG+Y+Y+   K +PDP +   +E+SR +  ++  GKP
Sbjct  561  ERVYKSLLIPIMLEDKRAGEKTRKGFYLYDDRRKARPDPEIKKYIEKSRSMAGLIADGKP  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            +S+ D++IVEM+ FPVVNEACRVL EGI V+ASDLD+AS++GM FP YRGG+++WAD++G
Sbjct  621  LSLMDKDIVEMVFFPVVNEACRVLGEGITVQASDLDIASVMGMGFPPYRGGVMFWADSLG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ LK W+E Y  G+FFKP  FLEERA  G +L
Sbjct  681  SNYIYSKLKIWAESY--GDFFKPCPFLEERAATGSKL  715



>ref|XP_008645489.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Zea mays]
 gb|AFW70928.1| hypothetical protein ZEAMMB73_391659 [Zea mays]
Length=116

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 85/97 (88%), Gaps = 2/97 (2%)
 Frame = -2

Query  507  MPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVY  328
            MPGG+P+++TDQ+I+EMI FPVVNEACRV+DE +V+RASDLD+AS+LGM FP YRGG+V+
Sbjct  1    MPGGQPVTLTDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASVLGMGFPKYRGGLVF  60

Query  327  WADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERA  217
            WADTVGA +I++ L KW+E Y  G FF+PS +LE+RA
Sbjct  61   WADTVGAPYIHSKLSKWAETY--GPFFRPSSYLEQRA  95



>ref|XP_006644156.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Oryza brachyantha]
Length=724

 Score =   158 bits (400),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ L+++  R G+ + KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  559  ERVYKSMLIPLMMEDKRAGEASRKGFYKYEDKRKAIPDPEIMKYIEKSRSMAGVKPDTEL  618

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGGI++WAD++G
Sbjct  619  MKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGIMFWADSIG  678

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L+KW++ Y  GNFFKP  +L ERA KG+ L
Sbjct  679  AKYIHDKLEKWAKQY--GNFFKPCSYLAERAAKGVAL  713



>ref|XP_009393205.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Musa acuminata subsp. malaccensis]
Length=719

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            L +  +R Y+S L+ ++I+  R G+ +GKG+Y Y++     PDP ++  VE+SR + ++ 
Sbjct  557  LQSYPERVYKSMLMSVMIEDKREGEASGKGFYKYDEKRNASPDPEIIKYVEKSRNMASVT  616

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
            P  + + + D++IVEM+LFPV+NEACR+LDEGI V+A+DLD+A+++GM FP+YRGGI++W
Sbjct  617  PNPQLMEIPDEDIVEMLLFPVINEACRILDEGIAVKATDLDIATVMGMGFPAYRGGIMFW  676

Query  324  ADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            AD++GA +I   L++WS+LY  GN FKP  +L +RA KGI L
Sbjct  677  ADSLGANYICEKLEEWSKLY--GNLFKPCSYLTDRAAKGILL  716



>gb|AFW80681.1| hypothetical protein ZEAMMB73_867373 [Zea mays]
Length=460

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S LL L+++  R G+   KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  295  ERVYKSMLLPLMMEGNRAGEATQKGFYKYEGKRKATPDPEIMKYIEKSRSMAGVTPDPEL  354

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG+++WAD++G
Sbjct  355  MKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMHWADSIG  414

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G FFKP  +L ERA KGI L
Sbjct  415  AKYIHGKLEEWTKRY--GGFFKPCSYLAERAAKGIPL  449



>ref|XP_004968710.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Setaria italica]
Length=723

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S LL L+++  R G+   KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  558  ERVYKSMLLPLMMEDNRAGEATQKGFYKYEGKRKATPDPEIMKYIEKSRSMAGVTPDPEL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG++YWAD++G
Sbjct  618  LKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMYWADSIG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G+FFKP  +L ERA KGI L
Sbjct  678  AKYIHGKLEEWTKRY--GSFFKPCSYLAERAAKGIPL  712



>gb|ACN35901.1| unknown [Zea mays]
 gb|AFW80683.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
Length=723

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S LL L+++  R G+   KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  558  ERVYKSMLLPLMMEGNRAGEATQKGFYKYEGKRKATPDPEIMKYIEKSRSMAGVTPDPEL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG+++WAD++G
Sbjct  618  MKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMHWADSIG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G FFKP  +L ERA KGI L
Sbjct  678  AKYIHGKLEEWTKRY--GGFFKPCSYLAERAAKGIPL  712



>ref|NP_001152306.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
 gb|ACG46924.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
Length=723

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S LL L+++  R G+   KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  558  ERVYKSMLLPLMMEDNRAGEATQKGFYKYEGKRKATPDPEIMKYIEKSRSMAGVTPDPEL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG+++WAD++G
Sbjct  618  MKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMHWADSIG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G FFKP  +L ERA KGI L
Sbjct  678  AKYIHGKLEEWTKRY--GGFFKPCSYLAERAAKGIPL  712



>ref|XP_008784762.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X3 [Phoenix dactylifera]
Length=636

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            L +  +R Y+S L+ ++++  R G+++ KG+Y+Y++  K  PDP +   +E+SR ++ + 
Sbjct  466  LQSFPERCYRSMLIPIMLQDKRIGESSRKGFYVYDEKWKASPDPDIKKYIEKSRSISAVT  525

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
             G K I + D++I+EMI FPVVNEACRVLDEGI  ++SDLD+AS++GM FPSYRGG ++W
Sbjct  526  QGPKVIELADKDIIEMIFFPVVNEACRVLDEGIASKSSDLDIASIMGMGFPSYRGGTMFW  585

Query  324  ADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            AD++GA ++++ L++WS++Y  G+FFKP  +L+ERA  G
Sbjct  586  ADSLGANYVFSRLEEWSKMY--GDFFKPCAYLKERATSG  622



>ref|XP_001773623.1| predicted protein [Physcomitrella patens]
 gb|EDQ61511.1| predicted protein [Physcomitrella patens]
Length=732

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
             ++++ +DR Y S L+  +++S R G+ NGKG+YIY++  K +P P +  ++++S+    
Sbjct  560  QVVNSFSDRVYISRLVPKMLQSQRLGEQNGKGFYIYDEKRKARPAPEIKDIIKESQEEAG  619

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            IM  GKP+ +TD++IVEM++FPVVNEACRVL E IVV+ASDLD+AS+ GM FP YRGGIV
Sbjct  620  IMLDGKPLELTDKDIVEMVMFPVVNEACRVLAEKIVVQASDLDIASVFGMGFPPYRGGIV  679

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
             WAD +GA +I + L  W++ +  G+FFKP  FLEERA  G++L
Sbjct  680  CWADIIGAKYIASRLNTWTKAH--GDFFKPCAFLEERASSGVKL  721



>ref|XP_003550336.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Glycine max]
 gb|KHN03350.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
MFP2 [Glycine soja]
Length=722

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   KP PDP +   +E++R  T +    K 
Sbjct  557  ERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKCKPSPDPELKNYIEKARSFTGVSVDPKL  616

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++I+EM  FPVVNEACRVLDEGI V+ SDLD+++++GM FP YRGGI++WAD++G
Sbjct  617  VKLQEKDIIEMTFFPVVNEACRVLDEGIAVKGSDLDISAVMGMGFPPYRGGILFWADSLG  676

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP  +L  RA KGI L
Sbjct  677  SKYIYSKLEKWSELY--GEFFKPCAYLAARAAKGIPL  711



>ref|XP_004508202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Cicer arietinum]
Length=722

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  557  ERTYKSMLIPLLQEDKRAGEATRKGFYLYDDRRKASPDPELKKFIEKARSISGVSVDPKL  616

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  617  VKLQEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAVMGMGFPPYRGGIIFWADSLG  676

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G+FFKP  +L  RA KGI L
Sbjct  677  SKYIYSRLEKWSELY--GSFFKPCAYLAARAAKGIPL  711



>ref|XP_008784760.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Phoenix dactylifera]
Length=719

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            L +  +R Y+S L+ ++++  R G+++ KG+Y+Y++  K  PDP +   +E+SR ++ + 
Sbjct  549  LQSFPERCYRSMLIPIMLQDKRIGESSRKGFYVYDEKWKASPDPDIKKYIEKSRSISAVT  608

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
             G K I + D++I+EMI FPVVNEACRVLDEGI  ++SDLD+AS++GM FPSYRGG ++W
Sbjct  609  QGPKVIELADKDIIEMIFFPVVNEACRVLDEGIASKSSDLDIASIMGMGFPSYRGGTMFW  668

Query  324  ADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            AD++GA ++++ L++WS++Y  G+FFKP  +L+ERA  G  L
Sbjct  669  ADSLGANYVFSRLEEWSKMY--GDFFKPCAYLKERATSGTPL  708



>ref|XP_008784761.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Phoenix dactylifera]
Length=690

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            L +  +R Y+S L+ ++++  R G+++ KG+Y+Y++  K  PDP +   +E+SR ++ + 
Sbjct  520  LQSFPERCYRSMLIPIMLQDKRIGESSRKGFYVYDEKWKASPDPDIKKYIEKSRSISAVT  579

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
             G K I + D++I+EMI FPVVNEACRVLDEGI  ++SDLD+AS++GM FPSYRGG ++W
Sbjct  580  QGPKVIELADKDIIEMIFFPVVNEACRVLDEGIASKSSDLDIASIMGMGFPSYRGGTMFW  639

Query  324  ADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            AD++GA ++++ L++WS++Y  G+FFKP  +L+ERA  G  L
Sbjct  640  ADSLGANYVFSRLEEWSKMY--GDFFKPCAYLKERATSGTPL  679



>ref|XP_003569321.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brachypodium distachyon]
Length=748

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    +  +R Y+S L D+++K  R G+++G+GYY+Y+   K  PDP +   VE+SR + 
Sbjct  575  KQYYQSFPERCYKSMLTDIMLKDKRTGESSGRGYYLYDDKRKASPDPDIQKYVEKSRNMA  634

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +    K + +TD +IVEM+ FPVVNEACRVLDEGI ++ASDLDVAS++GM FPSYRGG+
Sbjct  635  GVAKDPKVMKLTDSDIVEMVFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSYRGGV  694

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD++GA +++  L+ WS+ Y  G FF+P  +L  RA +G  L
Sbjct  695  MFWADSLGAEYVFKRLEAWSKDY--GEFFRPCEYLAARARQGASL  737



>gb|AES91892.2| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=723

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +      
Sbjct  558  ERTYKSMLIPLLQEDKRAGETTRKGFYLYDDRRKASPDPELKKFIEKARSISGVSVDPML  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++I+EMI FPVVNEACRVLDEGIVV+A+DLD+A+++GM FP YRGGI++WAD++G
Sbjct  618  VKLQEKDIIEMIFFPVVNEACRVLDEGIVVKAADLDIAAIMGMGFPPYRGGIIFWADSLG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP  +L  RA KGI L
Sbjct  678  SKYIYSRLEKWSELY--GPFFKPCAYLAARAAKGIPL  712



>ref|XP_003609695.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Medicago truncatula]
Length=724

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +      
Sbjct  559  ERTYKSMLIPLLQEDKRAGETTRKGFYLYDDRRKASPDPELKKFIEKARSISGVSVDPML  618

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++I+EMI FPVVNEACRVLDEGIVV+A+DLD+A+++GM FP YRGGI++WAD++G
Sbjct  619  VKLQEKDIIEMIFFPVVNEACRVLDEGIVVKAADLDIAAIMGMGFPPYRGGIIFWADSLG  678

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP  +L  RA KGI L
Sbjct  679  SKYIYSRLEKWSELY--GPFFKPCAYLAARAAKGIPL  713



>dbj|BAJ86175.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=761

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            DR Y+S L+ ++++  R G+ + KG+Y YE   K  PDP ++  +++SR +  + P  + 
Sbjct  595  DRVYKSMLIPIMMEDKRAGEASRKGFYKYEDKRKATPDPEIMTYIQKSRSMAGVTPDAEL  654

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG++ W D++G
Sbjct  655  MKLSDKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMLWGDSIG  714

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G+FF+P  +L ERA KGI L
Sbjct  715  AKYIHEKLQQWAKRY--GSFFEPCSYLAERAAKGIPL  749



>ref|XP_010921650.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like [Elaeis guineensis]
Length=720

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            L +  +R Y+S L+ ++++  R G+++ KG+Y+Y+   K  PDP +   +E+SR ++ + 
Sbjct  549  LQSFPERCYRSMLIPIMLEDKRTGESSRKGFYVYDGKRKASPDPDIKKYIEKSRSISGVT  608

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
               K I + D++I+E++ FPVVNEACRVLDEGI  +ASDLD+AS++GM FPSYRGG ++W
Sbjct  609  QSPKVIELADKDIIEIVFFPVVNEACRVLDEGIASKASDLDIASIMGMGFPSYRGGTMFW  668

Query  324  A-DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A D++GA ++Y+ L++WS++Y  G+FFKP  +L+ERA +GI L
Sbjct  669  ATDSLGANYVYSRLEEWSKMY--GDFFKPCAYLKERATRGISL  709



>ref|XP_008649523.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X1 [Zea mays]
 gb|AFW77664.1| hypothetical protein ZEAMMB73_186479 [Zea mays]
Length=718

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R+Y+S LL +L++  R G+++ KG+Y+Y+   K   DP     +E+SR +  +M   K 
Sbjct  553  ERSYKSMLLQILVEDNRTGESSCKGFYVYDDKRKASRDPDFGKYIEKSRNMAGVMQDPKL  612

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +TD +IVEMI FPVVNEACRVLDEGI ++ASDLDVAS++GM FPSYRGG+++WAD++G
Sbjct  613  MKLTDNDIVEMIFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSYRGGVMFWADSLG  672

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A ++Y  L  WS+ Y  G FF+P  +L  RA +G  L
Sbjct  673  AKYVYDKLDAWSKDY--GEFFRPCEYLAVRARQGASL  707



>ref|XP_008649524.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X2 [Zea mays]
Length=689

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    +  +R+Y+S LL +L++  R G+++ KG+Y+Y+   K   DP     +E+SR + 
Sbjct  516  KQYYQSYPERSYKSMLLQILVEDNRTGESSCKGFYVYDDKRKASRDPDFGKYIEKSRNMA  575

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +M   K + +TD +IVEMI FPVVNEACRVLDEGI ++ASDLDVAS++GM FPSYRGG+
Sbjct  576  GVMQDPKLMKLTDNDIVEMIFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSYRGGV  635

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD++GA ++Y  L  WS+ Y  G FF+P  +L  RA +G  L
Sbjct  636  MFWADSLGAKYVYDKLDAWSKDY--GEFFRPCEYLAVRARQGASL  678



>gb|KEH37224.1| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=721

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S +L L+ +  R G+   KG+Y+Y+   +  PDP +   +E+SR ++ +    K 
Sbjct  556  ERTYKSMILPLMQEDKRAGEATRKGFYLYDDKRRANPDPELKNYIEKSRNISGVTVDPKL  615

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  616  VKLSEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAVMGMGFPPYRGGIIFWADSLG  675

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L +WS+LY  G FFKPS +L  RA KGI L
Sbjct  676  SKYIYSRLSEWSKLY--GEFFKPSAYLAARAAKGIPL  710



>gb|KHN02955.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Glycine soja]
Length=724

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  558  ERTYKSMLIPLLQEDNRAGETTRKGFYLYDDKRKASPDPELKNYIEKARSISGVSVDPKL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  618  AKLQEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAIMGMGFPPYRGGIIFWADSLG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP  +L  RA KGI L
Sbjct  678  SKYIYSRLEKWSELY--GEFFKPCAYLAARAAKGIPL  712



>ref|XP_003529561.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Glycine max]
Length=724

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  558  ERTYKSMLIPLLQEDNRAGETTRKGFYLYDDKRKASPDPELKNYIEKARSISGVSVDPKL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  618  AKLQEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAIMGMGFPPYRGGIIFWADSLG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP  +L  RA KGI L
Sbjct  678  SKYIYSRLEKWSELY--GEFFKPCAYLAARAAKGIPL  712



>ref|XP_010931678.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Elaeis guineensis]
Length=722

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ ++++  R+G+   KG+Y Y++  K  PDP +   +E+SR +  I P  + 
Sbjct  557  ERVYKSLLMSIMLEDKRSGEATRKGFYKYDEKRKASPDPEIKKYIEKSRSMAGITPDLEL  616

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + D++IVEM+  PVVNEACRVLDEGIVV+ASDLD+AS++GM FP YRGGI++WAD++G
Sbjct  617  MKLADKDIVEMVFLPVVNEACRVLDEGIVVKASDLDIASIMGMGFPPYRGGIMFWADSLG  676

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A ++++ L  WS  Y  G  FKP  +L ERA KG+ L
Sbjct  677  ANYVHSKLNAWSNKY--GQLFKPCTYLAERASKGLSL  711



>gb|EMT14631.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Aegilops tauschii]
Length=456

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    +  +R Y+S L +++++  R G+++ +G+Y+Y    +  PDP +   VE+SR + 
Sbjct  282  KQYYKSYPERCYKSRLTEIMLEENRTGESSHRGFYLYNDKRQASPDPDIKKYVEKSRNMA  341

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +    K + +TD++IVEM+ FPVVNEACRVLDEGI ++ASDLDVAS++GM FPS+RGG+
Sbjct  342  GVAQDPKLMKLTDKDIVEMVFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSFRGGV  401

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD++GA ++Y  L  WS+ Y  G FF+P  +L  RA +G  L
Sbjct  402  MFWADSLGAEYVYRRLDAWSKDY--GEFFRPCEYLAARASRGTSL  444



>ref|XP_002439650.1| hypothetical protein SORBIDRAFT_09g017970 [Sorghum bicolor]
 gb|EES18080.1| hypothetical protein SORBIDRAFT_09g017970 [Sorghum bicolor]
Length=718

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = -2

Query  666  RTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKPI  487
            R Y+S +L +L++  R G+++ KG+Y+Y+   K   DP +   +E+SR +  +M   K +
Sbjct  554  RCYKSMILQILVEDNRTGESSRKGFYVYDNKRKASRDPDLGKYIEKSRNMAGVMQDPKLM  613

Query  486  SVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVGA  307
             +TD +IVEMI FPVVNEACRVLDEGI ++ASDLDVAS++GM FPSYRGG+++WAD++GA
Sbjct  614  KLTDNDIVEMIFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSYRGGLMFWADSLGA  673

Query  306  MHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
             ++Y  L  WS+ Y  G FF+P  +L  RA +G+ L
Sbjct  674  KYVYDRLDAWSKDY--GEFFRPCEYLAVRARQGVSL  707



>gb|KDO71720.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=403

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ ++ +  R G+   KG+Y+Y++  K  PDP V   +E++R ++ +    K 
Sbjct  238  ERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKF  297

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              +++++IVEMI FPVVNEACRV  EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  298  AKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  357

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS LY  G FFKP  FL ERA KG  L
Sbjct  358  SKYIYSRLEEWSSLY--GEFFKPCAFLAERAGKGATL  392



>emb|CDM81353.1| unnamed protein product [Triticum aestivum]
 emb|CDM81375.1| unnamed protein product [Triticum aestivum]
Length=724

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ ++++  R G+ + KG+Y YE   K  PDP ++  +++SR +  + P  + 
Sbjct  558  ERVYKSMLIPIMMEDKRAGEASRKGFYKYEDRRKATPDPEIMTYIQKSRSMAGVTPDAEL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG++ W D++G
Sbjct  618  MKLSDKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMLWGDSIG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G+FF+P  +L ERA KGI L
Sbjct  678  AKYIHGKLQEWAKRY--GSFFEPCSYLAERAAKGIPL  712



>gb|EMT06606.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Aegilops tauschii]
Length=747

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ ++++  R G+ + KG+Y YE   K  PDP ++  +++SR +  + P  + 
Sbjct  581  ERVYKSMLIPIMMEDKRAGEASRKGFYKYEDKRKATPDPEIMTYIQKSRSMAGVTPDAEL  640

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG++ W D++G
Sbjct  641  MKLSDKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMLWGDSIG  700

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L++W++ Y  G+FF+P  +L ERA KGI L
Sbjct  701  AKYIHGKLQEWAKRY--GSFFEPCSYLAERAAKGIPL  735



>ref|XP_007154174.1| hypothetical protein PHAVU_003G096400g [Phaseolus vulgaris]
 gb|ESW26168.1| hypothetical protein PHAVU_003G096400g [Phaseolus vulgaris]
Length=779

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  614  ERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKRKASPDPELKNYIEKARGISGVSVDPKL  673

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD+ G
Sbjct  674  AKIPEKDIVEMIFFPVVNEACRVLDEGIAVKAADLDISAIMGMGFPPYRGGIIFWADSFG  733

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP  +L  RA KGI L
Sbjct  734  SKYIYSRLQKWSELY--GEFFKPCAYLAARAAKGIPL  768



>gb|KJB84050.1| hypothetical protein B456_N005500 [Gossypium raimondii]
Length=154

 Score =   140 bits (354),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = -2

Query  459  MILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKK  280
            M+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSY GGI++WADTVG+ HIY SLKK
Sbjct  1    MVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYCGGIMFWADTVGSKHIYLSLKK  60

Query  279  WSELYGIGNFFKPSRFLEERALKGI  205
            WSE Y   ++FKPSR+LEERA+KG+
Sbjct  61   WSERY--DSYFKPSRYLEERAMKGM  83



>ref|XP_004173119.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like, partial [Cucumis 
sativus]
Length=459

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            DRT++S ++ L+ +  R G+   KG+Y+Y+K  K KPDP +   +E++R ++ I    K 
Sbjct  294  DRTFKSMIIPLMQEDKRAGETTQKGFYLYDKNRKSKPDPELKKYIEKARSMSGISVDPKL  353

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V+A+DLD+A ++GM FP YRGG+++WAD++G
Sbjct  354  AKISDKDIIEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPPYRGGVMFWADSLG  413

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L ERA +G  L
Sbjct  414  SKYIYSRLEEWSKLY--GGFFKPCAYLAERAAQGSTL  448



>ref|NP_001234975.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Glycine max]
 dbj|BAG09370.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Glycine max]
Length=723

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y    K  PDP +   +E++R ++ +    K 
Sbjct  558  ERTYKSMLISLLQEDKRAGETTHKGFYLYNDKRKASPDPELKNYIEKARSISGVSVDPKL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  618  AKLQEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAIMGMGFPPYRGGIIFWADSLG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP   L  RA KGI L
Sbjct  678  SKYIYSRLEKWSELY--GEFFKPCANLAARAAKGIPL  712



>ref|XP_004487834.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Cicer arietinum]
Length=721

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S LL L+ +  R G+   KG+Y+Y    +  PDP +   +E+SR ++ +    K 
Sbjct  556  ERTYKSMLLPLMQEDKRAGEATRKGFYLYNDKRRANPDPELKNYIEKSRNISGVTVDPKL  615

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            +++++++I+EM  FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  616  VNLSEKDIIEMTFFPVVNEACRVLDEGIAVKAADLDISAVMGMGFPPYRGGIIFWADSLG  675

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L  RA KGI L
Sbjct  676  SKYIYSRLEEWSKLY--GEFFKPCAYLAARAAKGIPL  710



>gb|KHN03349.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Glycine soja]
Length=719

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y    K  PDP +   +E++R ++ +    K 
Sbjct  558  ERTYKSMLISLLQEDKRAGETTHKGFYLYNDKRKASPDPELKNYIEKARSISGVSVDPKL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  618  AKLQEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAIMGMGFPPYRGGIIFWADSLG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP   L  RA KGI L
Sbjct  678  SKYIYSRLEKWSELY--GEFFKPCANLAARAAKGIPL  712



>dbj|BAJ85471.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L ++++K  R G+++ +G+Y+Y+   +  PDP +   VE SR +  +    K 
Sbjct  553  ERCYKSHLTEIMLKENRTGESSRRGFYLYDDKREASPDPDIKKYVENSRNMAGVAQDPKL  612

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +TD++IVEM+ FPVVNEACRVLDEGI ++ASDLDVAS++GM FPS+RGG+++WAD++G
Sbjct  613  LKLTDKDIVEMVFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSFRGGVMFWADSLG  672

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A ++Y  L  WS+ Y  G FFKP  +L  RA  G  L
Sbjct  673  AEYVYRRLDAWSKDY--GEFFKPCEYLASRASCGTSL  707



>gb|EMS61353.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Triticum urartu]
Length=715

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ ++++  R+G+ + KG+Y YE   K  PDP ++  +++SR +  + P  + 
Sbjct  549  ERVYKSMLIPIMMEDKRSGEASRKGFYKYEDKRKATPDPEIMTYIQKSRSMAGVTPDAEL  608

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG++ W D++G
Sbjct  609  MKLSDKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMLWGDSIG  668

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L +W++ Y  G+FF+P  +L ERA KGI L
Sbjct  669  AKYIHGKLAEWAKRY--GSFFEPCSYLAERAAKGIPL  703



>ref|XP_006600114.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein isoform X1 [Glycine max]
Length=759

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y    K  PDP +   +E++R ++ +    K 
Sbjct  558  ERTYKSMLISLLQEDKRAGETTHKGFYLYNDKRKASPDPELKNYIEKARSISGVSVDPKL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++I+EMI FPVVNEACRVLDEGI V+A+DLD+++++GM FP YRGGI++WAD++G
Sbjct  618  AKLQEKDIIEMIFFPVVNEACRVLDEGIAVKAADLDISAIMGMGFPPYRGGIIFWADSLG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWSELY  G FFKP   L  RA KGI L
Sbjct  678  SKYIYSRLEKWSELY--GEFFKPCANLAARAAKGIPL  712



>gb|KJB72710.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=662

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y Y+   KP PDP +   +E+SR ++ +    K 
Sbjct  497  ERTYKSMLVPLMQEDKRTGEGTRKGFYSYDNERKPSPDPELYKYIEKSRSISGVAVDPKF  556

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNE CRVL EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  557  VKLSDKDIVEMIFFPVVNETCRVLAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  616

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY  L++W+++Y  G FFKP  FL E A KG
Sbjct  617  SNYIYCRLEEWTKMY--GEFFKPCAFLAELAAKG  648



>gb|KJB84048.1| hypothetical protein B456_N005500 [Gossypium raimondii]
 gb|KJB84049.1| hypothetical protein B456_N005500 [Gossypium raimondii]
Length=171

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = -2

Query  459  MILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKK  280
            M+LFP +NEACRVLDEG+V RASDLDVAS+LGMSFPSY GGI++WADTVG+ HIY SLKK
Sbjct  1    MVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSYCGGIMFWADTVGSKHIYLSLKK  60

Query  279  WSELYGIGNFFKPSRFLEERALKGIRL  199
            WSE Y   ++FKPSR+LEERA+KG+ L
Sbjct  61   WSERY--DSYFKPSRYLEERAMKGMPL  85



>gb|KJB72711.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=712

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y Y+   KP PDP +   +E+SR ++ +    K 
Sbjct  547  ERTYKSMLVPLMQEDKRTGEGTRKGFYSYDNERKPSPDPELYKYIEKSRSISGVAVDPKF  606

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNE CRVL EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  607  VKLSDKDIVEMIFFPVVNETCRVLAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  666

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY  L++W+++Y  G FFKP  FL E A KG
Sbjct  667  SNYIYCRLEEWTKMY--GEFFKPCAFLAELAAKG  698



>ref|XP_003578000.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brachypodium distachyon]
Length=723

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ L+++  R G+  GKG+Y YE   K  PDP ++  +++SR +  + P  + 
Sbjct  558  ERVYKSMLIPLMMEDKRAGEATGKGFYKYEGKRKSTPDPDIMTYIQKSRSMAGVTPDPEL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGG++ W D++G
Sbjct  618  MKLSDKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGVMLWGDSIG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L+ W++ Y  G+FF+P  +L ERA KGI L
Sbjct  678  AKYIHGKLQGWAKRY--GSFFEPCSYLAERAAKGIPL  712



>ref|XP_010039870.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Eucalyptus grandis]
 gb|KCW84803.1| hypothetical protein EUGRSUZ_B01603 [Eucalyptus grandis]
Length=724

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              L    +RTY+S L+ +L K  R G++  KG+Y Y++  K   DP +   +E++R ++ 
Sbjct  552  QFLEKFPERTYKSMLIPILQKDKRAGESTNKGFYQYDQRRKATADPDLEKYIEKARSISG  611

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K +++ + +IVEMI FPVVNEACR+L EGI V+A+DLD+A+++GM FP YRGGIV
Sbjct  612  VTVDSKLVNIAEDDIVEMIFFPVVNEACRILAEGIAVKAADLDIAAVMGMGFPPYRGGIV  671

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ HI + L +WS++Y  G+FFKP  +L ERA KGI L
Sbjct  672  FWADSLGSKHICSRLDEWSKMY--GDFFKPCPYLAERAAKGIPL  713



>gb|KJB72706.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
 gb|KJB72708.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=725

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y Y+   KP PDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSMLVPLMQEDKRTGEGTRKGFYSYDNERKPSPDPELYKYIEKSRSISGVAVDPKF  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNE CRVL EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  620  VKLSDKDIVEMIFFPVVNETCRVLAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY  L++W+++Y  G FFKP  FL E A KG
Sbjct  680  SNYIYCRLEEWTKMY--GEFFKPCAFLAELAAKG  711



>gb|KDO71719.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=560

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ ++ +  R G+   KG+Y+Y++  K  PDP V   +E++R ++ +    K 
Sbjct  395  ERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKF  454

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              +++++IVEMI FPVVNEACRV  EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  455  AKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  514

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS LY  G FFKP  FL ERA KG  L
Sbjct  515  SKYIYSRLEEWSSLY--GEFFKPCAFLAERAGKGATL  549



>gb|KDO71723.1| hypothetical protein CISIN_1g008576mg [Citrus sinensis]
Length=561

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ ++ +  R G+   KG+Y+Y++  K  PDP V   +E++R ++ +    K 
Sbjct  395  ERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKF  454

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              +++++IVEMI FPVVNEACRV  EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  455  AKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  514

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS LY  G FFKP  FL ERA KG  L
Sbjct  515  SKYIYSRLEEWSSLY--GEFFKPCAFLAERAGKGATL  549



>gb|KGN47431.1| hypothetical protein Csa_6G319770 [Cucumis sativus]
Length=725

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            DRT++S ++ L+ +  R G+   KG+Y+Y+K  K KPDP +   +E++R ++ I    K 
Sbjct  560  DRTFKSMIIPLMQEDKRAGETTQKGFYLYDKKRKSKPDPELKKYIEKARSMSGISVDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V+A+DLD+A ++GM FP YRGG+++WAD++G
Sbjct  620  AKISDKDIIEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPPYRGGVMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L ERA +G  L
Sbjct  680  SKYIYSRLEEWSKLY--GGFFKPCAYLAERAAQGSTL  714



>gb|KHG21753.1| Peroxisomal fatty acid beta-oxidation multifunctional MFP2 -like 
protein [Gossypium arboreum]
Length=725

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y Y    KP PDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSMLVPLMQEDKRTGEATRKGFYSYNNNRKPSPDPELYKYIEKSRSISGVAVDPKF  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNE CRVL EGI V+ +DLD+AS++GM FP YRGGI++WAD++G
Sbjct  620  VKLSDKDIVEMIFFPVVNETCRVLAEGIAVKGADLDIASVMGMGFPPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY  L++W+++Y  G FFKP  FL E A KG
Sbjct  680  SNYIYCRLEEWTKMY--GEFFKPCAFLAEMAAKG  711



>gb|EPS70422.1| hypothetical protein M569_04343 [Genlisea aurea]
Length=96

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = -2

Query  459  MILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKK  280
            M+L P+VNEACRVLDEG+V+RASDLDVA++LG+SFPSYRGGIVYWAD++GA +IY  L+K
Sbjct  1    MVLLPMVNEACRVLDEGVVIRASDLDVATVLGISFPSYRGGIVYWADSLGADYIYRKLQK  60

Query  279  WSELYGIGNFFKPSRFLEERALKGIRL  199
            W EL+  GNFFKPSRFL ERA +GI L
Sbjct  61   WYELF--GNFFKPSRFLVERATRGIPL  85



>gb|KCW61184.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=581

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L  LL +  R G+   KG+Y+Y+   K  PDP +   VE++R ++ +    K 
Sbjct  416  ERTYKSMLTPLLQEDKRLGEATRKGFYLYDDRRKASPDPELKKYVEKARSISGVSIDPKL  475

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++IVEM  FPVVNEACRVLDEGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  476  VKLLEKDIVEMTFFPVVNEACRVLDEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  535

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L  RA +GI L
Sbjct  536  SKYIYSRLEEWSKLY--GGFFKPCVYLANRAARGIPL  570



>ref|XP_007221966.1| hypothetical protein PRUPE_ppa002036mg [Prunus persica]
 gb|EMJ23165.1| hypothetical protein PRUPE_ppa002036mg [Prunus persica]
Length=725

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ + GR G++  KG+Y Y    K  PDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSMLIPLMQEDGRAGESTRKGFYTYGDKRKASPDPELKKYIEKSRSISGVSIDSKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEMI FPVVNEACRVL EGI V+A+DLD+A+++GM FP YRGGI++WAD +G
Sbjct  620  LKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAAVMGMGFPPYRGGILFWADLLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS +Y  G FFKP  +L ERA KG  L
Sbjct  680  SKYIYSRLEEWSNIY--GEFFKPCAYLAERAAKGASL  714



>gb|KJB18729.1| hypothetical protein B456_003G067500 [Gossypium raimondii]
Length=101

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = -2

Query  459  MILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKK  280
            M+LFP++NE CRVLDEG+V RASDL+VAS+LGMSFPSY GG+++WAD VG+ HIY SLKK
Sbjct  1    MVLFPMINEVCRVLDEGVVARASDLNVASVLGMSFPSYCGGLMFWADRVGSKHIYLSLKK  60

Query  279  WSELYGIGNFFKPSRFLEERALKGIRL  199
            WSE Y  G++FKPSR+LEERA+KG+ L
Sbjct  61   WSERY--GSYFKPSRYLEERAMKGMPL  85



>ref|XP_006419532.1| hypothetical protein CICLE_v10004429mg [Citrus clementina]
 gb|ESR32772.1| hypothetical protein CICLE_v10004429mg [Citrus clementina]
Length=725

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            ++TY+S ++ ++ +  R G+   KG+Y+Y++  K  PDP V   +E++R ++ +    K 
Sbjct  560  EQTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAIDPKF  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              +++++IVEMI FPVVNEACRV  EGI V+A+DLD+AS++GM FP+YRGGI++WAD++G
Sbjct  620  AKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPAYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS LY  G FFKP  FL ERA KG  L
Sbjct  680  SKYIYSRLEEWSSLY--GEFFKPCAFLAERAAKGATL  714



>ref|XP_008810214.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Phoenix dactylifera]
Length=723

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (73%), Gaps = 2/124 (2%)
 Frame = -2

Query  570  KPKPDPSVLPLVEQSRRLTNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRAS  391
            K  PDP +   +E+SR +  I P  + + + D++IVEM+  PVVNEACRVLDEGI V+AS
Sbjct  591  KASPDPEIKKYIEKSRSMAGITPDLELMKLADKDIVEMVFLPVVNEACRVLDEGIAVKAS  650

Query  390  DLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALK  211
            DLD+AS++GM FP YRGGI++WAD++GA +I++ L  WS +Y  G  FKP  +L ERA K
Sbjct  651  DLDIASIMGMGFPPYRGGIMFWADSLGANYIHSRLDAWSNMY--GELFKPCTYLAERASK  708

Query  210  GIRL  199
            G+ L
Sbjct  709  GLSL  712



>gb|EEC79068.1| hypothetical protein OsI_19644 [Oryza sativa Indica Group]
Length=718

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  L +  +R Y+S L+ ++++  R G+++ KG+Y+Y+   K  PDP +   +E+SR + 
Sbjct  545  KQYLQSYPERCYKSMLIQIMLEENRTGESSRKGFYLYDDKRKASPDPEMNKYIEKSRSMA  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            +I+   K   +TD EIVEM+LFPVVNEACR+LDEG+ ++ASDLDVAS++G  FPSYRGG+
Sbjct  605  SIVQDPKLPKLTDDEIVEMMLFPVVNEACRLLDEGVAMKASDLDVASIMGRGFPSYRGGV  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD+ GA +IY  LK WS+ +  G  F+P  +L  RA +G+ L
Sbjct  665  MFWADSFGAKYIYDRLKDWSKFH--GGIFEPYEYLSTRARQGLSL  707



>ref|NP_001042973.1| Os01g0348600 [Oryza sativa Japonica Group]
 dbj|BAB63893.1| putative tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Oryza sativa Japonica Group]
 dbj|BAB93398.1| putative tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Oryza sativa Japonica Group]
 dbj|BAF04887.1| Os01g0348600 [Oryza sativa Japonica Group]
 gb|EAZ11803.1| hypothetical protein OsJ_01677 [Oryza sativa Japonica Group]
 dbj|BAG94610.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70593.1| hypothetical protein OsI_01815 [Oryza sativa Indica Group]
 gb|AGW30398.1| glyoxysomal fatty acid beta-chain multifunctional protein [Oryza 
sativa]
Length=727

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ L+++  R G+ + KG+Y YE   K  PDP ++  +E+SR +  + P  + 
Sbjct  562  ERVYKSMLIPLMMEDKRTGEASRKGFYKYEDKRKATPDPEIMKYIEKSRSMAGVTPDTEL  621

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEM+ FPV+NEACRVLDEGI V+ASDLD+AS+ GM FP YRGGI++WAD++G
Sbjct  622  MKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGMGFPPYRGGIMFWADSIG  681

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I+  L+ W++ Y   + FKP  +L ERA  G+ L
Sbjct  682  AKYIHDKLEVWAKRY--SDIFKPCSYLAERAANGVPL  716



>ref|XP_002314377.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
 gb|EEF00548.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
Length=726

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLIPLMQEDKRAGETTRKGFYLYDDRRKAKPDPELRKYIEKARNISGVANDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRV  EGI V+A+DLD++SL+GM FP YRGGI++WAD++G
Sbjct  621  AKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDISSLMGMGFPPYRGGIMFWADSLG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FFKP  FL ERA KG
Sbjct  681  SKYIYSRLEEWSKTY--GEFFKPCAFLAERAAKG  712



>ref|XP_008458439.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Cucumis melo]
Length=725

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + A  +RTY+S L+ L+ +    G++  KG+Y+Y+K  K  P+P +   +E++R ++ 
Sbjct  553  QFVQAFPERTYKSMLIPLMQEDKNAGESTRKGFYVYDKNRKAGPNPELKKYIEKARSISG  612

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K   +++++IVEMI FPVVNEACRVL EGI V+A+DLD+A ++GM FPSYRGG++
Sbjct  613  VSVDPKLTKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPSYRGGLM  672

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ +IY+ L++WS+ Y  G FFKP R+L ERA +G  L
Sbjct  673  FWADSLGSKYIYSRLEEWSKQY--GGFFKPCRYLAERAAQGATL  714



>ref|XP_008223215.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Prunus mume]
Length=725

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ + GR G++  KG+Y Y    K  PDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSMIIPLMQEDGRAGESTRKGFYTYGDKRKASPDPELKKYIEKSRSISGVSIDSKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEMI FPVVNEACRVL EGI V+A+DLD+A+++GM FP YRGGI++WAD +G
Sbjct  620  LKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAAVMGMGFPPYRGGILFWADLLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS +Y  G FFKP  +L ERA KG  L
Sbjct  680  SKYIYSRLEEWSNIY--GEFFKPCAYLAERAAKGASL  714



>gb|EEE63425.1| hypothetical protein OsJ_18237 [Oryza sativa Japonica Group]
Length=718

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  L +  +R Y+S L+ ++++  R G+++ KG+Y+Y+   K  PDP +   +E+SR + 
Sbjct  545  KQYLQSYPERCYKSMLIQIMLEENRTGESSRKGFYLYDDKRKASPDPEMNKYIEKSRSMA  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            +I+   K   +TD EIVEM+LFPVVNEACR+LDEG+ ++ASDLDVAS++G  FPSYRGG+
Sbjct  605  SIVQDPKLPKLTDDEIVEMMLFPVVNEACRLLDEGVAMKASDLDVASIMGRGFPSYRGGV  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD+ GA +IY  LK WS+ +  G  F+P  +L  RA +G+ L
Sbjct  665  MFWADSFGAKYIYDRLKDWSKYH--GGIFEPYEYLSTRARQGLSL  707



>ref|XP_008458418.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Cucumis melo]
Length=725

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            DRT++S ++ L+ +  R G+   KG+Y+Y+K  K KPDP +   +E++R ++ I    K 
Sbjct  560  DRTFKSMIIPLMQEDKRAGETTQKGFYLYDKNRKSKPDPELKKYIEKARSMSGISVDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++++EMI FPVVNEACRVL EGI V+A+DLD+A ++GM FP YRGG+++WAD++G
Sbjct  620  AKLSDKDLIEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPPYRGGVMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L ERA +G  L
Sbjct  680  SKYIYSRLEEWSKLY--GGFFKPCSYLAERAAQGSTL  714



>ref|XP_010259502.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nelumbo nucifera]
Length=725

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + +  +R+Y+S L+ ++ +  R G+   KG+Y+Y+   +  PDP +   VE++R ++ 
Sbjct  553  QFIGSFPERSYKSMLIPIMQEDKRAGEATRKGFYVYDNKRRASPDPEIGKYVEKARHISG  612

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K + + D++IVEMI FPVVNEACRVL EGI V+ASDLD+AS++GM FP YRGGI+
Sbjct  613  VKVDSKFMKLPDKDIVEMIFFPVVNEACRVLAEGIAVKASDLDIASVMGMGFPPYRGGII  672

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ +I + L++WS++Y  G FFKP  +L ERA KG  L
Sbjct  673  FWADSLGSKYICSRLEEWSKMY--GEFFKPCSYLAERAAKGTPL  714



>gb|AAT38103.1| putative glyoxysomal fatty acid beta-oxidation multifunctional 
protein [Oryza sativa Japonica Group]
Length=724

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  L +  +R Y+S L+ ++++  R G+++ KG+Y+Y+   K  PDP +   +E+SR + 
Sbjct  551  KQYLQSYPERCYKSMLIQIMLEENRTGESSRKGFYLYDDKRKASPDPEMNKYIEKSRSMA  610

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            +I+   K   +TD EIVEM+LFPVVNEACR+LDEG+ ++ASDLDVAS++G  FPSYRGG+
Sbjct  611  SIVQDPKLPKLTDDEIVEMMLFPVVNEACRLLDEGVAMKASDLDVASIMGRGFPSYRGGV  670

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD+ GA +IY  LK WS+ +  G  F+P  +L  RA +G+ L
Sbjct  671  MFWADSFGAKYIYDRLKDWSKYH--GGIFEPYEYLSTRARQGLSL  713



>ref|XP_010024717.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Eucalyptus grandis]
 gb|KCW61183.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=725

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L  LL +  R G+   KG+Y+Y+   K  PDP +   VE++R ++ +    K 
Sbjct  560  ERTYKSMLTPLLQEDKRLGEATRKGFYLYDDRRKASPDPELKKYVEKARSISGVSIDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++IVEM  FPVVNEACRVLDEGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  620  VKLLEKDIVEMTFFPVVNEACRVLDEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L  RA +GI L
Sbjct  680  SKYIYSRLEEWSKLY--GGFFKPCVYLANRAARGIPL  714



>ref|XP_011010197.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Populus euphratica]
Length=726

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLIPLMQEDKRAGETTRKGFYLYDDRRKAKPDPELRKYIEKARNISGVAIDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRV  EGI V+A+DLD++SL+GM FP YRGGI++WAD++G
Sbjct  621  AKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDISSLMGMGFPPYRGGIMFWADSLG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FFKP  FL ERA KG
Sbjct  681  SKYIYSRLEEWSKTY--GEFFKPCAFLAERAAKG  712



>gb|KCW61185.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=732

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L  LL +  R G+   KG+Y+Y+   K  PDP +   VE++R ++ +    K 
Sbjct  560  ERTYKSMLTPLLQEDKRLGEATRKGFYLYDDRRKASPDPELKKYVEKARSISGVSIDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++IVEM  FPVVNEACRVLDEGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  620  VKLLEKDIVEMTFFPVVNEACRVLDEGIAVKAADLDIASVMGMGFPPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS+LY  G FFKP  +L  RA +GI L
Sbjct  680  SKYIYSRLEEWSKLY--GGFFKPCVYLANRAARGIPL  714



>ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nicotiana sylvestris]
Length=725

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  560  ERTYKSMLIPLMQEDKRAGETTRKGFYVYDDRRKASPDPEIKKYIEKAREMSGVTIDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V+ASDLD+++++GM FP YRGGI++WADT+G
Sbjct  620  AKLSDKDIIEMIFFPVVNEACRVLAEGIAVKASDLDISAVMGMGFPPYRGGIIFWADTLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L +WS +Y  G+FFKP  +L ERA KG
Sbjct  680  SKYICSRLDEWSRMY--GDFFKPCSYLAERAAKG  711



>dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation multifunctional 
protein [Capsicum chinense]
Length=725

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  560  ERTYKSMLIPLMQEDKRAGETTRKGFYVYDDRRKASPDPEIKKYIEKAREMSGVTIDHKM  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V++SDLD+++++GM FP YRGGI++WADT+G
Sbjct  620  AKLSDKDIIEMIFFPVVNEACRVLAEGIAVKSSDLDISAIMGMGFPPYRGGIIFWADTLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L +WS +Y  G+FFKP  +L ERA KG
Sbjct  680  SKYICSRLDEWSRMY--GDFFKPCSYLAERAAKG  711



>ref|XP_006840485.1| hypothetical protein AMTR_s00045p00190660 [Amborella trichopoda]
 gb|ERN02160.1| hypothetical protein AMTR_s00045p00190660 [Amborella trichopoda]
Length=717

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ ++ +  R G+   KG+YIY+   K +PDP++   +E+S+ +  I    K 
Sbjct  558  ERVYKSMLIPIMAEDKRAGEKTKKGFYIYDDKRKARPDPAIKKYIEKSQSMAGINLDPKL  617

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++I+EM+ FPVVNEACRVL EGI V+ASDLD+AS++GM FP YRGG+V+WAD+ G
Sbjct  618  MKLSDKDIIEMVFFPVVNEACRVLAEGIAVKASDLDIASVMGMGFPPYRGGVVFWADSFG  677

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A +I + L +WS  Y  G FFKP  +LEERA  G+ L
Sbjct  678  AKYICSRLAEWSRTY--GGFFKPCAYLEERAAGGLSL  712



>gb|EMS51968.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Triticum urartu]
Length=707

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 113/165 (68%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K    +  +R Y+S L  ++++  R G+++ KG+Y+Y+   +  PDP +   VE+SR++ 
Sbjct  509  KQYYQSYPERCYKSLLTAIMLEENRTGESSRKGFYLYDDKRQASPDPDIKKYVEKSRKMA  568

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
             +    K + +TD++IVEM+ FPVVNEACRVLDEGI ++ASDLDVAS++GM FPS+RGG+
Sbjct  569  GVAQDPKLLKLTDKDIVEMVFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSFRGGV  628

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD++ A ++Y  L  WS+ Y  G FFKP  +L  RA  G  L
Sbjct  629  MFWADSLSAEYVYRRLDGWSKDY--GEFFKPCEYLAARASHGASL  671



>gb|KJB34649.1| hypothetical protein B456_006G076600 [Gossypium raimondii]
Length=724

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ ++ +  R G++  KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  559  ERTYKSMLIPIMQEDKRAGESTRKGFYLYDNKRKASPDPELKMYIEKARSISGVAVDPKF  618

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEMI FPVVNEACRV  EGI V+ASD+D+A+++GM FP YRGG+++WAD++G
Sbjct  619  VKLSEKDIVEMIFFPVVNEACRVFAEGIAVKASDIDIAAVMGMGFPPYRGGLMFWADSLG  678

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS LY  G FFKP  FL ERA KG
Sbjct  679  SKYIYSRLEEWSNLY--GGFFKPCAFLAERAAKG  710



>ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nicotiana tomentosiformis]
Length=725

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y+   K  PDP +   +E +R ++ +    K 
Sbjct  560  ERTYKSMLIPLMQEDKRAGETTRKGFYVYDDRRKASPDPEIKKYIETAREMSGVTIDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V+ASDLD+++++GM FP YRGGI++WADT+G
Sbjct  620  AKLSDKDIIEMIFFPVVNEACRVLAEGIAVKASDLDISAVMGMGFPPYRGGIIFWADTLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L +WS +Y  G+FFKP  +L ERA KG
Sbjct  680  SKYICSRLDEWSRMY--GDFFKPCSYLAERAAKG  711



>ref|XP_001780666.1| predicted protein [Physcomitrella patens]
 gb|EDQ54552.1| predicted protein [Physcomitrella patens]
Length=726

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 113/155 (73%), Gaps = 3/155 (2%)
 Frame = -2

Query  678  AXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKP-KPDPSVLPLVEQSRRLTNIMP  502
            A  +RTYQ+ L DLL++  R G+  G GYY Y+KGS+  +P P +   + ++R+  +++P
Sbjct  555  AFGERTYQTNLNDLLLEDNRYGERTGMGYYNYKKGSRAEQPAPELDGYLTKTRQAASLIP  614

Query  501  GGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWA  322
             GK + ++D+EIVEMI + VVNEACRVLDE +VVR++DLD+AS+LGM FP+YRGG+V+W 
Sbjct  615  NGKIVDISDEEIVEMIFYGVVNEACRVLDEDVVVRSADLDIASVLGMGFPAYRGGVVFWG  674

Query  321  DTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERA  217
            D VG   IY+ LK WS LY  G+F++PS  LE  A
Sbjct  675  DHVGVERIYSKLKHWSTLY--GSFYQPSAALERAA  707



>ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Solanum tuberosum]
Length=727

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  562  ERTYKSMLIPLMQEDKRAGETTRKGFYVYDDRRKASPDPEIKKYIEKAREMSGVTIDPKM  621

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V++SDLD+++++GM F  YRGGI++WADT+G
Sbjct  622  AKLSDKDIIEMIFFPVVNEACRVLAEGIAVKSSDLDISAIMGMGFTPYRGGIIFWADTLG  681

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L +WS +Y  G+FFKP  +L ERA KG
Sbjct  682  SKYIYSRLDEWSRMY--GDFFKPCSYLAERASKG  713



>gb|AIL29217.1| fatty acid beta-oxidation multifunctional protein [Camellia oleifera]
Length=725

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+++ KG+YIY    K +PDP +   ++++R ++ +    K 
Sbjct  560  ERTYKSMLIMLLQEEKRAGESSRKGFYIYNDKRKARPDPEIKKFIQKAREISGVNVDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNEACRV  EGI V+A+D+D+A+++GM FP YRGGI++WAD++G
Sbjct  620  MKLSDKDIVEMIFFPVVNEACRVFAEGIAVKAADIDIAAVMGMGFPPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + ++ + L++WS +Y  G FFKP  FL ERA KG
Sbjct  680  SKYVCSRLEEWSNMY--GGFFKPCAFLTERAAKG  711



>ref|XP_008390640.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Malus domestica]
Length=725

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ + GR G+   KG+Y Y+   K  PDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSXLIPLMQEDGRAGETTRKGFYTYDDRRKASPDPQLKGYIEKSRSISGVSIDSKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEMI FPVVNEACRVL EGI V+A+DLD+A+++GM FP YRGGI++WAD +G
Sbjct  620  LKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAAIMGMGFPPYRGGILFWADLLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS  Y  G FFKP  +L ERA  G  L
Sbjct  680  SXYIYSRLEEWSNTY--GEFFKPCAYLAERASNGASL  714



>ref|XP_002270067.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Vitis vinifera]
Length=724

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ ++ +  R G+   KG+Y+Y+   K  PDP +   VE++R ++ +    K 
Sbjct  559  ERTYKSMLIPIMQEDKRAGETTRKGFYVYDDKRKASPDPELKKYVEKARGISGVAIDPKL  618

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNEACRV  EGI V+A+DLD+A ++GM FP YRGGI++WAD++G
Sbjct  619  MKLSDKDIVEMIFFPVVNEACRVYAEGIAVKAADLDIAGVMGMGFPPYRGGIMFWADSLG  678

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L+ WS LY  G FFKP  +L ERA KG
Sbjct  679  SKYIYSRLEAWSNLY--GGFFKPCAYLAERAAKG  710



>ref|XP_004252912.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a isoform X1 [Solanum lycopersicum]
Length=727

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   +G+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  562  ERTYKSMLIPLMQEDKRAGETTRRGFYVYDDRRKASPDPEIKKYIEKAREMSGVTIDPKM  621

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V++SDLD+++++GM FP YRGGI++WADT+G
Sbjct  622  AKLSDKDIIEMIFFPVVNEACRVLAEGIAVKSSDLDISAIMGMGFPPYRGGIIFWADTLG  681

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L +WS +Y  G+FFKP  +L ERA KG
Sbjct  682  SKYICSRLDEWSRMY--GDFFKPCSYLAERASKG  713



>ref|XP_006380155.1| hypothetical protein POPTR_0008s22410g [Populus trichocarpa]
 gb|ERP57952.1| hypothetical protein POPTR_0008s22410g [Populus trichocarpa]
Length=721

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S LL L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLLPLMQEDKRGGETTCKGFYLYDDRRKAKPDPELRKYIEKARSISGVAVDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRV  EGI V+A+DLD+ASL+GM FP YRGGI++WAD+ G
Sbjct  621  AKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASLMGMGFPPYRGGIMFWADSFG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FF+P  FL ER  KG
Sbjct  681  SKYIYSRLEEWSKTY--GEFFEPCAFLAERGAKG  712



>ref|XP_002882497.1| hypothetical protein ARALYDRAFT_478006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58756.1| hypothetical protein ARALYDRAFT_478006 [Arabidopsis lyrata subsp. 
lyrata]
Length=723

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
            ++RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K
Sbjct  557  SERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGVKLDPK  616

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
              +++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A ++GM FP YRGGI++WAD++
Sbjct  617  LANLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIMGMGFPPYRGGIMFWADSI  676

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G+ +IY+ L +WS+ Y  G FFKP  FL ER  KG+ L
Sbjct  677  GSKYIYSRLDEWSKTY--GEFFKPCAFLAERGSKGVPL  712



>ref|XP_011003910.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Populus euphratica]
Length=726

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S LL L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLLPLMQEDKRGGETTCKGFYLYDDRRKAKPDPELRKYIEKARSISGVAVDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRV  EGI V+A+DLD+ASL+GM FP YRGGI++WAD+ G
Sbjct  621  AKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASLMGMGFPPYRGGIMFWADSFG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FF+P  FL ER  KG
Sbjct  681  SKYIYSRLEEWSKTY--GEFFEPCAFLAERGAKG  712



>ref|XP_010314711.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a isoform X2 [Solanum lycopersicum]
Length=726

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   +G+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLIPLMQEDKRAGETTRRGFYVYDDRRKASPDPEIKKYIEKAREMSGVTIDPKM  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++I+EMI FPVVNEACRVL EGI V++SDLD+++++GM FP YRGGI++WADT+G
Sbjct  621  AKLSDKDIIEMIFFPVVNEACRVLAEGIAVKSSDLDISAIMGMGFPPYRGGIIFWADTLG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L +WS +Y  G+FFKP  +L ERA KG
Sbjct  681  SKYICSRLDEWSRMY--GDFFKPCSYLAERASKG  712



>gb|KDP27817.1| hypothetical protein JCGZ_18897 [Jatropha curcas]
Length=725

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+++ KG+Y+Y    K  PDP +   +E++R ++ +    K 
Sbjct  560  ERTYKSMLIPLMQEDKRAGESSRKGFYLYNDKRKASPDPELRKYIEKARSISGVAVDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRV  EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  620  EKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASVMGMGFPPYRGGILFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS++Y  G FFKP  FL ERA KG
Sbjct  680  SKYIYSRLEEWSKIY--GEFFKPCAFLAERAAKG  711



>ref|XP_006489051.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Citrus sinensis]
Length=725

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ ++ +  R G+   KG+Y+Y++  K  PDP V   +E++R ++ +    K 
Sbjct  560  ERTYKSMIIPIMQEDKRAGETTRKGFYLYDERRKASPDPEVKKFIEKARSMSGVAINPKF  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              +++++IVEMI FPVVNEAC V  EGI V+A+DLD+AS++GM FP YRGGI++WAD++G
Sbjct  620  AKLSEKDIVEMIFFPVVNEACLVFAEGIAVKAADLDIASVMGMGFPVYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L++WS LY  G FFKP  FL ERA +G  L
Sbjct  680  SKYIYSRLEEWSSLY--GEFFKPCAFLAERAARGATL  714



>ref|XP_006380154.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
 gb|ERP57951.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
Length=726

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S LL L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLLPLMQEDKRGGETTCKGFYLYDDRRKAKPDPELRKYIEKARSISGVAVDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              + +++IVEMI FPVVNEACRV  EGI V+A+DLD+ASL+GM FP YRGGI++WAD+ G
Sbjct  621  AKLPEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIASLMGMGFPPYRGGIMFWADSFG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FF+P  FL ER  KG
Sbjct  681  SKYIYSRLEEWSKTY--GEFFEPCAFLAERGAKG  712



>ref|XP_007154175.1| hypothetical protein PHAVU_003G096500g [Phaseolus vulgaris]
 gb|ESW26169.1| hypothetical protein PHAVU_003G096500g [Phaseolus vulgaris]
Length=722

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ LL +  R G+   KG+Y+Y+   K  PD  +   +E++R +T +    K 
Sbjct  557  ERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKRKASPDTELKNYIEKARSITGVSVDPKL  616

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++I+EMI FPVVNEACRVL EGI V+A+DLD++S++GM FP YRGGI++WAD++G
Sbjct  617  VKLQEKDIIEMIFFPVVNEACRVLGEGIAVKAADLDISSVMGMGFPPYRGGILFWADSLG  676

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +IY+ L+KWS+LY  G FFKP   L  RA KGI L
Sbjct  677  SKYIYSKLEKWSQLY--GEFFKPCANLAARAAKGIPL  711



>ref|XP_009623955.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Nicotiana tomentosiformis]
Length=715

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 114/162 (70%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  LSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIM  505
            + +  DRTY+S L+ LL  + R G+   +G+YIY+K  K KPDP +   +E++R  + + 
Sbjct  545  MESMPDRTYKSMLIPLLQGNKRLGETTQRGFYIYDKRRKAKPDPEIKKYIEKARENSGVN  604

Query  504  PGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYW  325
               K   ++D++IVEMILFPVVNEACR+L +GIVV+ASDLD+AS++G  FP YRGGI+YW
Sbjct  605  IDPKLEKLSDKDIVEMILFPVVNEACRLLAKGIVVKASDLDIASVMGTGFPPYRGGIIYW  664

Query  324  ADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ADT+G+ +I + L  W+ +Y  GNFF P  +L ++A  G+ L
Sbjct  665  ADTLGSKYICSRLDDWARMY--GNFFNPCAYLADKAASGVPL  704



>emb|CBI22983.3| unnamed protein product [Vitis vinifera]
Length=765

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ ++ +  R G+   KG+Y+Y+   K  PDP +   VE++R ++ +    K 
Sbjct  600  ERTYKSMLIPIMQEDKRAGETTRKGFYVYDDKRKASPDPELKKYVEKARGISGVAIDPKL  659

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++D++IVEMI FPVVNEACRV  EGI V+A+DLD+A ++GM FP YRGGI++WAD++G
Sbjct  660  MKLSDKDIVEMIFFPVVNEACRVYAEGIAVKAADLDIAGVMGMGFPPYRGGIMFWADSLG  719

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L+ WS LY  G FFKP  +L ERA KG
Sbjct  720  SKYIYSRLEAWSNLY--GGFFKPCAYLAERAAKG  751



>ref|XP_004296857.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Fragaria vesca subsp. vesca]
Length=725

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ ++ + GR G+   +G+Y+Y+   + KPDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSMLIPMMQEDGRAGETTKRGFYVYDDKRQAKPDPELKKYIEKSRSISGLSVDAKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++IVEMI FPVVNEACRV  EGI V+A+DLD+AS++GM FP YRGGI++WAD VG
Sbjct  620  VKLPEKDIVEMIFFPVVNEACRVYAEGIAVKAADLDIASVMGMGFPPYRGGIMFWADLVG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS  Y  G FFKP  +L ERA +G
Sbjct  680  SKYIYSRLEQWSNTY--GEFFKPCAYLAERAAQG  711



>emb|CDO98847.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   +G+Y+Y+   K  PDP +   +E+SR ++ +    K 
Sbjct  561  ERTYKSMLIPLMQEDKRAGETTRRGFYVYDNKRKASPDPEIKKYIEKSREMSGVKIDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++IVEMI FPVVNEACRVL EGI V+++DLD+++++GM FP YRGGI++WADT G
Sbjct  621  AKLSDKDIVEMIFFPVVNEACRVLAEGIAVKSADLDISAVMGMGFPPYRGGILFWADTFG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            + +I + L++W+ LY  G FFKP  +L +RA KG  L
Sbjct  681  SKYICSRLEEWANLY--GGFFKPCAYLADRAAKGAHL  715



>ref|XP_007035631.1| Multifunctional protein 2 [Theobroma cacao]
 gb|EOY06557.1| Multifunctional protein 2 [Theobroma cacao]
Length=725

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ ++ +  R G+   KG+Y+Y+   K  PDP +   +E++R ++ +    K 
Sbjct  560  ERTYKSLLIPIMQEDKRAGETTQKGFYLYDNKRKASPDPELKKYIEKARSISGVAIDPKF  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEMI FPVVNEACRV  EGI V+A+DLD+A+++GM F  YRGGI++WAD++G
Sbjct  620  VKLSEKDIVEMIFFPVVNEACRVFAEGIAVKAADLDIAAVMGMGFAPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L+ WS++Y  G+FFKP  FL ERA KG
Sbjct  680  SKYIYSRLEDWSKMY--GDFFKPCAFLAERAAKG  711



>ref|XP_006297065.1| hypothetical protein CARUB_v10013066mg [Capsella rubella]
 gb|EOA29963.1| hypothetical protein CARUB_v10013066mg [Capsella rubella]
Length=725

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT--NIMPGG  496
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++  N+ P  
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGGNVDP--  617

Query  495  KPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADT  316
            K + ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A+++GM FP YRGGI++WAD+
Sbjct  618  KLVKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAAIMGMGFPPYRGGIMFWADS  677

Query  315  VGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            +G+ +IY+ L +WS+ Y  G+FFKP  FL ERA KG
Sbjct  678  MGSKYIYSRLDEWSKTY--GDFFKPCAFLAERASKG  711



>ref|XP_006654304.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Oryza brachyantha]
Length=718

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 113/165 (68%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT  514
            K  L +  +R Y+S L+ ++++  R G+++ +G+Y+Y+   K  PDP +   VE+SR + 
Sbjct  545  KQYLQSYPERCYKSVLIKIMLEENRTGESSRRGFYLYDDKRKASPDPEINKYVEKSRSMA  604

Query  513  NIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGI  334
            +I    K + +TD +IVEM+ FPVVNEACR+LDEG+ ++ASDLDVAS++G  FPSYRGG+
Sbjct  605  SISQDPKLLKLTDDDIVEMMFFPVVNEACRLLDEGVAMKASDLDVASIMGRGFPSYRGGV  664

Query  333  VYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            ++WAD++G  +IY  L  WS+ Y  G  F+P  +L  RA +G  L
Sbjct  665  MFWADSLGTKYIYNRLNAWSKDY--GGIFEPCEYLAARARQGSSL  707



>ref|XP_010486216.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Camelina sativa]
Length=725

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++      K 
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGANVDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A+++GM FP YRGGI++WAD++G
Sbjct  620  VKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAAIMGMGFPPYRGGIMFWADSIG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L +WS+ Y  G+FFKP  FL ER  KG
Sbjct  680  SKYIYSRLDEWSKTY--GDFFKPCAFLAERGSKG  711



>ref|XP_010445439.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X1 [Camelina sativa]
 ref|XP_010445486.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X2 [Camelina sativa]
Length=604

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT--NIMPGG  496
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++  N+ P  
Sbjct  439  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGGNVDP--  496

Query  495  KPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADT  316
            K + ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A+++GM FP YRGGI++WAD+
Sbjct  497  KLVKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAAIMGMGFPPYRGGIMFWADS  556

Query  315  VGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            +G+ +IY+ L +WS+ Y  G+FFKP  FL ER  KG
Sbjct  557  IGSKYIYSRLDEWSKTY--GDFFKPCAFLAERGSKG  590



>emb|CDY08028.1| BnaC03g34950D [Brassica napus]
Length=726

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   ++++R ++   P  K 
Sbjct  561  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDRRKAKPDPEIKKYIDKARSVSGAKPDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A + GM FP YRGGI++WAD++G
Sbjct  621  EKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIFGMGFPPYRGGIMFWADSIG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FFKP  FL ER  KG
Sbjct  681  SKYIYSKLEEWSKAY--GEFFKPCAFLAERGSKG  712



>ref|XP_011071437.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Sesamum indicum]
Length=724

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ +  R G+   KG+Y+Y++  K  PDP +   +E++R L+ +    K 
Sbjct  559  ERTYKSMLIPLMQEDKRAGETTRKGFYVYDEKRKASPDPEIKRYIEKARELSGVTIDPKL  618

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              +++++IVEMI FPVVNEACRVL EGI V+A+DLD+++++GM FP YRGGI++WADT+G
Sbjct  619  TKMSNKDIVEMIFFPVVNEACRVLAEGIAVKAADLDISAVMGMGFPPYRGGIIFWADTLG  678

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I   L++WS+ Y  G FFKP  +L ERA KG
Sbjct  679  SKYICARLEEWSKSY--GGFFKPCSYLAERAAKG  710



>sp|O49809.2|MFPA_BRANA RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA 
isomerase/3-hydroxybutyryl-CoA epimerase; 
Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Brassica napus]
 emb|CAA04386.1| Tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Brassica napus]
Length=725

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   ++++R ++   P  K 
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDRRKAKPDPEIKNYIDKARSVSGAKPDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A + GM FP YRGGI++WAD++G
Sbjct  620  EKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIFGMGFPPYRGGIMFWADSIG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FFKP  FL ER  KG
Sbjct  680  SKYIYSKLEEWSKAY--GEFFKPCAFLAERGSKG  711



>ref|XP_010464276.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Camelina sativa]
Length=725

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++      K 
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSMSGANVDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A++ GM FP YRGGI++WAD++G
Sbjct  620  VKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAAIFGMGFPPYRGGIMFWADSIG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L +WS+ Y  G+FFKP  FL ER  KG
Sbjct  680  SKYIYSRLDEWSKTY--GDFFKPCAFLAERGSKG  711



>ref|XP_010321770.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Solanum lycopersicum]
Length=859

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  696  EKNLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRL  517
            E   +S+   R Y+S L+ L+ +  R G+   KG+Y+Y++  K KPDP +   +E++R +
Sbjct  685  EAQFVSSMPGRIYKSMLVPLMQQDKRLGETTRKGFYLYDERRKAKPDPDIKRYIEKAREI  744

Query  516  TNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGG  337
            + +    K   ++++++VEMILFP+VNEACR+L EGIVV+ASDLD+AS++G+ FP YRGG
Sbjct  745  SGVSIDPKTAKLSEKDMVEMILFPLVNEACRLLAEGIVVKASDLDIASVMGIGFPPYRGG  804

Query  336  IVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            I+YWADTVG+ +I + L +W+ +Y  G  FKP  +L E+A +GI L
Sbjct  805  IIYWADTVGSKYICSRLDEWTTIY--GKIFKPCDYLAEKAARGIPL  848



>ref|NP_187342.1| fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis 
thaliana]
 sp|Q9ZPI5.1|MFP2_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2; Short=AtMPF2; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA 
dehydrogenase [Arabidopsis thaliana]
 pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2
 gb|AAF26990.1|AC016827_1 fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
 gb|AAD18042.1| MFP2 [Arabidopsis thaliana]
 gb|AAL32699.1| fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
 gb|AEE74468.1| fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis 
thaliana]
Length=725

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -2

Query  672  ADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGK  493
            ++RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K
Sbjct  559  SERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGVKLDPK  618

Query  492  PISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTV  313
              ++++++I+EM  FPVVNEACRV  EGI V+A+DLD+A ++GM FP YRGGI++WAD++
Sbjct  619  LANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIMGMGFPPYRGGIMFWADSI  678

Query  312  GAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            G+ +IY+ L +WS+ Y  G FFKP  FL ER  KG+ L
Sbjct  679  GSKYIYSRLDEWSKAY--GEFFKPCAFLAERGSKGVLL  714



>ref|XP_004962329.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Setaria italica]
Length=719

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 114/166 (69%), Gaps = 3/166 (2%)
 Frame = -2

Query  693  KNLLSAXADRTYQSPLL-DLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRL  517
            K    +  +R Y+S LL  ++++  R G+++ KG+Y+Y+   K   DP +   VE+SR +
Sbjct  545  KQYFQSYPERCYKSMLLLQIMLEDNRTGESSRKGFYVYDNKRKASRDPDLRKYVEKSRDM  604

Query  516  TNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGG  337
              +    K + +TD +IVE+I FPVVNEACRVLDEGI ++ASDLDVAS++GM FPSYRGG
Sbjct  605  AGVKQDPKLMKLTDNDIVEIIFFPVVNEACRVLDEGISLKASDLDVASVMGMGFPSYRGG  664

Query  336  IVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +++WAD++GA ++Y  L+ WS+ Y  G FFKP  +L  RA +G  L
Sbjct  665  VMFWADSLGAKYVYDRLEAWSKDY--GEFFKPCEYLAARARQGASL  708



>emb|CDX74076.1| BnaA03g29710D [Brassica napus]
Length=726

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   ++++R ++   P  K 
Sbjct  561  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDRRKAKPDPEIKNYIDKARSVSGAKPDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A + GM FP YRGGI++WAD++G
Sbjct  621  EKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIFGMGFPPYRGGIMFWADSIG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FFKP  FL ER  KG
Sbjct  681  SKYIYSKLEEWSKAY--GEFFKPCAFLAERGSKG  712



>ref|XP_009134933.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Brassica rapa]
Length=725

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   ++++R ++   P  K 
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDRRKAKPDPEIKKYIDKARGVSGAKPDPKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A + GM FP YRGGI++WAD++G
Sbjct  620  EKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIFGMGFPPYRGGIMFWADSIG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +IY+ L++WS+ Y  G FFKP  FL ER  KG
Sbjct  680  SKYIYSKLEEWSKAY--GEFFKPCAFLAERGSKG  711



>gb|EEC78551.1| hypothetical protein OsI_18514 [Oryza sativa Indica Group]
Length=391

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 2/124 (2%)
 Frame = -2

Query  570  KPKPDPSVLPLVEQSRRLTNIMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRAS  391
            K  PDP +   VE+SRR+   +P  + + + D+EIVEM+ FPV+NEAC+VL EGI  +AS
Sbjct  258  KAIPDPDIFKYVEKSRRMAGTVPDLELLKLDDKEIVEMVFFPVINEACQVLSEGIANKAS  317

Query  390  DLDVASLLGMSFPSYRGGIVYWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALK  211
            DLD+AS+ GM FP YRGGIVYWAD++GA  I+  L +W   +  G  F+P  +L ERA +
Sbjct  318  DLDIASIFGMGFPPYRGGIVYWADSIGAKRIHARLSEWEMKH--GQLFRPCSYLSERAAE  375

Query  210  GIRL  199
            G+ L
Sbjct  376  GVPL  379



>ref|XP_010445530.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X3 [Camelina sativa]
Length=725

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLT--NIMPGG  496
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++  N+ P  
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGGNVDP--  617

Query  495  KPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADT  316
            K + ++++EI+EM  FPVVNEACRV  EGI V+A+DLD+A+++GM FP YRGGI++WAD+
Sbjct  618  KLVKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAAIMGMGFPPYRGGIMFWADS  677

Query  315  VGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            +G+ +IY+ L +WS+ Y  G+FFKP  FL ER  KG
Sbjct  678  IGSKYIYSRLDEWSKTY--GDFFKPCAFLAERGSKG  711



>emb|CAA55910.1| protein MFP-b [Cucumis sativus]
Length=633

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + A  +RTY+S L+ L+ +    G++  KG+Y+Y+K  K  P+P +   +E++R  + 
Sbjct  461  QFVQAFPERTYKSMLIPLMQEDKNAGESTRKGFYVYDKNRKAGPNPELKKYIEKARNSSG  520

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K   + +++IVEMI FPVVNEACRVL EGI V+A+DLD+A ++GM FPSYRGG++
Sbjct  521  VSVDPKLTKLPEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPSYRGGLM  580

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ +IY+ L++WS+ Y  G FFKP  +L ERA++G  L
Sbjct  581  FWADSLGSNYIYSRLEEWSKQY--GGFFKPCGYLAERAVQGATL  622



>ref|XP_010105147.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Morus notabilis]
 gb|EXC03955.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Morus notabilis]
Length=726

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ + GR G++  KG+Y Y    K  PDP +   +E++R ++ +    K 
Sbjct  561  ERTYKSMLIPLMQEDGRAGESTKKGFYAYGDKRKANPDPELKKYIEKARSMSGVAIDPKL  620

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +++IVEMI FPVVNEACRVL EGI V+A+DLD+AS++GM FP YRGG+++WAD++G
Sbjct  621  VKLPEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIASVMGMGFPPYRGGLLFWADSLG  680

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L++WS+ Y  G+FFKP  +L ERA KG
Sbjct  681  SKYICSRLEEWSKTY--GDFFKPCAYLAERAAKG  712



>gb|EYU45545.1| hypothetical protein MIMGU_mgv1a002038mg [Erythranthe guttata]
Length=724

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y++  K  PDP +   +E+SR ++ +    K 
Sbjct  559  ERTYKSMIIPLMQEDKRAGETTRKGFYVYDEKRKASPDPEIKKYIEKSREISGVTIDPKL  618

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
              ++D++IVEMI  PVVNE CRVL EGI V+A+DLD+++++GM FP YRGGIV+WAD++G
Sbjct  619  TKLSDKDIVEMIFLPVVNETCRVLAEGIAVKAADLDISAVMGMGFPPYRGGIVFWADSLG  678

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L++WS LY  G FFKP  +L ERA KG
Sbjct  679  SKYICSRLEEWSNLY--GGFFKPCSYLAERAAKG  710



>ref|XP_009352290.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Pyrus x bretschneideri]
Length=725

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S L+ L+ + GR G+   KG+Y Y+   K  PDP +   +E+SR ++ +    K 
Sbjct  560  ERTYKSMLIPLMQEDGRAGETTRKGFYTYDDRRKASPDPQLKGYIEKSRSISGVSIDSKL  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++IVEMI FPVVNEACRVL EGI V+A+DLD+A+++GM FP YRGGI++WAD +G
Sbjct  620  LKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAAIMGMGFPPYRGGILFWADLLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERA  217
            + +IY+ L++WS  Y  G FFKP  +L ERA
Sbjct  680  SKYIYSRLEEWSNTY--GEFFKPCAYLAERA  708



>ref|XP_004168411.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform 2 [Cucumis sativus]
 sp|Q39659.1|MFPA_CUCSA RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA 
isomerase/3-hydroxybutyryl-CoA epimerase; 
Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Cucumis sativus]
 emb|CAA55630.1| tetrafunctional protein [Cucumis sativus]
Length=725

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + A  +RTY+S L+ L+ +    G++  KG+Y+Y+K  K  P+P +   +E++R  + 
Sbjct  553  QFVQAFPERTYKSMLIPLMQEDKNAGESTRKGFYVYDKNRKAGPNPELKKYIEKARNSSG  612

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K   + +++IVEMI FPVVNEACRVL EGI V+A+DLD+A ++GM FPSYRGG++
Sbjct  613  VSVDPKLTKLPEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPSYRGGLM  672

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ +IY+ L++WS+ Y  G FFKP  +L ERA++G  L
Sbjct  673  FWADSLGSNYIYSRLEEWSKQY--GGFFKPCGYLAERAVQGATL  714



>ref|XP_010524718.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Tarenaya hassleriana]
Length=725

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +RTY+S ++ L+ +  R G+   KG+Y+Y+   K KPDP +   +E++R ++ +    K 
Sbjct  560  ERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSMSGVNIDPKC  619

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + +++++I+EM+ FPVVNEACRV  EGI V+A+DLD+A+++GM FP YRGGI++WAD++G
Sbjct  620  VKLSERDIIEMVFFPVVNEACRVFAEGIAVKAADLDIAAVMGMGFPPYRGGIMFWADSLG  679

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKG  208
            + +I + L +WS  Y  G+FFKP  F+ ERA KG
Sbjct  680  SKYICSRLNEWSRTY--GDFFKPCDFMAERASKG  711



>gb|KGN47371.1| hypothetical protein Csa_6G306330 [Cucumis sativus]
Length=777

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + A  +RTY+S L+ L+ +    G++  KG+Y+Y+K  K  P+P +   +E++R  + 
Sbjct  605  QFVQAFPERTYKSMLIPLMQEDKNAGESTRKGFYVYDKNRKAGPNPELKKYIEKARNSSG  664

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K   + +++IVEMI FPVVNEACRVL EGI V+A+DLD+A ++GM FPSYRGG++
Sbjct  665  VSVDPKLTKLPEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPSYRGGLM  724

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ +IY+ L++WS+ Y  G FFKP  +L ERA++G  L
Sbjct  725  FWADSLGSNYIYSRLEEWSKQY--GGFFKPCGYLAERAVQGATL  766



>ref|XP_004168410.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform 1 [Cucumis sativus]
Length=794

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  NLLSAXADRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTN  511
              + A  +RTY+S L+ L+ +    G++  KG+Y+Y+K  K  P+P +   +E++R  + 
Sbjct  553  QFVQAFPERTYKSMLIPLMQEDKNAGESTRKGFYVYDKNRKAGPNPELKKYIEKARNSSG  612

Query  510  IMPGGKPISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIV  331
            +    K   + +++IVEMI FPVVNEACRVL EGI V+A+DLD+A ++GM FPSYRGG++
Sbjct  613  VSVDPKLTKLPEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAGVMGMGFPSYRGGLM  672

Query  330  YWADTVGAMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            +WAD++G+ +IY+ L++WS+ Y  G FFKP  +L ERA++G  L
Sbjct  673  FWADSLGSNYIYSRLEEWSKQY--GGFFKPCGYLAERAVQGATL  714



>gb|EMS65926.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Triticum urartu]
Length=669

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -2

Query  669  DRTYQSPLLDLLIKSgrngknngkgyyiyekGSKPKPDPSVLPLVEQSRRLTNIMPGGKP  490
            +R Y+S L+ L+ +  R G+ + KG+Y Y+   K  PDP ++  +E+SRR+    P  + 
Sbjct  499  ERVYKSMLISLMTEDKRTGEASQKGFYRYDSKRKASPDPEIMNYLEESRRIAGATPDPEL  558

Query  489  ISVTDQEIVEMILFPVVNEACRVLDEGIVVRASDLDVASLLGMSFPSYRGGIVYWADTVG  310
            + + +  I EM+LFPV+NEACRVL EGI  +ASDLD+AS+ GM FP YRGGI++WAD++G
Sbjct  559  LKLDNSAIAEMVLFPVINEACRVLGEGIAFKASDLDIASIFGMDFPPYRGGIMHWADSIG  618

Query  309  AMHIYTSLKKWSELYGIGNFFKPSRFLEERALKGIRL  199
            A  I T L +W   Y  G FFKP   L ERA +G+ L
Sbjct  619  ARRICTMLSEWEMKY--GQFFKPCSHLLERAAEGLPL  653



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455