BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016C21

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627508.1|  PREDICTED: probable ADP-ribosylation factor ...    145   5e-36   Nicotiana tomentosiformis
ref|XP_009627509.1|  PREDICTED: probable ADP-ribosylation factor ...    145   5e-36   Nicotiana tomentosiformis
ref|XP_009776200.1|  PREDICTED: probable ADP-ribosylation factor ...    143   2e-35   Nicotiana sylvestris
ref|XP_009776199.1|  PREDICTED: probable ADP-ribosylation factor ...    143   2e-35   Nicotiana sylvestris
ref|XP_006353447.1|  PREDICTED: probable ADP-ribosylation factor ...    136   6e-33   Solanum tuberosum [potatoes]
ref|XP_004251595.1|  PREDICTED: probable ADP-ribosylation factor ...    133   7e-32   Solanum lycopersicum
ref|XP_011078363.1|  PREDICTED: probable ADP-ribosylation factor ...    110   8e-24   Sesamum indicum [beniseed]
ref|XP_002515587.1|  conserved hypothetical protein                     105   1e-22   
gb|EYU23027.1|  hypothetical protein MIMGU_mgv1a004452mg                102   2e-21   Erythranthe guttata [common monkey flower]
gb|KDP32306.1|  hypothetical protein JCGZ_13231                         100   3e-20   Jatropha curcas
emb|CDP03358.1|  unnamed protein product                              98.2    1e-19   Coffea canephora [robusta coffee]
emb|CBI36171.3|  unnamed protein product                              94.7    2e-18   Vitis vinifera
ref|XP_007203783.1|  hypothetical protein PRUPE_ppa001945mg           94.0    4e-18   Prunus persica
ref|XP_010654688.1|  PREDICTED: probable ADP-ribosylation factor ...  92.8    1e-17   Vitis vinifera
ref|XP_010654693.1|  PREDICTED: probable ADP-ribosylation factor ...  92.4    1e-17   
ref|XP_011458060.1|  PREDICTED: probable ADP-ribosylation factor ...  92.4    1e-17   Fragaria vesca subsp. vesca
ref|XP_004287082.1|  PREDICTED: probable ADP-ribosylation factor ...  92.0    2e-17   Fragaria vesca subsp. vesca
ref|XP_008242599.1|  PREDICTED: probable ADP-ribosylation factor ...  89.7    1e-16   Prunus mume [ume]
gb|KJB64872.1|  hypothetical protein B456_010G069100                  89.0    2e-16   Gossypium raimondii
ref|XP_008793443.1|  PREDICTED: probable ADP-ribosylation factor ...  86.7    1e-15   Phoenix dactylifera
ref|XP_010656352.1|  PREDICTED: actin cytoskeleton-regulatory com...  85.9    2e-15   Vitis vinifera
ref|XP_002281316.2|  PREDICTED: probable ADP-ribosylation factor ...  85.9    2e-15   Vitis vinifera
ref|XP_007013233.1|  NSP-interacting GTPase, putative isoform 3       82.0    4e-14   
ref|XP_007013231.1|  NSP-interacting GTPase, putative isoform 1       82.0    4e-14   
ref|XP_006583393.1|  PREDICTED: probable ADP-ribosylation factor ...  81.3    5e-14   Glycine max [soybeans]
ref|XP_003630818.1|  hypothetical protein MTR_8g103750                81.3    5e-14   Medicago truncatula
gb|KEH21362.1|  ARF GTPase activator                                  81.3    5e-14   Medicago truncatula
gb|KHN20701.1|  hypothetical protein glysoja_019018                   81.3    5e-14   Glycine soja [wild soybean]
ref|XP_004512853.1|  PREDICTED: probable ADP-ribosylation factor ...  80.5    1e-13   Cicer arietinum [garbanzo]
ref|XP_006587509.1|  PREDICTED: probable ADP-ribosylation factor ...  80.1    1e-13   Glycine max [soybeans]
gb|KDO54160.1|  hypothetical protein CISIN_1g004435mg                 79.7    2e-13   Citrus sinensis [apfelsine]
ref|XP_006587511.1|  PREDICTED: probable ADP-ribosylation factor ...  79.7    2e-13   Glycine max [soybeans]
ref|XP_006587512.1|  PREDICTED: probable ADP-ribosylation factor ...  79.7    2e-13   Glycine max [soybeans]
ref|XP_006451098.1|  hypothetical protein CICLE_v100075541mg          79.7    2e-13   
gb|KDO54156.1|  hypothetical protein CISIN_1g004435mg                 79.3    2e-13   Citrus sinensis [apfelsine]
gb|KHN21549.1|  Arf-GAP domain and FG repeat-containing protein 1     79.3    2e-13   Glycine soja [wild soybean]
gb|KHG17023.1|  hypothetical protein F383_09821                       79.0    3e-13   Gossypium arboreum [tree cotton]
ref|XP_006587510.1|  PREDICTED: probable ADP-ribosylation factor ...  79.0    3e-13   Glycine max [soybeans]
ref|XP_006583396.1|  PREDICTED: probable ADP-ribosylation factor ...  78.2    5e-13   
ref|XP_010088856.1|  putative ADP-ribosylation factor GTPase-acti...  78.2    6e-13   
ref|XP_002324405.1|  Rev interacting-like family protein              77.4    1e-12   
ref|XP_011043437.1|  PREDICTED: probable ADP-ribosylation factor ...  77.0    1e-12   Populus euphratica
ref|XP_010249829.1|  PREDICTED: probable ADP-ribosylation factor ...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010249832.1|  PREDICTED: probable ADP-ribosylation factor ...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004512959.1|  PREDICTED: probable ADP-ribosylation factor ...  77.0    1e-12   Cicer arietinum [garbanzo]
ref|XP_006475714.1|  PREDICTED: probable ADP-ribosylation factor ...  77.0    2e-12   
ref|XP_010047752.1|  PREDICTED: probable ADP-ribosylation factor ...  76.6    2e-12   Eucalyptus grandis [rose gum]
ref|XP_006584844.1|  PREDICTED: probable ADP-ribosylation factor ...  76.6    2e-12   Glycine max [soybeans]
ref|XP_010047751.1|  PREDICTED: probable ADP-ribosylation factor ...  76.6    2e-12   Eucalyptus grandis [rose gum]
ref|XP_006451097.1|  hypothetical protein CICLE_v100075541mg          75.9    3e-12   
gb|KDO54159.1|  hypothetical protein CISIN_1g004435mg                 75.9    3e-12   Citrus sinensis [apfelsine]
ref|XP_009336872.1|  PREDICTED: probable ADP-ribosylation factor ...  75.5    4e-12   Pyrus x bretschneideri [bai li]
ref|XP_004512854.1|  PREDICTED: probable ADP-ribosylation factor ...  75.1    5e-12   Cicer arietinum [garbanzo]
ref|XP_010915040.1|  PREDICTED: probable ADP-ribosylation factor ...  75.1    5e-12   Elaeis guineensis
ref|XP_009352480.1|  PREDICTED: probable ADP-ribosylation factor ...  75.1    5e-12   Pyrus x bretschneideri [bai li]
gb|KDO54162.1|  hypothetical protein CISIN_1g004435mg                 74.7    8e-12   Citrus sinensis [apfelsine]
ref|XP_007013232.1|  NSP-interacting GTPase, putative isoform 2       74.3    9e-12   
gb|KDO54161.1|  hypothetical protein CISIN_1g004435mg                 74.3    9e-12   Citrus sinensis [apfelsine]
ref|XP_006580462.1|  PREDICTED: probable ADP-ribosylation factor ...  73.6    2e-11   Glycine max [soybeans]
ref|XP_006475716.1|  PREDICTED: probable ADP-ribosylation factor ...  72.8    3e-11   
ref|XP_004512957.1|  PREDICTED: probable ADP-ribosylation factor ...  72.0    6e-11   Cicer arietinum [garbanzo]
ref|XP_006475717.1|  PREDICTED: probable ADP-ribosylation factor ...  71.6    8e-11   
ref|XP_008804233.1|  PREDICTED: probable ADP-ribosylation factor ...  70.9    1e-10   Phoenix dactylifera
ref|XP_008804232.1|  PREDICTED: probable ADP-ribosylation factor ...  70.9    1e-10   Phoenix dactylifera
gb|KHG08531.1|  hypothetical protein F383_13599                       70.9    1e-10   Gossypium arboreum [tree cotton]
ref|XP_010934106.1|  PREDICTED: probable ADP-ribosylation factor ...  70.9    1e-10   Elaeis guineensis
ref|XP_010933331.1|  PREDICTED: probable ADP-ribosylation factor ...  70.9    1e-10   
ref|XP_010931848.1|  PREDICTED: probable ADP-ribosylation factor ...  70.9    1e-10   Elaeis guineensis
ref|XP_008337464.1|  PREDICTED: probable ADP-ribosylation factor ...  70.9    1e-10   
ref|XP_007160352.1|  hypothetical protein PHAVU_002G314400g           70.5    2e-10   Phaseolus vulgaris [French bean]
ref|XP_007160351.1|  hypothetical protein PHAVU_002G314400g           70.5    2e-10   Phaseolus vulgaris [French bean]
ref|XP_010254182.1|  PREDICTED: probable ADP-ribosylation factor ...  70.5    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008343980.1|  PREDICTED: probable ADP-ribosylation factor ...  68.6    6e-10   
ref|XP_007160353.1|  hypothetical protein PHAVU_002G314500g           68.6    7e-10   Phaseolus vulgaris [French bean]
ref|XP_009408824.1|  PREDICTED: probable ADP-ribosylation factor ...  68.2    9e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934816.1|  PREDICTED: probable ADP-ribosylation factor ...  67.8    1e-09   
ref|XP_004512958.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    3e-09   
ref|XP_010688167.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    7e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB27127.1|  hypothetical protein B456_004G279500                  63.9    2e-08   Gossypium raimondii
ref|XP_009402905.1|  PREDICTED: probable ADP-ribosylation factor ...  62.8    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010648572.1|  PREDICTED: probable ADP-ribosylation factor ...  62.8    7e-08   
gb|KJB54155.1|  hypothetical protein B456_009G023500                  62.4    7e-08   Gossypium raimondii
gb|KJB54158.1|  hypothetical protein B456_009G023500                  62.4    8e-08   Gossypium raimondii
gb|KJB27126.1|  hypothetical protein B456_004G279500                  62.0    1e-07   Gossypium raimondii
gb|KJB27130.1|  hypothetical protein B456_004G279500                  62.0    1e-07   Gossypium raimondii
ref|XP_009377378.1|  PREDICTED: probable ADP-ribosylation factor ...  60.8    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_009415353.1|  PREDICTED: probable ADP-ribosylation factor ...  60.1    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415351.1|  PREDICTED: probable ADP-ribosylation factor ...  60.1    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008357498.1|  PREDICTED: probable ADP-ribosylation factor ...  59.7    7e-07   
ref|XP_007013726.1|  ArfGap/RecO-like zinc finger domain-containi...  58.2    2e-06   
ref|XP_006844366.1|  hypothetical protein AMTR_s00142p00058560        57.8    3e-06   
ref|XP_006476221.1|  PREDICTED: probable ADP-ribosylation factor ...  57.4    4e-06   Citrus sinensis [apfelsine]
ref|XP_010527129.1|  PREDICTED: probable ADP-ribosylation factor ...  56.6    6e-06   Tarenaya hassleriana [spider flower]
ref|XP_008808979.1|  PREDICTED: probable ADP-ribosylation factor ...  54.7    3e-05   Phoenix dactylifera
ref|XP_008808989.1|  PREDICTED: probable ADP-ribosylation factor ...  54.7    3e-05   Phoenix dactylifera
ref|XP_008808997.1|  PREDICTED: probable ADP-ribosylation factor ...  54.7    3e-05   Phoenix dactylifera
ref|XP_008809007.1|  PREDICTED: probable ADP-ribosylation factor ...  54.3    3e-05   Phoenix dactylifera
ref|XP_008458192.1|  PREDICTED: probable ADP-ribosylation factor ...  54.3    3e-05   Cucumis melo [Oriental melon]
ref|XP_009762670.1|  PREDICTED: probable ADP-ribosylation factor ...  54.3    4e-05   Nicotiana sylvestris
ref|XP_009592977.1|  PREDICTED: probable ADP-ribosylation factor ...  54.3    4e-05   Nicotiana tomentosiformis
ref|XP_008394008.1|  PREDICTED: probable ADP-ribosylation factor ...  53.5    8e-05   
ref|XP_008352294.1|  PREDICTED: probable ADP-ribosylation factor ...  53.1    1e-04   
ref|XP_003620547.1|  Arf-GAP domain and FG repeats-containing pro...  52.8    1e-04   
ref|XP_009139640.1|  PREDICTED: probable ADP-ribosylation factor ...  52.4    2e-04   Brassica rapa
ref|XP_003620495.1|  Arf-GAP domain and FG repeats-containing pro...  52.4    2e-04   
ref|XP_004139426.1|  PREDICTED: uncharacterized protein LOC101209764  52.4    2e-04   
ref|XP_009592974.1|  PREDICTED: probable ADP-ribosylation factor ...  52.0    2e-04   Nicotiana tomentosiformis
ref|XP_004167945.1|  PREDICTED: uncharacterized LOC101209764          52.0    2e-04   
ref|XP_008219908.1|  PREDICTED: probable ADP-ribosylation factor ...  52.0    3e-04   Prunus mume [ume]
ref|XP_006450579.1|  hypothetical protein CICLE_v10010498mg           51.6    3e-04   
ref|XP_009139639.1|  PREDICTED: probable ADP-ribosylation factor ...  51.2    4e-04   Brassica rapa
ref|XP_009139636.1|  PREDICTED: probable ADP-ribosylation factor ...  50.8    5e-04   Brassica rapa
ref|XP_010670775.1|  PREDICTED: uncharacterized protein LOC104887747  50.8    6e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007227166.1|  hypothetical protein PRUPE_ppa024658mg           50.4    7e-04   
ref|XP_008378298.1|  PREDICTED: uncharacterized protein LOC103441401  48.1    8e-04   
gb|KJB27131.1|  hypothetical protein B456_004G279500                  50.4    9e-04   Gossypium raimondii



>ref|XP_009627508.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
Length=695

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 104/148 (70%), Gaps = 4/148 (3%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHR  553
            G +M YNM + T  L QP KS+NPFD  +EPS  QASTFPSMASLQGALPN+ APTGL  
Sbjct  552  GFAMQYNMSMATNALPQPSKSANPFDVINEPSS-QASTFPSMASLQGALPNMVAPTGLLH  610

Query  552  TSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAM  373
            TSSLG PT +P  MPQQ P YAS   P +YMG  +AGSMPQRP            AFGA+
Sbjct  611  TSSLGAPTSYPPAMPQQSPSYASAVLPGSYMGHQVAGSMPQRP---PGVASFGFDAFGAL  667

Query  372  HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +++QQ GGL++APA QNTFS   GNPFG
Sbjct  668  NSNQQPGGLYSAPATQNTFSSSGGNPFG  695



>ref|XP_009627509.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana tomentosiformis]
Length=694

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 104/148 (70%), Gaps = 4/148 (3%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHR  553
            G +M YNM + T  L QP KS+NPFD  +EPS  QASTFPSMASLQGALPN+ APTGL  
Sbjct  551  GFAMQYNMSMATNALPQPSKSANPFDVINEPSS-QASTFPSMASLQGALPNMVAPTGLLH  609

Query  552  TSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAM  373
            TSSLG PT +P  MPQQ P YAS   P +YMG  +AGSMPQRP            AFGA+
Sbjct  610  TSSLGAPTSYPPAMPQQSPSYASAVLPGSYMGHQVAGSMPQRP---PGVASFGFDAFGAL  666

Query  372  HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +++QQ GGL++APA QNTFS   GNPFG
Sbjct  667  NSNQQPGGLYSAPATQNTFSSSGGNPFG  694



>ref|XP_009776200.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana sylvestris]
Length=693

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 104/148 (70%), Gaps = 4/148 (3%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHR  553
            G +M YNM + T  L QP KS+NPFD  +EPS  QASTFPSMASLQGALPN+  PTGL  
Sbjct  550  GFAMQYNMSMATNALPQPSKSANPFDVINEPSS-QASTFPSMASLQGALPNMVPPTGLLH  608

Query  552  TSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAM  373
            TSSLG PT +P  MPQQ P YAS  PP +YMG  +AGSMPQR             AFGA+
Sbjct  609  TSSLGAPTSYPPAMPQQSPSYASAVPPGSYMGHQVAGSMPQR---SPGVASFGFDAFGAL  665

Query  372  HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +++QQ GGL++APA+QNTFS   GNPFG
Sbjct  666  NSNQQPGGLYSAPASQNTFSSSGGNPFG  693



>ref|XP_009776199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana sylvestris]
Length=694

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 104/148 (70%), Gaps = 4/148 (3%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHR  553
            G +M YNM + T  L QP KS+NPFD  +EPS  QASTFPSMASLQGALPN+  PTGL  
Sbjct  551  GFAMQYNMSMATNALPQPSKSANPFDVINEPSS-QASTFPSMASLQGALPNMVPPTGLLH  609

Query  552  TSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAM  373
            TSSLG PT +P  MPQQ P YAS  PP +YMG  +AGSMPQR             AFGA+
Sbjct  610  TSSLGAPTSYPPAMPQQSPSYASAVPPGSYMGHQVAGSMPQR---SPGVASFGFDAFGAL  666

Query  372  HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +++QQ GGL++APA+QNTFS   GNPFG
Sbjct  667  NSNQQPGGLYSAPASQNTFSSSGGNPFG  694



>ref|XP_006353447.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Solanum tuberosum]
Length=695

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHR  553
            G +M YNM + T    QP KS+NPFD  +EP+  QA TFPSM+SLQGALPN+ APTGL  
Sbjct  550  GFAMQYNMSMATNAFPQPSKSTNPFDVINEPTS-QAPTFPSMSSLQGALPNMAAPTGLLH  608

Query  552  TSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAM  373
            TS+LG P  +P  +PQQ P YAS  PP +YMG  +AGSMPQRP      FG DG AFG +
Sbjct  609  TSNLGAPISYPPAIPQQAPSYASANPPGSYMGHQVAGSMPQRP-PGVASFGFDGVAFGGL  667

Query  372  HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +++QQ GGL++AP  QNTFS   GNPFG
Sbjct  668  NSNQQSGGLYSAPPTQNTFSSSGGNPFG  695



>ref|XP_004251595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Solanum lycopersicum]
 ref|XP_010313725.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Solanum lycopersicum]
Length=691

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHR  553
            G +M YNM + T    QP K++NPFD  +EP+  QA TFPSM+SLQGALPN+ APTGL  
Sbjct  547  GFAMQYNMSMATNAFPQPSKTTNPFDVINEPTS-QAPTFPSMSSLQGALPNMAAPTGLLH  605

Query  552  TSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAM  373
            TSSLG PT +P  MPQQ P YAS  PP +YMG  +AGSMPQRP      FG DG AFG +
Sbjct  606  TSSLGAPT-YPPAMPQQAPSYASAIPPGSYMGHQVAGSMPQRP-PGVASFGFDGVAFGGL  663

Query  372  HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +++QQ GGL++AP  QNTFS   GNPFG
Sbjct  664  NSNQQPGGLYSAPPTQNTFSSSGGNPFG  691



>ref|XP_011078363.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
Length=699

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPI-KSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            G  M YNM +  P   QP+ +S+NPFD  +EPSP+QASTFPS+ASL GALP    P+GL 
Sbjct  553  GVPMQYNMPMVVPNF-QPVSRSANPFDVGNEPSPVQASTFPSLASLGGALPQTTTPSGLL  611

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
            RTSSLG   PHP  M  Q P YAS  PP++ + Q +AG+M  RP+    GF +   AF  
Sbjct  612  RTSSLGGLPPHPPSMLAQGPSYASATPPSSVIQQEIAGTMTPRPQG-LSGFSIQDPAFAP  670

Query  375  MHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            ++ + QLGGLH A +A + F+   GNPFG
Sbjct  671  LNPNSQLGGLHPAQSASSNFTSLGGNPFG  699



>ref|XP_002515587.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47036.1| conserved hypothetical protein [Ricinus communis]
Length=401

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = -2

Query  735  IGXSMPY-NMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G +M Y N     PT +QP KS NPFD  +EPS +QA TFPSMASLQ ALPN+   +GL
Sbjct  244  VGFAMQYINAAAPMPTSIQPSKSMNPFD-LNEPSTVQAQTFPSMASLQSALPNMPTSSGL  302

Query  558  HRTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalg  406
             RTSSLG P+         P+P  +P Q   YAS  PP  YM Q ++ +MP      A G
Sbjct  303  QRTSSLGAPSAAWMPSHSLPYPSALPPQALSYASAVPPRVYMAQQVSNNMPLSGHQGAGG  362

Query  405  fgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            FG DGAAFGAM+T+QQL G   APAA + FS   GNPFG
Sbjct  363  FGADGAAFGAMNTNQQLAGRFPAPAAPSPFSSVGGNPFG  401



>gb|EYU23027.1| hypothetical protein MIMGU_mgv1a004452mg [Erythranthe guttata]
Length=526

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 88/130 (68%), Gaps = 4/130 (3%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPTPHPYRMPQQPP  496
            +S+NPFD  ++PSPLQ STFPS+A +Q  LP    P+GL RT+SLGTP PHP  M  Q P
Sbjct  400  RSTNPFDVGNDPSPLQTSTFPSVAPMQEPLPRTANPSGLLRTASLGTPQPHPPSMFGQAP  459

Query  495  XYASTQPPNAYMGQNLAGSMPQRPRDQalgf-gldgaafgAMHTSQQLGGLHAAPAAQNT  319
             YAST PP ++ GQ + GSMP  PR Q L   G D +AF +M+ +  LGGLH A +A N 
Sbjct  460  AYASTVPPGSFAGQEIPGSMP--PRQQGLSGFGFDESAFASMNPNPHLGGLHHAHSASN-  516

Query  318  FSPPAGNPFG  289
            F+  +GNPFG
Sbjct  517  FTSASGNPFG  526



>gb|KDP32306.1| hypothetical protein JCGZ_13231 [Jatropha curcas]
Length=717

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 96/159 (60%), Gaps = 12/159 (8%)
 Frame = -2

Query  735  IGXSMPY-NMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G +M Y N  V  PT VQ  KS+NPFD  +E SP Q  TFPSMA LQGALPN+   +GL
Sbjct  561  MGFAMQYSNAAVPMPTYVQQSKSTNPFD-LNESSPAQVHTFPSMAPLQGALPNMPPSSGL  619

Query  558  HRTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalg  406
             R SSLGTP+         P+P  +P QPP YAS  PP AYM Q +  +M         G
Sbjct  620  QRASSLGTPSSAWMPSQSLPYPSALPSQPPPYASAMPPRAYMAQ-VPSNMSFSGHQGVGG  678

Query  405  fgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            F  DGAAFGA++  QQL G  +APAA  +FS   GNPFG
Sbjct  679  FSTDGAAFGAINMDQQLAGRFSAPAAPTSFSSVGGNPFG  717



>emb|CDP03358.1| unnamed protein product [Coffea canephora]
Length=714

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -2

Query  735  IGXSMPYNMQV-QTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G +M YNM +   PT  Q  KS+NPFD +++PSP  A+ FPSMASLQGALP + AP GL
Sbjct  568  MGFNMQYNMPMPMQPTFPQSSKSTNPFDVSADPSP--AAAFPSMASLQGALPPLAAPAGL  625

Query  558  HRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafg  379
             +TSSLG P  HP  +    P YAS  P    + Q L G+M  RP  Q + +G++  AFG
Sbjct  626  LQTSSLGAPLAHPSALLPNGPPYASIMPSTTNLMQQLPGNMAPRPHGQ-VSYGIESGAFG  684

Query  378  AMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
             + ++ QL  L + PAA NTFS   GNPFG
Sbjct  685  PLSSNPQLSVLQSVPAAPNTFSSIGGNPFG  714



>emb|CBI36171.3| unnamed protein product [Vitis vinifera]
Length=734

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 93/160 (58%), Gaps = 12/160 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G  M Y + ++ P+  Q  +S NPFD  SE + +QA  FPSMA LQGALPN  APTGL 
Sbjct  576  MGFGMQYPIAMRAPSFPQASRSINPFDVNSEAALVQAPMFPSMAPLQGALPNASAPTGLL  635

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPP-----------NAYMGQNLAGSMPQRPRDQal  409
            R SSLGT   HP  +  Q   YAS+ PP           + YMGQ +  ++P        
Sbjct  636  RPSSLGTAM-HPQWVQSQTQAYASSMPPQPLPYVSGMPQSMYMGQQMHSNLPHPGHQAVG  694

Query  408  gfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GFG DGAAFG  + +QQLGG  +APA  N+FS   GNPFG
Sbjct  695  GFGRDGAAFGPSNMNQQLGGRFSAPATPNSFSSMGGNPFG  734



>ref|XP_007203783.1| hypothetical protein PRUPE_ppa001945mg [Prunus persica]
 gb|EMJ04982.1| hypothetical protein PRUPE_ppa001945mg [Prunus persica]
Length=738

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 97/182 (53%), Gaps = 34/182 (19%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G +M YN  V  PT  Q  KS+NPFD  SEP P+QASTFPS AS Q ALPNV   +P G
Sbjct  558  MGFAMQYNTAVPMPTFQQSSKSANPFDVNSEP-PIQASTFPSAASFQAALPNVQSLSPPG  616

Query  561  LHRTSSLGTP-------------------------------TPHPYRMPQQPPXYASTQP  475
            L RTSSL TP                               + +   +P Q P YAS  P
Sbjct  617  LVRTSSLNTPSSAWMPLQSSSYSSAVPPQAPQYASQVPPQLSSYSSAVPPQAPQYASQMP  676

Query  474  PNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNP  295
            P AYM Q +  SMP      A+GFG +G+AF +++T QQL G  +APA  N +S   GNP
Sbjct  677  PRAYMVQQVPSSMPPSGYQGAVGFGSEGSAFASLNTDQQLIGRFSAPATPNPYSSAGGNP  736

Query  294  FG  289
            FG
Sbjct  737  FG  738



>ref|XP_010654688.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654689.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654690.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654691.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654692.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
Length=736

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 90/160 (56%), Gaps = 12/160 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
             G   P  M  + P+  Q  +S NPFD  SE + +QA  FPSMA LQGALPN  APTGL 
Sbjct  578  FGMQYPIAMLQRAPSFPQASRSINPFDVNSEAALVQAPMFPSMAPLQGALPNASAPTGLL  637

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPP-----------NAYMGQNLAGSMPQRPRDQal  409
            R SSLGT   HP  +  Q   YAS+ PP           + YMGQ +  ++P        
Sbjct  638  RPSSLGTAM-HPQWVQSQTQAYASSMPPQPLPYVSGMPQSMYMGQQMHSNLPHPGHQAVG  696

Query  408  gfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GFG DGAAFG  + +QQLGG  +APA  N+FS   GNPFG
Sbjct  697  GFGRDGAAFGPSNMNQQLGGRFSAPATPNSFSSMGGNPFG  736



>ref|XP_010654693.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Vitis vinifera]
 ref|XP_010654694.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Vitis vinifera]
Length=717

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 90/160 (56%), Gaps = 12/160 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
             G   P  M  + P+  Q  +S NPFD  SE + +QA  FPSMA LQGALPN  APTGL 
Sbjct  559  FGMQYPIAMLQRAPSFPQASRSINPFDVNSEAALVQAPMFPSMAPLQGALPNASAPTGLL  618

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPP-----------NAYMGQNLAGSMPQRPRDQal  409
            R SSLGT   HP  +  Q   YAS+ PP           + YMGQ +  ++P        
Sbjct  619  RPSSLGTAM-HPQWVQSQTQAYASSMPPQPLPYVSGMPQSMYMGQQMHSNLPHPGHQAVG  677

Query  408  gfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GFG DGAAFG  + +QQLGG  +APA  N+FS   GNPFG
Sbjct  678  GFGRDGAAFGPSNMNQQLGGRFSAPATPNSFSSMGGNPFG  717



>ref|XP_011458060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011458085.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Fragaria vesca subsp. vesca]
Length=726

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +MPYN  +  P+  Q +KS+NPFD +S+P P+QASTF SMA  QG LPNV  P+ L 
Sbjct  573  MGFAMPYNTAMPIPSFQQSLKSANPFDVSSDPPPVQASTFHSMAPSQGPLPNVQPPSDLL  632

Query  555  RTSSLGTPTPHPY------RMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
            RTSSLG   P  +       +P Q P YAS  PP+AY GQ +  S+P      A GF  +
Sbjct  633  RTSSLGA-LPSAWGPSYSSGLPLQAPPYASQMPPSAYAGQQIPSSLPPPGYQGAGGFSAE  691

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GAAFG+++   Q  G ++APA  N F    GNPFG
Sbjct  692  GAAFGSLNMVHQPVGRYSAPATPNPFPSAGGNPFG  726



>ref|XP_004287082.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Fragaria vesca subsp. vesca]
Length=701

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +MPYN  +  P+  Q +KS+NPFD +S+P P+QASTF SMA  QG LPNV  P+ L 
Sbjct  548  MGFAMPYNTAMPIPSFQQSLKSANPFDVSSDPPPVQASTFHSMAPSQGPLPNVQPPSDLL  607

Query  555  RTSSLGTPTPHPY------RMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
            RTSSLG   P  +       +P Q P YAS  PP+AY GQ +  S+P      A GF  +
Sbjct  608  RTSSLGA-LPSAWGPSYSSGLPLQAPPYASQMPPSAYAGQQIPSSLPPPGYQGAGGFSAE  666

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GAAFG+++   Q  G ++APA  N F    GNPFG
Sbjct  667  GAAFGSLNMVHQPVGRYSAPATPNPFPSAGGNPFG  701



>ref|XP_008242599.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=738

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 94/182 (52%), Gaps = 34/182 (19%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G +M YN  V  P   Q  KS+NPFD  SEP P+QASTFPS AS Q ALPNV   +P G
Sbjct  558  MGFAMQYNTAVPMPVFQQSSKSANPFDVNSEP-PIQASTFPSAASFQAALPNVQSLSPPG  616

Query  561  LHRTSSLGTP-------------------------------TPHPYRMPQQPPXYASTQP  475
            L RTSSL TP                               + +   +P Q P YAS  P
Sbjct  617  LVRTSSLNTPSSAWMPLQSSSYSSVVPPQAPQYASQVPPQLSSYSSAVPPQAPQYASRMP  676

Query  474  PNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNP  295
            P AYM Q +  SMP      A+GFG  G+AF +++T QQ  G  +APA  N +S   GNP
Sbjct  677  PRAYMVQQVPSSMPPSGYQGAVGFGSVGSAFASLNTDQQQIGRFSAPATPNPYSSAGGNP  736

Query  294  FG  289
            FG
Sbjct  737  FG  738



>gb|KJB64872.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
 gb|KJB64873.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
 gb|KJB64874.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
Length=740

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G  M YN  V   +L Q  +S NPFD  SE  P+Q  TFPSMASLQGALPN+  P+G  
Sbjct  596  MGLMMQYNTAVPMSSLPQSSRSMNPFDLGSEAPPVQTQTFPSMASLQGALPNMPPPSGPV  655

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
            RTSSLGTP+   +  PQ  P YAS+     Y G  L  S+P  P    +G       FG 
Sbjct  656  RTSSLGTPS-SAWMSPQSLP-YASSVAQRPYPGAQLPNSLP--PSSHHIGGIGSEVCFGF  711

Query  375  MHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            ++T QQ+ G  AAPAA   FS   GNPFG
Sbjct  712  VNTDQQVAGRLAAPAAPQPFSSVGGNPFG  740



>ref|XP_008793443.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Phoenix dactylifera]
Length=667

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 89/157 (57%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  MPYNMQVQTPTLV----QPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            M Y MQ  T  +V    Q +KS+NPFD T+EP+PL A  FPSMASLQG++PN+  P  L 
Sbjct  513  MGYGMQYPTGMIVPAYPQLVKSANPFDLTNEPAPLSAPMFPSMASLQGSIPNMSVPRNLL  572

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR--------PRDQalgfg  400
            R+ S G P+P   +MP Q P Y S+  P+ YM Q +  +M                +G G
Sbjct  573  RSCSFGGPSPR--QMPSQQPSYLSSISPSLYMMQQVPSNMRHHVPTNMVPMVHQGIVGLG  630

Query  399  ldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
             +GAAFG++       G ++ P+  N+FSP  GNPFG
Sbjct  631  SEGAAFGSIGIDHHPAGRYSLPSTPNSFSPAGGNPFG  667



>ref|XP_010656352.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1 
isoform X2 [Vitis vinifera]
Length=758

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 89/169 (53%), Gaps = 20/169 (12%)
 Frame = -2

Query  735  IGXSMPYNMQVQTP-TLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G  + YN     P T     KS+NPFD  +EP P QA TFPSMASLQG+LPN+    GL
Sbjct  590  MGFHLQYNTAAPLPSTFSHSSKSTNPFDLNNEPPPAQAPTFPSMASLQGSLPNMPPSMGL  649

Query  558  HRTSSLGTPT-------------------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSM  436
              +SS GT +                   P+   MP Q P YAS  PP AYMGQ + G++
Sbjct  650  LHSSSAGTQSTWTPPQSSLYPLAMPPQAPPYVSGMPPQVPPYASGMPPRAYMGQQVPGAI  709

Query  435  PQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            P         FG + AAF +++ +  +GG  +APAA +  S   GNPFG
Sbjct  710  PPSSHQGVGSFGSEDAAFSSLNPNHLIGGRSSAPAALDKLSSVGGNPFG  758



>ref|XP_002281316.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 emb|CBI28100.3| unnamed protein product [Vitis vinifera]
Length=759

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 89/169 (53%), Gaps = 20/169 (12%)
 Frame = -2

Query  735  IGXSMPYNMQVQTP-TLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G  + YN     P T     KS+NPFD  +EP P QA TFPSMASLQG+LPN+    GL
Sbjct  591  MGFHLQYNTAAPLPSTFSHSSKSTNPFDLNNEPPPAQAPTFPSMASLQGSLPNMPPSMGL  650

Query  558  HRTSSLGTPT-------------------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSM  436
              +SS GT +                   P+   MP Q P YAS  PP AYMGQ + G++
Sbjct  651  LHSSSAGTQSTWTPPQSSLYPLAMPPQAPPYVSGMPPQVPPYASGMPPRAYMGQQVPGAI  710

Query  435  PQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            P         FG + AAF +++ +  +GG  +APAA +  S   GNPFG
Sbjct  711  PPSSHQGVGSFGSEDAAFSSLNPNHLIGGRSSAPAALDKLSSVGGNPFG  759



>ref|XP_007013233.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 ref|XP_007013235.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 gb|EOY30852.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 gb|EOY30854.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
Length=753

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 79/158 (50%), Gaps = 12/158 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G  M Y+  V      Q  KS NPFD   E  P+Q  TFPSMASLQGALPNV   +GL 
Sbjct  599  MGFIMQYSTAVPMSAFPQSSKSINPFDLGGEAPPVQNQTFPSMASLQGALPNVPPASGLV  658

Query  555  RTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
            R SSLGTP+         P+   MP Q   YAS  P  AY G  L  ++P          
Sbjct  659  RASSLGTPSSAWMPAQALPYASGMPSQSLPYASAVPQRAYTGAQLPSNLPP---SSHQIG  715

Query  402  gldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                A+FG ++  QQ+ G  +AP     FS   GNPFG
Sbjct  716  IGSEASFGFVNADQQVAGRFSAPTTPQPFSSVGGNPFG  753



>ref|XP_007013231.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 ref|XP_007013234.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 gb|EOY30850.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 gb|EOY30853.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
Length=752

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 79/158 (50%), Gaps = 12/158 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G  M Y+  V      Q  KS NPFD   E  P+Q  TFPSMASLQGALPNV   +GL 
Sbjct  598  MGFIMQYSTAVPMSAFPQSSKSINPFDLGGEAPPVQNQTFPSMASLQGALPNVPPASGLV  657

Query  555  RTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
            R SSLGTP+         P+   MP Q   YAS  P  AY G  L  ++P          
Sbjct  658  RASSLGTPSSAWMPAQALPYASGMPSQSLPYASAVPQRAYTGAQLPSNLPP---SSHQIG  714

Query  402  gldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                A+FG ++  QQ+ G  +AP     FS   GNPFG
Sbjct  715  IGSEASFGFVNADQQVAGRFSAPTTPQPFSSVGGNPFG  752



>ref|XP_006583393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
 ref|XP_006583394.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Glycine max]
 ref|XP_006583395.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Glycine max]
Length=681

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 87/155 (56%), Gaps = 10/155 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS NPFD +SEP+  QA TFPSM+SLQGALP V  P  +H
Sbjct  531  MGISMQYNNVVPVPSFPQPSKSINPFDVSSEPTANQAPTFPSMSSLQGALPGVPPPGAVH  590

Query  555  RTSSLGTPTPHPYR------MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT H +       +P Q    A+   P  YMGQ +  +MP  PR +   FG  
Sbjct  591  -PSSMGNPT-HGWTPLSSSFLPAQTQMRATALGPRPYMGQQMPTNMPM-PRQEVGNFGNQ  647

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  +  QQL G  +     N+F P  GNPFG
Sbjct  648  GAVFGLSNPDQQLTGRLSNTPTSNSF-PTGGNPFG  681



>ref|XP_003630818.1| hypothetical protein MTR_8g103750 [Medicago truncatula]
 gb|AET05294.1| ARF GTPase activator [Medicago truncatula]
Length=688

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 89/159 (56%), Gaps = 13/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  +  P+  QP +S+NPFD  +EP+P+QA TFPSM+SLQGALP V AP+   
Sbjct  533  MGVSVQYNNVMSMPSFPQPSQSTNPFDVINEPTPVQAPTFPSMSSLQGALPTV-APSAAV  591

Query  555  RTSSLGT-------PTPHPY--RMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
              S++G        P+   Y   +P Q   +AS   P AYMGQ L  ++P  PR Q +G 
Sbjct  592  NPSNMGNQSLSWNPPSSLSYAPTLPPQAHIHASAMGPRAYMGQQLPTNVPM-PRHQGIGT  650

Query  402  gldgaafgAM-HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
              +  A     +  QQL G  +A A  N F P  GNPFG
Sbjct  651  FGNEGAAFGFSNIDQQLNGRSSASATLNPF-PAGGNPFG  688



>gb|KEH21362.1| ARF GTPase activator [Medicago truncatula]
Length=623

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 89/159 (56%), Gaps = 13/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  +  P+  QP +S+NPFD  +EP+P+QA TFPSM+SLQGALP V AP+   
Sbjct  468  MGVSVQYNNVMSMPSFPQPSQSTNPFDVINEPTPVQAPTFPSMSSLQGALPTV-APSAAV  526

Query  555  RTSSLGT-------PTPHPY--RMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
              S++G        P+   Y   +P Q   +AS   P AYMGQ L  ++P  PR Q +G 
Sbjct  527  NPSNMGNQSLSWNPPSSLSYAPTLPPQAHIHASAMGPRAYMGQQLPTNVPM-PRHQGIGT  585

Query  402  gldgaafgAM-HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
              +  A     +  QQL G  +A A  N F P  GNPFG
Sbjct  586  FGNEGAAFGFSNIDQQLNGRSSASATLNPF-PAGGNPFG  623



>gb|KHN20701.1| hypothetical protein glysoja_019018 [Glycine soja]
Length=616

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 87/155 (56%), Gaps = 10/155 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS NPFD +SEP+  QA TFPSM+SLQGALP V  P  +H
Sbjct  466  MGISMQYNNVVPVPSFPQPSKSINPFDVSSEPTANQAPTFPSMSSLQGALPGVPPPGAVH  525

Query  555  RTSSLGTPTPHPYR------MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT H +       +P Q    A+   P  YMGQ +  +MP  PR +   FG  
Sbjct  526  -PSSMGNPT-HGWTPLSSSFLPAQTQMRATALGPRPYMGQQMPTNMPM-PRQEVGNFGNQ  582

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  +  QQL G  +     N+F P  GNPFG
Sbjct  583  GAVFGLSNPDQQLTGRLSNTPTSNSF-PTGGNPFG  616



>ref|XP_004512853.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
Length=687

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 84/159 (53%), Gaps = 12/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  V  P   QP KS+NPFD  +EP+P+QA TFPSM+SLQGALP+V  P+   
Sbjct  531  MGISVQYNNMVSMPGFPQPSKSTNPFDVINEPTPVQAPTFPSMSSLQGALPSV-TPSATV  589

Query  555  RTSSLGTPT-----PHPYR----MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
             TS +G  +     PH       +P Q   +AS   P AY+ Q +  +MP  PR Q +G 
Sbjct  590  HTSHMGNQSLAWNPPHSLSYAPMLPPQAQTHASAMGPRAYVEQQIPTNMPM-PRHQGIGT  648

Query  402  gldgaafgAM-HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                 A     +  QQL G  +  A  N F    GNPFG
Sbjct  649  FGTEGAAFGFSNIDQQLTGRLSTSATLNPFPAAGGNPFG  687



>ref|XP_006587509.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
 gb|KHN32007.1| Arf-GAP domain and FG repeat-containing protein 1 [Glycine soja]
Length=680

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS+NPFD +SEP+  QA TFPSM+SLQGALP+V  P G  
Sbjct  530  MGISMQYN-NVPVPSFPQPSKSTNPFDVSSEPTANQAPTFPSMSSLQGALPSV-PPAGAV  587

Query  555  RTSSLGTPT------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT      P    +P Q   +A+   P AYM Q +  +MP  PR +   FG  
Sbjct  588  HPSSMGNPTHGWTPPPASSFLPAQAQMHATALGPRAYMEQQIPTNMPM-PRQEVGNFGNQ  646

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  + +QQL G  +     N+F P  GNPFG
Sbjct  647  GAVFGLSNPNQQLIGRLSNTPTSNSF-PTGGNPFG  680



>gb|KDO54160.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=677

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 86/166 (52%), Gaps = 21/166 (13%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTS
Sbjct  513  AMQYNTAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTS  572

Query  546  SLGTP---------TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQR  427
            SL TP         +P+P  MP Q P YA+             PP  Y+G  +  ++P  
Sbjct  573  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPS  631

Query  426  PRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                  G G +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  632  GHQGMGGLGSEGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  677



>ref|XP_006587511.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Glycine max]
Length=644

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS+NPFD +SEP+  QA TFPSM+SLQGALP+V  P G  
Sbjct  494  MGISMQYN-NVPVPSFPQPSKSTNPFDVSSEPTANQAPTFPSMSSLQGALPSV-PPAGAV  551

Query  555  RTSSLGTPT------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT      P    +P Q   +A+   P AYM Q +  +MP  PR +   FG  
Sbjct  552  HPSSMGNPTHGWTPPPASSFLPAQAQMHATALGPRAYMEQQIPTNMPM-PRQEVGNFGNQ  610

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  + +QQL G  +     N+F P  GNPFG
Sbjct  611  GAVFGLSNPNQQLIGRLSNTPTSNSF-PTGGNPFG  644



>ref|XP_006587512.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Glycine max]
Length=581

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS+NPFD +SEP+  QA TFPSM+SLQGALP+V  P G  
Sbjct  431  MGISMQYN-NVPVPSFPQPSKSTNPFDVSSEPTANQAPTFPSMSSLQGALPSV-PPAGAV  488

Query  555  RTSSLGTPT------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT      P    +P Q   +A+   P AYM Q +  +MP  PR +   FG  
Sbjct  489  HPSSMGNPTHGWTPPPASSFLPAQAQMHATALGPRAYMEQQIPTNMPM-PRQEVGNFGNQ  547

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  + +QQL G  +     N+F P  GNPFG
Sbjct  548  GAVFGLSNPNQQLIGRLSNTPTSNSF-PTGGNPFG  581



>ref|XP_006451098.1| hypothetical protein CICLE_v100075541mg, partial [Citrus clementina]
 ref|XP_006451099.1| hypothetical protein CICLE_v100075541mg, partial [Citrus clementina]
 gb|ESR64338.1| hypothetical protein CICLE_v100075541mg, partial [Citrus clementina]
 gb|ESR64339.1| hypothetical protein CICLE_v100075541mg, partial [Citrus clementina]
Length=720

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 86/166 (52%), Gaps = 21/166 (13%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTS
Sbjct  556  AMQYNAAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTS  615

Query  546  SLGTP---------TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQR  427
            SL TP         +P+P  MP Q P YA+             PP  Y+G  +  ++P  
Sbjct  616  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPS  674

Query  426  PRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                  G G +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  675  GHQGMGGLGSEGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  720



>gb|KDO54156.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
 gb|KDO54157.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
 gb|KDO54158.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=753

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 86/166 (52%), Gaps = 21/166 (13%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTS
Sbjct  589  AMQYNTAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTS  648

Query  546  SLGTP---------TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQR  427
            SL TP         +P+P  MP Q P YA+             PP  Y+G  +  ++P  
Sbjct  649  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPS  707

Query  426  PRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                  G G +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  708  GHQGMGGLGSEGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  753



>gb|KHN21549.1| Arf-GAP domain and FG repeat-containing protein 1 [Glycine soja]
Length=697

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  V  P+  QP KS+NPFD +SEP+P+QA  FPSM+SLQGALP+V  P+   
Sbjct  543  MGISIQYNNAVPMPSYAQPSKSTNPFDVSSEPTPVQAPMFPSMSSLQGALPSV-TPSATM  601

Query  555  RTSSLGTPT----PH----PYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfg  400
              S++G  +    PH     Y +P Q    A      AYMGQ +A +MP  PR Q +G  
Sbjct  602  HPSNMGNISHAWNPHSSSPSYVLPPQAQTLAPAMGLGAYMGQQMATNMPM-PRHQGIGSF  660

Query  399  ldgaafgAMHT-SQQLGGLHAAPAAQNTFSPPAGNPFG  289
               A         QQL G  +  A  NT+    GNPFG
Sbjct  661  ATEATAFGFSNPDQQLTGRLSTAATPNTYH-AGGNPFG  697



>gb|KHG17023.1| hypothetical protein F383_09821 [Gossypium arboreum]
Length=774

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 87/181 (48%), Gaps = 34/181 (19%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M YN  V   +  Q  +S NPFD  SE   +Q  TFPSMASLQGALPN+  P+G  
Sbjct  596  MGLTMQYNTAVPMSSFPQSSRSINPFDLGSEAPAVQTQTFPSMASLQGALPNMSPPSGPV  655

Query  555  RTSSLGTP----------------------TPHPYRM-PQQPPX---------YASTQPP  472
            RTS LGTP                      TP P  M PQ  P          YAS+   
Sbjct  656  RTSGLGTPSPAWMSPQSLPYASGMLLQCAGTPSPAWMSPQSLPYASGMLLQLPYASSVAQ  715

Query  471  NAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPF  292
              Y G  L  S+P  P    +G      +F  ++T+QQ+ G  AAPAA + FS   GNPF
Sbjct  716  RPYQGAQLPNSLP--PSSHQIGGIGSEVSFSFVNTNQQVAGRLAAPAAPHPFSSVGGNPF  773

Query  291  G  289
            G
Sbjct  774  G  774



>ref|XP_006587510.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Glycine max]
Length=679

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 89/155 (57%), Gaps = 11/155 (7%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS+NPFD +SEP+  QA TFPSM+SLQGALP+V  P G  
Sbjct  530  MGISMQYNNPV--PSFPQPSKSTNPFDVSSEPTANQAPTFPSMSSLQGALPSV-PPAGAV  586

Query  555  RTSSLGTPT------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT      P    +P Q   +A+   P AYM Q +  +MP  PR +   FG  
Sbjct  587  HPSSMGNPTHGWTPPPASSFLPAQAQMHATALGPRAYMEQQIPTNMPM-PRQEVGNFGNQ  645

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  + +QQL G  +     N+F P  GNPFG
Sbjct  646  GAVFGLSNPNQQLIGRLSNTPTSNSF-PTGGNPFG  679



>ref|XP_006583396.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Glycine max]
Length=680

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 87/155 (56%), Gaps = 11/155 (7%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP KS NPFD +SEP+  QA TFPSM+SLQGALP V  P  +H
Sbjct  531  MGISMQYN-NVPVPSFPQPSKSINPFDVSSEPTANQAPTFPSMSSLQGALPGVPPPGAVH  589

Query  555  RTSSLGTPTPHPYR------MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgld  394
              SS+G PT H +       +P Q    A+   P  YMGQ +  +MP  PR +   FG  
Sbjct  590  -PSSMGNPT-HGWTPLSSSFLPAQTQMRATALGPRPYMGQQMPTNMPM-PRQEVGNFGNQ  646

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA FG  +  QQL G  +     N+F P  GNPFG
Sbjct  647  GAVFGLSNPDQQLTGRLSNTPTSNSF-PTGGNPFG  680



>ref|XP_010088856.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
 gb|EXB37053.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
Length=767

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 91/183 (50%), Gaps = 38/183 (21%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPN--------  580
            +G  M YN  +  PT  Q  KS+NPFD  S+P P+Q   FPSM  LQ ALPN        
Sbjct  589  MGYPMQYNPAMPIPTYQQSSKSTNPFDLNSDP-PVQVPAFPSMVPLQSALPNVLNPSGLP  647

Query  579  -----------VGA------PTGLHRTSSLGTPTPHPYRMPQQ-------PPX--YASTQ  478
                       VG       P+GL RTSSLG P+     MPQ        PP   Y S  
Sbjct  648  PSGMPPSIIPTVGVPPSSMPPSGLMRTSSLGAPSSA--WMPQSSAYTSVFPPHAPYGSAM  705

Query  477  PPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGN  298
            PP AY+GQ + G+MP        G   +GAAFG+++T QQLGG  +AP     F P  GN
Sbjct  706  PPRAYIGQQVPGNMPAFGHQGVGGGVAEGAAFGSVNTDQQLGGRFSAPTTPTPF-PSGGN  764

Query  297  PFG  289
            PFG
Sbjct  765  PFG  767



>ref|XP_002324405.1| Rev interacting-like family protein [Populus trichocarpa]
 gb|EEF02970.1| Rev interacting-like family protein [Populus trichocarpa]
Length=649

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 90/159 (57%), Gaps = 14/159 (9%)
 Frame = -2

Query  735  IGXSMPYN-MQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G ++ YN +    PT +Q  KS+NPFD +    P+QA  FPSM  L  ALPN+  P+GL
Sbjct  495  MGFAVQYNSVPASMPTFLQQPKSANPFDLSE---PVQAQHFPSMTPLHAALPNM-PPSGL  550

Query  558  HRTSSLGTPTP---------HPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalg  406
               SSLGTP+P         +P  +P Q P Y+S+ PP AY+ Q    SMP        G
Sbjct  551  QHASSLGTPSPAWMSPQSSPYPPALPSQAPPYSSSIPPRAYVAQQAPSSMPFAGHQVGGG  610

Query  405  fgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            FG DGAAFGA++  QQ+ G  +AP     FS   GNPFG
Sbjct  611  FGGDGAAFGAVNMDQQVAGRFSAPPTPQPFSSVGGNPFG  649



>ref|XP_011043437.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
 ref|XP_011043438.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
 ref|XP_011043439.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
Length=739

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 90/159 (57%), Gaps = 14/159 (9%)
 Frame = -2

Query  735  IGXSMPYN-MQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            +G ++ YN +    PT +Q  KS+NPFD +    P+QA  FPSM  L  ALPN+  P+GL
Sbjct  585  MGFAVQYNSVPASMPTFLQQPKSANPFDLSE---PVQAQHFPSMTPLHAALPNM-PPSGL  640

Query  558  HRTSSLGTPTP---------HPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalg  406
              TSSLGTP+P         +P  +P Q P Y+S+ PP  Y+ Q    SMP        G
Sbjct  641  QHTSSLGTPSPAWMLPQSSPYPPALPSQAPPYSSSVPPRVYVAQQAPSSMPFAGHQVVGG  700

Query  405  fgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            FG DGAAFGA++  QQ+ G  +AP     FS   GNPFG
Sbjct  701  FGGDGAAFGAVNMDQQVAGRFSAPPTPQPFSSVGGNPFG  739



>ref|XP_010249829.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
 ref|XP_010249830.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
 ref|XP_010249831.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
Length=758

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 82/151 (54%), Gaps = 6/151 (4%)
 Frame = -2

Query  723  MPYNMQVQTPTLVQP----IKSSNPFDATSEPSPLQAST--FPSMASLQGALPNVGAPTG  562
            M Y MQ  T   V      +KS+NPFD   + S +QA    FPSM+SLQGALP++  P+G
Sbjct  608  MAYGMQYPTAMSVSTFPHLLKSTNPFDLNDDTSVVQAPRPMFPSMSSLQGALPHMAPPSG  667

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaaf  382
            L RT+SLG+    P  +P Q   YA+   P+ YMGQ    +M         GF  DGA F
Sbjct  668  LLRTTSLGSLGTPPRWVPPQSQSYAAATLPSTYMGQQAPNNMLPFGHQGVGGFSSDGAGF  727

Query  381  gAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
              +   Q + G ++ PA QN+F    GNPFG
Sbjct  728  STLSKDQLMTGTYSQPARQNSFPSVGGNPFG  758



>ref|XP_010249832.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nelumbo nucifera]
Length=712

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 82/151 (54%), Gaps = 6/151 (4%)
 Frame = -2

Query  723  MPYNMQ----VQTPTLVQPIKSSNPFDATSEPSPLQAST--FPSMASLQGALPNVGAPTG  562
            M Y MQ    +   T    +KS+NPFD   + S +QA    FPSM+SLQGALP++  P+G
Sbjct  562  MAYGMQYPTAMSVSTFPHLLKSTNPFDLNDDTSVVQAPRPMFPSMSSLQGALPHMAPPSG  621

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaaf  382
            L RT+SLG+    P  +P Q   YA+   P+ YMGQ    +M         GF  DGA F
Sbjct  622  LLRTTSLGSLGTPPRWVPPQSQSYAAATLPSTYMGQQAPNNMLPFGHQGVGGFSSDGAGF  681

Query  381  gAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
              +   Q + G ++ PA QN+F    GNPFG
Sbjct  682  STLSKDQLMTGTYSQPARQNSFPSVGGNPFG  712



>ref|XP_004512959.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Cicer arietinum]
Length=694

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 91/170 (54%), Gaps = 25/170 (15%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G SM YN  V  P+  QP +S+NPFD +S+P+P Q  +FPSM+S QGALP+V     LH
Sbjct  529  MGISMQYNNMVPVPSFSQPSRSTNPFDVSSKPTPDQTPSFPSMSSFQGALPSVPPSVALH  588

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPN---------------------AYMGQNLAGS  439
              SSLG P+ H +  P + P YA T  P+                     +YMGQ +A +
Sbjct  589  -PSSLGNPS-HAWTPPLRNPSYAWTPAPSSSYASALPPQAQTHASALGPGSYMGQQMATN  646

Query  438  MPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +P  PR +   FG +G+ FG  +  QQL    +     N+F P  GNPFG
Sbjct  647  IPM-PRQEVGNFGTEGSVFGLSNPEQQLTDRPSTTPTSNSF-PRGGNPFG  694



>ref|XP_006475714.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Citrus sinensis]
 ref|XP_006475715.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Citrus sinensis]
Length=753

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 85/166 (51%), Gaps = 21/166 (13%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGAL NV  P GL RTS
Sbjct  589  AMQYNTAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALQNVSHPPGLLRTS  648

Query  546  SLGTP---------TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQR  427
            SL TP         +P+P  MP Q P YA+             PP  Y+G  +  ++P  
Sbjct  649  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPS  707

Query  426  PRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                  G G +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  708  GHQGMGGLGSEGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  753



>ref|XP_010047752.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Eucalyptus grandis]
Length=725

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 85/143 (59%), Gaps = 11/143 (8%)
 Frame = -2

Query  690  LVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPTPHPYRM  511
            L Q  KS NPFD TSEPS +Q   FPSMASLQGALPNV   + L   S LGTPTP  +  
Sbjct  585  LPQQSKSVNPFD-TSEPSQVQTPMFPSMASLQGALPNVPPSSSLMHASGLGTPTPS-WIP  642

Query  510  PQ---------QPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQ  358
            PQ         QP  +AS  PP+AYMGQ + G+MP        GFG++GA++G ++T+Q 
Sbjct  643  PQGTYASAASLQPQAHASALPPSAYMGQQMHGNMPPSRYQGVGGFGMEGASYGPLNTNQF  702

Query  357  LGGLHAAPAAQNTFSPPAGNPFG  289
                  AP   N+ +P  GNPFG
Sbjct  703  GTAGFPAPHTPNSSAPVGGNPFG  725



>ref|XP_006584844.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
 gb|KHN16595.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=696

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 84/158 (53%), Gaps = 13/158 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  V  P   QP KS+NPFD ++EP+P+QASTFPSM+SLQGALP+V  P+   
Sbjct  543  MGISIQYNNVVPMPNYAQPSKSTNPFDVSNEPTPVQASTFPSMSSLQGALPSV-TPSATM  601

Query  555  RTSSLGTPTPHPYR--------MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfg  400
              S++G  + H +          P Q    A    P AYMGQ +A +MP  PR Q +G  
Sbjct  602  HPSNMGNIS-HAWNPPSSSSYVSPPQVQTLAPAMGPGAYMGQQMATNMPM-PRHQGIGSF  659

Query  399  ldgaafgAMHT-SQQLGGLHAAPAAQNTFSPPAGNPFG  289
               A         QQL G  +  A  N +    GNPFG
Sbjct  660  ATEATAFGFSNPDQQLTGRLSTAATPNPYH-AGGNPFG  696



>ref|XP_010047751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Eucalyptus grandis]
 gb|KCW79713.1| hypothetical protein EUGRSUZ_C01068 [Eucalyptus grandis]
Length=733

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 85/143 (59%), Gaps = 11/143 (8%)
 Frame = -2

Query  690  LVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPTPHPYRM  511
            L Q  KS NPFD TSEPS +Q   FPSMASLQGALPNV   + L   S LGTPTP  +  
Sbjct  593  LPQQSKSVNPFD-TSEPSQVQTPMFPSMASLQGALPNVPPSSSLMHASGLGTPTPS-WIP  650

Query  510  PQ---------QPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQ  358
            PQ         QP  +AS  PP+AYMGQ + G+MP        GFG++GA++G ++T+Q 
Sbjct  651  PQGTYASAASLQPQAHASALPPSAYMGQQMHGNMPPSRYQGVGGFGMEGASYGPLNTNQF  710

Query  357  LGGLHAAPAAQNTFSPPAGNPFG  289
                  AP   N+ +P  GNPFG
Sbjct  711  GTAGFPAPHTPNSSAPVGGNPFG  733



>ref|XP_006451097.1| hypothetical protein CICLE_v100075541mg, partial [Citrus clementina]
 gb|ESR64337.1| hypothetical protein CICLE_v100075541mg, partial [Citrus clementina]
Length=710

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 82/156 (53%), Gaps = 21/156 (13%)
 Frame = -2

Query  696  PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTP-----  532
            P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTSSL TP     
Sbjct  556  PNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTSSL-TPSPAWM  614

Query  531  ----TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQRPRDQalgfgl  397
                +P+P  MP Q P YA+             PP  Y+G  +  ++P        G G 
Sbjct  615  PPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPSGHQGMGGLGS  674

Query  396  dgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  675  EGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  710



>gb|KDO54159.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=743

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 82/156 (53%), Gaps = 21/156 (13%)
 Frame = -2

Query  696  PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTP-----  532
            P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTSSL TP     
Sbjct  589  PNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTSSL-TPSPAWM  647

Query  531  ----TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQRPRDQalgfgl  397
                +P+P  MP Q P YA+             PP  Y+G  +  ++P        G G 
Sbjct  648  PPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPSGHQGMGGLGS  707

Query  396  dgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  708  EGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  743



>ref|XP_009336872.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=731

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 96/215 (45%), Gaps = 70/215 (33%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G  MPYN  V  P+  Q  KS+NPFD  SEP P+QAS FP   SLQ  LPN    +P+G
Sbjct  521  MGFPMPYNTAVPMPSFKQSSKSANPFDVNSEP-PIQASAFP---SLQAPLPNAQPLSPSG  576

Query  561  LHRTSSLGTPT------------------------------------------PHPYRMP  508
            L RTSSLGTP+                                          P+  ++P
Sbjct  577  LMRTSSLGTPSSAWMPLQSSPYSSAVPPQAPQYASQVPPQAPQYASQMPSQALPYASQVP  636

Query  507  QQPPXYASTQ----------------------PPNAYMGQNLAGSMPQRPRDQalgfgld  394
             QPP YAS                        PP AYM Q +  S+P      A GFG  
Sbjct  637  AQPPQYASQMPSQAPPYASQVPPQPPQYASQLPPRAYMVQQVPSSVPPSGYQGAGGFGTG  696

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            GA+FG+++  QQL G  +APA  N +S   GNPFG
Sbjct  697  GASFGSLNVDQQLAGRFSAPATPNPYSSAGGNPFG  731



>ref|XP_004512854.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=686

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 84/159 (53%), Gaps = 13/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  +  P   QP KS+NPFD  +EP+P+QA TFPSM+SLQGALP+V  P+   
Sbjct  531  MGISVQYN-NMSMPGFPQPSKSTNPFDVINEPTPVQAPTFPSMSSLQGALPSV-TPSATV  588

Query  555  RTSSLGTPT-----PHPYR----MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
             TS +G  +     PH       +P Q   +AS   P AY+ Q +  +MP  PR Q +G 
Sbjct  589  HTSHMGNQSLAWNPPHSLSYAPMLPPQAQTHASAMGPRAYVEQQIPTNMPM-PRHQGIGT  647

Query  402  gldgaafgAM-HTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                 A     +  QQL G  +  A  N F    GNPFG
Sbjct  648  FGTEGAAFGFSNIDQQLTGRLSTSATLNPFPAAGGNPFG  686



>ref|XP_010915040.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Elaeis guineensis]
Length=711

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 22/165 (13%)
 Frame = -2

Query  723  MPYNMQVQTPTLV----QPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            M Y MQ  T T+     Q  KS+NPFD T+E +PL A  FP MASLQG++P + AP  L 
Sbjct  549  MGYGMQYPTGTIEPAYPQSAKSANPFDLTNELAPLNAPMFPFMASLQGSVPKMTAPRNLL  608

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR----------------P  424
            R+ S G P+P   +MP Q P Y S+  P+ YM Q +  +M Q+                 
Sbjct  609  RSYSFGAPSPR--QMPSQQPSYLSSVSPSLYMMQQVPSNMMQQVPSNMPHHLPANMVPMV  666

Query  423  RDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
                +G G +GAAFG++       G ++ P+  N+FSP  GNPFG
Sbjct  667  HQGIVGLGSEGAAFGSIGIDYHPAGRYSQPSTPNSFSPAGGNPFG  711



>ref|XP_009352480.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=707

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 92/193 (48%), Gaps = 48/193 (25%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G  MPYN  V  P   Q  KS+NPFD   EP  +QAS FP   SLQ  LPN    +P G
Sbjct  519  MGFPMPYNTAVPMPNYQQSSKSANPFDVKREPQ-IQASAFP---SLQAPLPNAQPLSPLG  574

Query  561  LHRTSSLGTPT-------PHPY-----------------------------------RMP  508
            L RTSSLG P+         PY                                   ++P
Sbjct  575  LMRTSSLGAPSSAWMPLQSSPYSSAVPPQGPQYASQVPLQAPQNASQVPPQPPQFASQVP  634

Query  507  QQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAA  328
             QPP +AS  PP AYM Q +  S+P      A GFG DGA+FG+++  QQL G  +APA 
Sbjct  635  PQPPQFASQMPPRAYMVQQVPSSIPPSGYQGAGGFGTDGASFGSLNMDQQLAGRFSAPAT  694

Query  327  QNTFSPPAGNPFG  289
             N FS   GNPFG
Sbjct  695  PNPFSSTGGNPFG  707



>gb|KDO54162.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=698

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTS
Sbjct  589  AMQYNTAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTS  648

Query  546  SLGTP---------TPHPYRMPQQPPXYASTQP  475
            SL TP         +P+P  MP Q P YA+  P
Sbjct  649  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIP  680



>ref|XP_007013232.1| NSP-interacting GTPase, putative isoform 2 [Theobroma cacao]
 gb|EOY30851.1| NSP-interacting GTPase, putative isoform 2 [Theobroma cacao]
Length=710

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G  M Y+  V      Q  KS NPFD   E  P+Q  TFPSMASLQGALPNV   +GL 
Sbjct  598  MGFIMQYSTAVPMSAFPQSSKSINPFDLGGEAPPVQNQTFPSMASLQGALPNVPPASGLV  657

Query  555  RTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMP  433
            R SSLGTP+         P+   MP Q   YAS  P  AY G  L  ++P
Sbjct  658  RASSLGTPSSAWMPAQALPYASGMPSQSLPYASAVPQRAYTGAQLPSNLP  707



>gb|KDO54161.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=711

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGALPNV  P GL RTS
Sbjct  589  AMQYNTAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALPNVSHPPGLLRTS  648

Query  546  SLGTP---------TPHPYRMPQQPPXYASTQP  475
            SL TP         +P+P  MP Q P YA+  P
Sbjct  649  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIP  680



>ref|XP_006580462.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
Length=697

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 83/159 (52%), Gaps = 14/159 (9%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+ YN  V  P+  QP KS+NPFD +SEP+P+QA  FPSM+SLQGALP+V  P+   
Sbjct  543  MGISIQYNNAVPMPSYAQPSKSTNPFDVSSEPTPVQAPMFPSMSSLQGALPSV-TPSATM  601

Query  555  RTSSLGTPTPHPYR---------MPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
              S++G  + H +           P Q    A      AYMGQ +A +MP  PR Q +G 
Sbjct  602  HPSNMGNIS-HAWNPHSSSPSYVSPPQAQTLAPAMGLGAYMGQQMATNMPM-PRHQGIGS  659

Query  402  gldgaafgAMHT-SQQLGGLHAAPAAQNTFSPPAGNPFG  289
                A         QQL G  +  A  NT+    GNPFG
Sbjct  660  FATEATAFGFSNPDQQLTGRLSTAATPNTYH-AGGNPFG  697



>ref|XP_006475716.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Citrus sinensis]
Length=743

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 81/156 (52%), Gaps = 21/156 (13%)
 Frame = -2

Query  696  PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTP-----  532
            P  V    ++NPFD  ++  P+QA TFPSMASLQGAL NV  P GL RTSSL TP     
Sbjct  589  PNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALQNVSHPPGLLRTSSL-TPSPAWM  647

Query  531  ----TPHPYRMPQQPPXYAS-----------TQPPNAYMGQNLAGSMPQRPRDQalgfgl  397
                +P+P  MP Q P YA+             PP  Y+G  +  ++P        G G 
Sbjct  648  PPQASPYPSAMPSQMPTYAAAIPSQMPTHAPAMPPRPYLGPQVPSNVPPSGHQGMGGLGS  707

Query  396  dgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            +GA+FG M+   QL G  +A A    F+   GNPFG
Sbjct  708  EGASFGFMNPDPQLAGRLSASATPQAFTSVGGNPFG  743



>ref|XP_004512957.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
Length=696

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 91/172 (53%), Gaps = 27/172 (16%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQ--ASTFPSMASLQGALPNVGAPTG  562
            +G SM YN  V  P+  QP +S+NPFD +S+P+P Q  +  FPSM+S QGALP+V     
Sbjct  529  MGISMQYNNMVPVPSFSQPSRSTNPFDVSSKPTPDQTPSMQFPSMSSFQGALPSVPPSVA  588

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPN---------------------AYMGQNLA  445
            LH  SSLG P+ H +  P + P YA T  P+                     +YMGQ +A
Sbjct  589  LH-PSSLGNPS-HAWTPPLRNPSYAWTPAPSSSYASALPPQAQTHASALGPGSYMGQQMA  646

Query  444  GSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
             ++P  PR +   FG +G+ FG  +  QQL    +     N+F P  GNPFG
Sbjct  647  TNIPM-PRQEVGNFGTEGSVFGLSNPEQQLTDRPSTTPTSNSF-PRGGNPFG  696



>ref|XP_006475717.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Citrus sinensis]
Length=711

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +M YN     P  V    ++NPFD  ++  P+QA TFPSMASLQGAL NV  P GL RTS
Sbjct  589  AMQYNTAAPMPNFVHSKSTTNPFDVNNDSHPVQAQTFPSMASLQGALQNVSHPPGLLRTS  648

Query  546  SLGTP---------TPHPYRMPQQPPXYASTQP  475
            SL TP         +P+P  MP Q P YA+  P
Sbjct  649  SL-TPSPAWMPPQASPYPSAMPSQMPTYAAAIP  680



>ref|XP_008804233.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=662

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 77/151 (51%), Gaps = 36/151 (24%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPNVGA--PTGLHRTSSLGTPTPHPYRMPQQ  502
            KS+NPFD  +EP    ASTFPS+ SLQGALPN+     + L RTSSLG+P+P    +P Q
Sbjct  526  KSTNPFDLINEPKLPHASTFPSLTSLQGALPNMAMNNTSNLLRTSSLGSPSPQ--WVPPQ  583

Query  501  PPXYASTQPPNAYMGQNLAGSMP-QRPRDQalgfgldgaafgAMHTSQQLGGL-------  346
             P Y S   P++YM Q+   +MP Q P +                  Q++GGL       
Sbjct  584  RPSYPSAVTPSSYMMQHTVNNMPHQVPNNAFPV------------VPQRIGGLGTEGAAF  631

Query  345  -------HAA-----PAAQNTFSPPAGNPFG  289
                   H+A     P   N+F+P  GNPFG
Sbjct  632  GFSGMDPHSAARSYQPGTPNSFAPVGGNPFG  662



>ref|XP_008804232.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=663

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 77/151 (51%), Gaps = 36/151 (24%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPNVGA--PTGLHRTSSLGTPTPHPYRMPQQ  502
            KS+NPFD  +EP    ASTFPS+ SLQGALPN+     + L RTSSLG+P+P    +P Q
Sbjct  527  KSTNPFDLINEPKLPHASTFPSLTSLQGALPNMAMNNTSNLLRTSSLGSPSPQ--WVPPQ  584

Query  501  PPXYASTQPPNAYMGQNLAGSMP-QRPRDQalgfgldgaafgAMHTSQQLGGL-------  346
             P Y S   P++YM Q+   +MP Q P +                  Q++GGL       
Sbjct  585  RPSYPSAVTPSSYMMQHTVNNMPHQVPNNAFPV------------VPQRIGGLGTEGAAF  632

Query  345  -------HAA-----PAAQNTFSPPAGNPFG  289
                   H+A     P   N+F+P  GNPFG
Sbjct  633  GFSGMDPHSAARSYQPGTPNSFAPVGGNPFG  663



>gb|KHG08531.1| hypothetical protein F383_13599 [Gossypium arboreum]
Length=693

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 81/159 (51%), Gaps = 12/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M Y+         Q ++S NPFD   E    Q  T  SMASLQGALPN+  P+GL 
Sbjct  537  MGFTMQYHTAAPPSAFPQSLRSVNPFDLGGEAPRAQTQTPLSMASLQGALPNLPPPSGLL  596

Query  555  RTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
            RTSSLGTP+         P+   +P Q   YAS  P   Y+G  L G++P        G 
Sbjct  597  RTSSLGTPSSAWMPPQSLPYASGIPSQSLPYASALPQRPYLGAQLPGNLPS--SSHQAGG  654

Query  402  gldgaafgAMHTSQQLGGLHAAPAAQNTFSPP-AGNPFG  289
                +++G ++T Q + G  +APA    FS    GNPFG
Sbjct  655  IGSESSYGFINTDQHVAGRFSAPATPQPFSSVGGGNPFG  693



>ref|XP_010934106.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Elaeis guineensis]
Length=664

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 75/139 (54%), Gaps = 12/139 (9%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPN--VGAPTGLHRTSSLGTPTPHPYRMPQQ  502
            +S+NPFD  +EP    ASTFPS+ SLQGALPN  +   + L RTSSLG+P+P    +P Q
Sbjct  528  QSTNPFDLMNEPKLPHASTFPSLTSLQGALPNMTMNNTSALLRTSSLGSPSPQ--WVPPQ  585

Query  501  PPXYASTQPPNAYMGQNLAGSMP-QRPRDQalgfgldgaafgAMHTSQQLGGL--HAA--  337
             P Y S  PP++YM Q    +MP Q P +            G    +    G+  H+A  
Sbjct  586  RPSYPSAVPPSSYMMQQTVNNMPHQVPNNAFPVVPQRIGGLGTEGAAFGFSGMDPHSAAR  645

Query  336  ---PAAQNTFSPPAGNPFG  289
               P   N+F+P  GNPFG
Sbjct  646  SYQPGTPNSFAPVGGNPFG  664



>ref|XP_010933331.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Elaeis guineensis]
Length=665

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 77/151 (51%), Gaps = 36/151 (24%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPN--VGAPTGLHRTSSLGTPTPHPYRMPQQ  502
            +S+NPFD  +EP    ASTFPS+ SLQGALPN  +   + L RTSSLG+P+P    +P Q
Sbjct  529  QSTNPFDLMNEPKLPHASTFPSLTSLQGALPNMTMNNTSALLRTSSLGSPSPQ--WVPPQ  586

Query  501  PPXYASTQPPNAYMGQNLAGSMP-QRPRDQalgfgldgaafgAMHTSQQLGGL-------  346
             P Y S  PP++YM Q    +MP Q P +                  Q++GGL       
Sbjct  587  RPSYPSAVPPSSYMMQQTVNNMPHQVPNNAFPV------------VPQRIGGLGTEGAAF  634

Query  345  -------HAA-----PAAQNTFSPPAGNPFG  289
                   H+A     P   N+F+P  GNPFG
Sbjct  635  GFSGMDPHSAARSYQPGTPNSFAPVGGNPFG  665



>ref|XP_010931848.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
 ref|XP_010932605.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
Length=666

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 77/151 (51%), Gaps = 36/151 (24%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPN--VGAPTGLHRTSSLGTPTPHPYRMPQQ  502
            +S+NPFD  +EP    ASTFPS+ SLQGALPN  +   + L RTSSLG+P+P    +P Q
Sbjct  530  QSTNPFDLMNEPKLPHASTFPSLTSLQGALPNMTMNNTSALLRTSSLGSPSPQ--WVPPQ  587

Query  501  PPXYASTQPPNAYMGQNLAGSMP-QRPRDQalgfgldgaafgAMHTSQQLGGL-------  346
             P Y S  PP++YM Q    +MP Q P +                  Q++GGL       
Sbjct  588  RPSYPSAVPPSSYMMQQTVNNMPHQVPNNAFPV------------VPQRIGGLGTEGAAF  635

Query  345  -------HAA-----PAAQNTFSPPAGNPFG  289
                   H+A     P   N+F+P  GNPFG
Sbjct  636  GFSGMDPHSAARSYQPGTPNSFAPVGGNPFG  666



>ref|XP_008337464.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=646

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 90/193 (47%), Gaps = 48/193 (25%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G  MPYN  V  P   Q  KS+NPFD   EP  +QAS FP   SLQ  LPN    +P+G
Sbjct  458  MGFPMPYNTAVPMPNYQQSSKSANPFDVNREPQ-IQASAFP---SLQAPLPNAQPLSPSG  513

Query  561  LHRTSSLGTPT-------PHPY-----------------------------------RMP  508
            L R S LG P+         PY                                   ++P
Sbjct  514  LMRMSXLGAPSSAWIPLQSSPYSXAVPPQAPQYASQVPLQAPQYASQVPPQPPQFASQVP  573

Query  507  QQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAA  328
             QPP +AS  PP AYM Q +  S+P      A GFG DGA+FG+++  QQL G  +A A 
Sbjct  574  PQPPQFASQMPPRAYMVQQVPSSIPPSGYQWAGGFGTDGASFGSLNMDQQLAGRFSAAAT  633

Query  327  QNTFSPPAGNPFG  289
             N FS   GNPFG
Sbjct  634  PNPFSSTGGNPFG  646



>ref|XP_007160352.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
 gb|ESW32346.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
Length=701

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 79/159 (50%), Gaps = 15/159 (9%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+PYN  V  P+  Q  KS NPFD  +EP+P+QA TFPSM+SLQGAL     P+   
Sbjct  548  MGISIPYNNAVPIPSFPQASKSKNPFDVNNEPTPVQAPTFPSMSSLQGAL---AIPSATM  604

Query  555  RTSSLGTPT--------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfg  400
             +S++G P+         +    P Q    A    P AYMGQ +A ++P  PR Q  G  
Sbjct  605  HSSNMGNPSLAWNPSSSSYVSVPPLQAQTLAPEIGPGAYMGQQMATNIPM-PRHQGFGNF  663

Query  399  ldgaafgAMHT-SQQLGGLHAAPAAQ-NTFSPPAGNPFG  289
                         Q+L G   + A   NTF    GNPFG
Sbjct  664  TTEETAFGFSNPDQKLSGSRLSTAVTPNTFQ-AGGNPFG  701



>ref|XP_007160351.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
 gb|ESW32345.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
Length=670

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 79/159 (50%), Gaps = 15/159 (9%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G S+PYN  V  P+  Q  KS NPFD  +EP+P+QA TFPSM+SLQGAL     P+   
Sbjct  517  MGISIPYNNAVPIPSFPQASKSKNPFDVNNEPTPVQAPTFPSMSSLQGAL---AIPSATM  573

Query  555  RTSSLGTPT--------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfg  400
             +S++G P+         +    P Q    A    P AYMGQ +A ++P  PR Q  G  
Sbjct  574  HSSNMGNPSLAWNPSSSSYVSVPPLQAQTLAPEIGPGAYMGQQMATNIPM-PRHQGFGNF  632

Query  399  ldgaafgAMHT-SQQLGGLHAAPAAQ-NTFSPPAGNPFG  289
                         Q+L G   + A   NTF    GNPFG
Sbjct  633  TTEETAFGFSNPDQKLSGSRLSTAVTPNTFQ-AGGNPFG  670



>ref|XP_010254182.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nelumbo nucifera]
 ref|XP_010254183.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nelumbo nucifera]
Length=747

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 79/160 (49%), Gaps = 24/160 (15%)
 Frame = -2

Query  723  MPYNMQVQT----PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            M Y MQ  T    P  + P KS+NPFD  ++ S +QA TFPSM+SLQGALPN+    GL 
Sbjct  597  MGYGMQYPTAAPMPAFLHPPKSTNPFDLNNDTSVVQAPTFPSMSSLQGALPNIAPHAGL-  655

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPN-----------AYMGQNLAGSMPQRPRDQal  409
              SSLGT     + MP Q P Y S  PP+           AY+GQ    +M   P     
Sbjct  656  -ASSLGT----SHWMPPQAPSYGSGVPPHAASYAPAMLPSAYVGQQAPKNM--LPFGHQG  708

Query  408  gfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
              G      G     QQL G ++ PA  N+FS    NPFG
Sbjct  709  VGGYGSDGAGFGSMDQQLAGTYSQPAPPNSFS-SGXNPFG  747



>ref|XP_008343980.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=663

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 59/101 (58%), Gaps = 15/101 (15%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G  MPYN  V  P+  Q  KS+NPFD  SEP P+Q+S FP   SLQ  LPN    +P+G
Sbjct  520  MGFPMPYNTAVPMPSFQQSSKSANPFDVNSEP-PIQSSAFP---SLQAPLPNAQXLSPSG  575

Query  561  LHRTSSLGTP---------TPHPYRMPQQPPXYASTQPPNA  466
            L RTSSLGTP         +P+   +P Q P YAS  PP A
Sbjct  576  LMRTSSLGTPSSAWMPLQSSPYSSAVPPQAPQYASQVPPQA  616



>ref|XP_007160353.1| hypothetical protein PHAVU_002G314500g [Phaseolus vulgaris]
 gb|ESW32347.1| hypothetical protein PHAVU_002G314500g [Phaseolus vulgaris]
Length=692

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 76/156 (49%), Gaps = 9/156 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG-----A  571
            +G S+ YN  V  P   Q  KS NPFD ++ P+P+Q  TFPSM+SLQGALP+V       
Sbjct  539  MGISIQYNNAVPMPGFPQASKSINPFDVSNNPTPVQVPTFPSMSSLQGALPSVTPSATIH  598

Query  570  PTGLHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldg  391
            P+ +  +S    P+ + +  P Q    A    P  YMGQ +A +MP  PR Q  G     
Sbjct  599  PSNMGNSSLAWNPSSYVFVPPPQAQTNAPVMRPGVYMGQQMATNMPM-PRHQGFGKFATE  657

Query  390  aafgAMHT-SQQLGGLHAAPAAQ-NTFSPPAGNPFG  289
                      QQL     + A   NTF    GNPFG
Sbjct  658  GTAFGFSNPDQQLSDSRLSTAVTPNTFQ-SRGNPFG  692



>ref|XP_009408824.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
 ref|XP_009408825.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=672

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 76/157 (48%), Gaps = 18/157 (11%)
 Frame = -2

Query  723  MPYNMQ----VQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            M YN+Q    V  PT  Q  KS NPFD TS+P    A+ +PS+  LQ AL N+ AP  L 
Sbjct  522  MGYNIQYPSGVAMPTYSQTPKSVNPFDLTSDP----AAVYPSVTPLQAALSNMTAPATLL  577

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR-PRDQalgfgldgaafg  379
            RTSS G P+PH   + Q P  YAS+  P  +M   +  +MPQ+              A  
Sbjct  578  RTSSFGAPSPHSVHLQQSP--YASSVSPGPFMMHQVPDNMPQQFAASMMPMGNQGIVAPA  635

Query  378  AMHTSQQLGGLHAAPAAQ-------NTFSPPAGNPFG  289
            +   +    G+H  PA +       N+F    GNPFG
Sbjct  636  SNGATFSTSGIHQNPAVRYSQLSTPNSFGSVGGNPFG  672



>ref|XP_010934816.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Elaeis guineensis]
Length=625

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPN--VGAPTGLHRTSSLGTPTPHPYRMPQQ  502
            +S+NPFD  +EP    ASTFPS+ SLQGALPN  +   + L RTSSLG+P+P    +P Q
Sbjct  530  QSTNPFDLMNEPKLPHASTFPSLTSLQGALPNMTMNNTSALLRTSSLGSPSPQ--WVPPQ  587

Query  501  PPXYASTQPPNAYMGQNLAGSMPQR  427
             P Y S  PP++YM Q    +MP +
Sbjct  588  RPSYPSAVPPSSYMMQQTVNNMPHQ  612



>ref|XP_004512958.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=695

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 91/172 (53%), Gaps = 28/172 (16%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQ--ASTFPSMASLQGALPNVGAPTG  562
            +G SM YN  +  P+  QP +S+NPFD +S+P+P Q  +  FPSM+S QGALP+V     
Sbjct  529  MGISMQYN-NMPVPSFSQPSRSTNPFDVSSKPTPDQTPSMQFPSMSSFQGALPSVPPSVA  587

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPN---------------------AYMGQNLA  445
            LH  SSLG P+ H +  P + P YA T  P+                     +YMGQ +A
Sbjct  588  LH-PSSLGNPS-HAWTPPLRNPSYAWTPAPSSSYASALPPQAQTHASALGPGSYMGQQMA  645

Query  444  GSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
             ++P  PR +   FG +G+ FG  +  QQL    +     N+F P  GNPFG
Sbjct  646  TNIPM-PRQEVGNFGTEGSVFGLSNPEQQLTDRPSTTPTSNSF-PRGGNPFG  695



>ref|XP_010688167.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Beta vulgaris subsp. vulgaris]
Length=712

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 52/91 (57%), Gaps = 9/91 (10%)
 Frame = -2

Query  702  QTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPTPH  523
            Q PT  QP KS+NPFDA  E S +Q + FPSM+S+  ALP+ GAP G+   S+LG  TP 
Sbjct  583  QQPTYQQPTKSANPFDA--EGSSVQPAEFPSMSSVHAALPDTGAPRGVAHASNLGAATPS  640

Query  522  PYRMPQ------QPPXYASTQPPNAYMGQNL  448
             +  PQ        P + S  P   YMGQ L
Sbjct  641  -WMTPQLSTAHPAAPSFGSGMPAGIYMGQQL  670



>gb|KJB27127.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=729

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 75/155 (48%), Gaps = 15/155 (10%)
 Frame = -2

Query  723  MPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSS  544
            M + MQ  T  L + I   NPFD   E    Q  T  SMASLQGALPN+   +GL RTSS
Sbjct  580  MGFTMQYHTAALSRSI---NPFDLGGEAPRAQTQTPLSMASLQGALPNLPPASGLLRTSS  636

Query  543  LGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldg  391
             GTP+         P+   MP Q   YAS  P   Y+G  L  ++P        G     
Sbjct  637  RGTPSSAWMPSQSLPYASGMPSQSLPYASALPQRPYLGAQLPDNLPS--SSHQAGGIGSE  694

Query  390  aafgAMHTSQQLGGLHAAPAAQNTFSPP-AGNPFG  289
            +++G + T Q + G  +APA    FS    GNPFG
Sbjct  695  SSYGFITTDQHVAGRFSAPATPQPFSSVGGGNPFG  729



>ref|XP_009402905.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
 ref|XP_009402906.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=671

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 72/156 (46%), Gaps = 14/156 (9%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            IG +M +  +V   T  Q  KS NPFD TS+P+P    TFPS+   Q  LPN+ +P  L 
Sbjct  523  IGYNMQFPTRVTAATYTQTSKSVNPFDLTSDPAP----TFPSVTPQQVPLPNMTSPLALI  578

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
            RTSS G P+P     P +   YA++  P  +M   +  +MP R           G     
Sbjct  579  RTSSFGAPSPR--WNPSEHLPYATSVSPGTFMMHQVPNNMP-RELAMMSVGNQGGLGTDN  635

Query  375  MHTSQQLGGLHAAPAAQ-------NTFSPPAGNPFG  289
              T     G+H  PA         N+ +P  GNPFG
Sbjct  636  RGTDCGTSGIHQQPAISYAQASTPNSVNPVGGNPFG  671



>ref|XP_010648572.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
 ref|XP_010648573.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
Length=719

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 78/159 (49%), Gaps = 23/159 (14%)
 Frame = -2

Query  723  MPYNMQVQTPTLVQP-----IKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            M + MQ    T+  P     +KS+NPFD   E + +QA  FPSMASLQGALP+V AP G+
Sbjct  570  MGFRMQYHPATMTTPAFPSSVKSTNPFDFNDETTQVQAPVFPSMASLQGALPSVSAPVGI  629

Query  558  HRTSSLGT-------PTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfg  400
               SSLG         +  PY +      YA  Q P+          +P R +       
Sbjct  630  SHASSLGVLPQMMQPQSQSPYALALSTSPYARPQVPHTM--------LPSRHQG-IGSIT  680

Query  399  ldgaafgAMHTSQQLGGLHAAPAA--QNTFSPPAGNPFG  289
             + A FG+ +T+Q   G ++ P+    ++FS   GNPFG
Sbjct  681  SNAAVFGSANTNQLPAGRYSVPSTPDSHSFSSLGGNPFG  719



>gb|KJB54155.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
 gb|KJB54157.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
 gb|KJB54160.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=741

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 80/150 (53%), Gaps = 9/150 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M YN  V      Q  +S NPFD   E  P+Q  TFPSM SLQGALP +  P GL 
Sbjct  600  MGFTMQYNTAVPMTAFPQSSRSVNPFDLGGEGPPVQTQTFPSMVSLQGALPIMPRP-GLV  658

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
             TS+L  P+     MP Q   YAS +PP  Y G  L  ++P  P     G   + A+FG 
Sbjct  659  HTSNLSPPSSA--WMPPQSLPYAS-RPP--YPGAQLPSNLP--PSSHQNGGIGNEASFGF  711

Query  375  MHTSQQLGG-LHAAPAAQNTFSPPAGNPFG  289
            ++T QQ+GG   AAP  Q   S   GNPFG
Sbjct  712  VNTDQQMGGRFSAAPTPQPFRSVGGGNPFG  741



>gb|KJB54158.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=742

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 80/150 (53%), Gaps = 9/150 (6%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M YN  V      Q  +S NPFD   E  P+Q  TFPSM SLQGALP +  P GL 
Sbjct  601  MGFTMQYNTAVPMTAFPQSSRSVNPFDLGGEGPPVQTQTFPSMVSLQGALPIMPRP-GLV  659

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
             TS+L  P+     MP Q   YAS +PP  Y G  L  ++P  P     G   + A+FG 
Sbjct  660  HTSNLSPPSSA--WMPPQSLPYAS-RPP--YPGAQLPSNLP--PSSHQNGGIGNEASFGF  712

Query  375  MHTSQQLGG-LHAAPAAQNTFSPPAGNPFG  289
            ++T QQ+GG   AAP  Q   S   GNPFG
Sbjct  713  VNTDQQMGGRFSAAPTPQPFRSVGGGNPFG  742



>gb|KJB27126.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=736

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 76/159 (48%), Gaps = 12/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M Y+         Q  +S NPFD   E    Q  T  SMASLQGALPN+   +GL 
Sbjct  580  MGFTMQYHTAAPLSAFPQLSRSINPFDLGGEAPRAQTQTPLSMASLQGALPNLPPASGLL  639

Query  555  RTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
            RTSS GTP+         P+   MP Q   YAS  P   Y+G  L  ++P        G 
Sbjct  640  RTSSRGTPSSAWMPSQSLPYASGMPSQSLPYASALPQRPYLGAQLPDNLPS--SSHQAGG  697

Query  402  gldgaafgAMHTSQQLGGLHAAPAAQNTFSPP-AGNPFG  289
                +++G + T Q + G  +APA    FS    GNPFG
Sbjct  698  IGSESSYGFITTDQHVAGRFSAPATPQPFSSVGGGNPFG  736



>gb|KJB27130.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=737

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 76/159 (48%), Gaps = 12/159 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M Y+         Q  +S NPFD   E    Q  T  SMASLQGALPN+   +GL 
Sbjct  581  MGFTMQYHTAAPLSAFPQLSRSINPFDLGGEAPRAQTQTPLSMASLQGALPNLPPASGLL  640

Query  555  RTSSLGTPT---------PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgf  403
            RTSS GTP+         P+   MP Q   YAS  P   Y+G  L  ++P        G 
Sbjct  641  RTSSRGTPSSAWMPSQSLPYASGMPSQSLPYASALPQRPYLGAQLPDNLPS--SSHQAGG  698

Query  402  gldgaafgAMHTSQQLGGLHAAPAAQNTFSPP-AGNPFG  289
                +++G + T Q + G  +APA    FS    GNPFG
Sbjct  699  IGSESSYGFITTDQHVAGRFSAPATPQPFSSVGGGNPFG  737



>ref|XP_009377378.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=706

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 75/161 (47%), Gaps = 17/161 (11%)
 Frame = -2

Query  723  MPYNMQVQ-----TPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            M YNMQ        P +  P K  NPFD   E S + ++ FPSM+SLQGALPN   P GL
Sbjct  547  MGYNMQYYPTATPAPVIPGPAKPKNPFDLNEEKSLVTSTHFPSMSSLQGALPNAPVP-GL  605

Query  558  HRTSSLGT----PTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSM----PQRPRDQalgf  403
               SSL T     +     MP   P +A+   P AYMG  L  ++    PQ         
Sbjct  606  MHASSLPTMSQFESNESMTMPSHSPSFANAFSPRAYMGHQLPNNVQFLRPQGVGGFGRDE  665

Query  402  gldgaafgAMHTSQQLGGLHAAPAAQ---NTFSPPAGNPFG  289
               G+      + QQ    + AP++    +TFSP  GNPFG
Sbjct  666  APFGSLTTTQQSFQQPSVRYPAPSSSSTLDTFSPMRGNPFG  706



>ref|XP_009415353.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Musa acuminata subsp. malaccensis]
Length=598

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 68/157 (43%), Gaps = 14/157 (9%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G    Y   V  P     + SSNPF    EP  + ASTFP++A LQGALPNV   + + 
Sbjct  448  MGYGTQYPTAVALPAYSHSLTSSNPFAFVDEPKLVHASTFPNLAPLQGALPNVDGHSSIL  507

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
             TSSL    P    +PQQ    A  Q P  YM Q  A  + Q P                
Sbjct  508  HTSSL----PTQQWLPQQQILSAVPQSP--YMVQQGASPIRQSPTIAMFPVTHQAIRGFN  561

Query  375  MH--------TSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            M         + Q L   +  P   +TF+PP GNPFG
Sbjct  562  MEGASFNLPGSDQHLATRNYQPQPPSTFAPPGGNPFG  598



>ref|XP_009415351.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415352.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=638

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 68/157 (43%), Gaps = 14/157 (9%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G    Y   V  P     + SSNPF    EP  + ASTFP++A LQGALPNV   + + 
Sbjct  488  MGYGTQYPTAVALPAYSHSLTSSNPFAFVDEPKLVHASTFPNLAPLQGALPNVDGHSSIL  547

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgA  376
             TSSL    P    +PQQ    A  Q P  YM Q  A  + Q P                
Sbjct  548  HTSSL----PTQQWLPQQQILSAVPQSP--YMVQQGASPIRQSPTIAMFPVTHQAIRGFN  601

Query  375  MH--------TSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            M         + Q L   +  P   +TF+PP GNPFG
Sbjct  602  MEGASFNLPGSDQHLATRNYQPQPPSTFAPPGGNPFG  638



>ref|XP_008357498.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=702

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 78/165 (47%), Gaps = 25/165 (15%)
 Frame = -2

Query  723  MPYNMQ---VQTPTLV--QPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            M YNMQ     TP L    P K  NPFD   E S + ++ FPSM+SLQGAL N   P GL
Sbjct  543  MGYNMQYYPTATPALAIPGPAKPKNPFDLNEEKSLVTSTHFPSMSSLQGALTNAPVP-GL  601

Query  558  HRTSSLGT----PTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMP-QRP-------RDQ  415
               SSL T     +     MP   P +A+   P AYMG  L  ++   RP       RD+
Sbjct  602  MHASSLPTMSQFESNESMTMPSHSPSFANAFSPRAYMGHQLPBNVQFLRPXGVGGFGRDE  661

Query  414  algfgldgaafgAMHTSQQLGGLHAAPAAQ---NTFSPPAGNPFG  289
                   G+      + QQ    + AP++    +TFSP  GNPFG
Sbjct  662  ----AAFGSLTTTQQSFQQPSVRYPAPSSSSTLDTFSPMRGNPFG  702



>ref|XP_007013726.1| ArfGap/RecO-like zinc finger domain-containing protein, putative 
[Theobroma cacao]
 gb|EOY31345.1| ArfGap/RecO-like zinc finger domain-containing protein, putative 
[Theobroma cacao]
Length=715

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 73/137 (53%), Gaps = 13/137 (9%)
 Frame = -2

Query  669  SNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS-----SLGTPTPHPY----  517
            +NPFD  SE +P QA +FPSMASL G LP+V APTGL  T+     SLG  +   Y    
Sbjct  582  ANPFDLNSETTPEQARSFPSMASLPGGLPSVQAPTGLSDTTSFDAHSLGMTSHSSYLASL  641

Query  516  RMPQQPPXYASTQPPNAYMGQN-LAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHA  340
              P+ P   A   P NAYMG     G  P RP+    G G D  + G++ T+Q+  G H+
Sbjct  642  MTPESPCTLA--MPSNAYMGDQPHIGVPPSRPQ-VIGGLGSDEFSRGSVCTTQEPTGGHS  698

Query  339  APAAQNTFSPPAGNPFG  289
            A  +  +F     NPFG
Sbjct  699  ASNSPLSFPKMGANPFG  715



>ref|XP_006844366.1| hypothetical protein AMTR_s00142p00058560 [Amborella trichopoda]
 gb|ERN06041.1| hypothetical protein AMTR_s00142p00058560 [Amborella trichopoda]
Length=782

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = -2

Query  684  QPIKSSNPFDATSEPSPLQAS-TFPSMASLQGALPNVGAPTGLHRTSSLGTPTPHPYRMP  508
            Q  KS+NPFD   +P+P+Q+S TFPS+  LQ +LPN+ A   L R+SS G P    +R P
Sbjct  654  QSSKSTNPFDL--DPAPVQSSPTFPSLVPLQASLPNLIAGQALMRSSSFGAPV-QQWRAP  710

Query  507  QQPPXYASTQPPNAYMGQNLAGSMP  433
            Q    Y    PP AYM Q ++ S+P
Sbjct  711  QV-STYPMAMPPGAYMAQQMSTSVP  734



>ref|XP_006476221.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Citrus sinensis]
Length=828

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 71/137 (52%), Gaps = 10/137 (7%)
 Frame = -2

Query  696  PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGA-PTGLHRTSSLGTPTPHP  520
            P    P KS+NPFD +S+ +PLQA  FPSM  LQGALPNV +  T      SLG      
Sbjct  701  PAYSNPAKSTNPFDISSDTTPLQAPPFPSMVPLQGALPNVNSMSTSNAAAHSLGL-----  755

Query  519  YRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHA  340
              M QQ P YA +    A MGQ    +M          FG   A +G+ +T QQ  G + 
Sbjct  756  --MTQQLPSYAFSSDM-ASMGQQTHTNMMPNRLQGIDSFGGSRAVYGSSNTPQQPTGGYP  812

Query  339  APAAQNTFSPPAGNPFG  289
             PAA N+FS   GNPFG
Sbjct  813  VPAATNSFS-MGGNPFG  828



>ref|XP_010527129.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Tarenaya hassleriana]
Length=606

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -2

Query  675  KSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRT-----SSLGTPTPH--PY  517
            K +NPFDA ++ +P++A  FPSMA   GALP+V AP G   T      SLG+  PH   Y
Sbjct  476  KPTNPFDADNDTTPVRAPQFPSMAFTHGALPHVSAPRGFLNTQSPVAGSLGSMAPHSPSY  535

Query  516  RMPQQP--PXYASTQPPNAYMGQNLAGSMPQRPR  421
                 P  P +AST  P AYM Q    +M   PR
Sbjct  536  AAVLSPRSPSFASTLSPGAYMAQQTHMNMLLSPR  569



>ref|XP_008808979.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=664

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 54/105 (51%), Gaps = 4/105 (4%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAP--TG  562
            +G  M Y      PT     KS NPFD  +E     ASTFPS+ SLQG LPN+     + 
Sbjct  508  MGYGMQYPNAAALPTNPYSSKSMNPFDLVNERKLPHASTFPSLTSLQGELPNLNMNNMSA  567

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR  427
            L  TSSLG+P+P    +P Q P Y S   P++ M       MPQ+
Sbjct  568  LLHTSSLGSPSPQ--WVPPQQPSYPSAVTPSSSMMHQGVNHMPQQ  610



>ref|XP_008808989.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=662

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 54/105 (51%), Gaps = 4/105 (4%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAP--TG  562
            +G  M Y      PT     KS NPFD  +E     ASTFPS+ SLQG LPN+     + 
Sbjct  506  MGYGMQYPNAAALPTNPYSSKSMNPFDLVNERKLPHASTFPSLTSLQGELPNLNMNNMSA  565

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR  427
            L  TSSLG+P+P    +P Q P Y S   P++ M       MPQ+
Sbjct  566  LLHTSSLGSPSPQ--WVPPQQPSYPSAVTPSSSMMHQGVNHMPQQ  608



>ref|XP_008808997.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Phoenix dactylifera]
Length=599

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 54/105 (51%), Gaps = 4/105 (4%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAP--TG  562
            +G  M Y      PT     KS NPFD  +E     ASTFPS+ SLQG LPN+     + 
Sbjct  443  MGYGMQYPNAAALPTNPYSSKSMNPFDLVNERKLPHASTFPSLTSLQGELPNLNMNNMSA  502

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR  427
            L  TSSLG+P+P    +P Q P Y S   P++ M       MPQ+
Sbjct  503  LLHTSSLGSPSPQ--WVPPQQPSYPSAVTPSSSMMHQGVNHMPQQ  545



>ref|XP_008809007.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Phoenix dactylifera]
Length=597

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 54/105 (51%), Gaps = 4/105 (4%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAP--TG  562
            +G  M Y      PT     KS NPFD  +E     ASTFPS+ SLQG LPN+     + 
Sbjct  441  MGYGMQYPNAAALPTNPYSSKSMNPFDLVNERKLPHASTFPSLTSLQGELPNLNMNNMSA  500

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQR  427
            L  TSSLG+P+P    +P Q P Y S   P++ M       MPQ+
Sbjct  501  LLHTSSLGSPSPQ--WVPPQQPSYPSAVTPSSSMMHQGVNHMPQQ  543



>ref|XP_008458192.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Cucumis melo]
 ref|XP_008458200.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Cucumis melo]
Length=712

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 73/157 (46%), Gaps = 18/157 (11%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +MPYN  +  P+  Q   S+NPFD +SE        FPSMA LQ ALP+      L    
Sbjct  563  AMPYNSAMPMPSFPQSSTSTNPFDLSSE-----QPQFPSMAPLQNALPSGQPAPNLIHNP  617

Query  546  SLGTPT----PH--PYRMPQQPPX--YASTQPPNA-YMGQNLAGSMPQRPRDQalgfgld  394
              G PT    PH  P  +PQ PP   Y  T P    YMGQ +A ++  +P          
Sbjct  618  GYGNPTSTWMPHQPPSNIPQLPPQGPYQPTLPSRPPYMGQQVASNV--QPYRHPGLGNYG  675

Query  393  gaafgAMHT--SQQLGGLHAAPAAQNTFSPPAGNPFG  289
                 +++T  SQQ  G   APA  N FS   GNPFG
Sbjct  676  NEGATSVYTDMSQQTAGRFTAPATPNPFSSTGGNPFG  712



>ref|XP_009762670.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nicotiana sylvestris]
 ref|XP_009762678.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nicotiana sylvestris]
Length=637

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 65/136 (48%), Gaps = 6/136 (4%)
 Frame = -2

Query  696  PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPTPHPY  517
            P L    KS NPFD   +   +QA  FPSM S+Q ALPN+ AP  +          P+ +
Sbjct  508  PALPNSAKSRNPFD-IGQDGQVQAPEFPSMLSVQAALPNLSAPISVQ-----PQQLPYAF  561

Query  516  RMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGGLHAA  337
             +P Q   Y  T    AY GQ +  +M    +      G D AAF +++  QQ  G +  
Sbjct  562  ALPPQTANYGMTFSGEAYAGQQIPNNMALAAQQGNTSIGKDDAAFASLNPLQQSNGTNPT  621

Query  336  PAAQNTFSPPAGNPFG  289
             A  N+FS   GNPFG
Sbjct  622  HATSNSFSSGGGNPFG  637



>ref|XP_009592977.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana tomentosiformis]
Length=631

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 73/153 (48%), Gaps = 18/153 (12%)
 Frame = -2

Query  720  PYNMQ-----VQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            P+ MQ     +  P L    KS NPFD   +   +QA  FPSM ++Q ALP V AP  + 
Sbjct  488  PHGMQYHPAAMSIPALPNSAKSRNPFDIGQDGPQVQAPEFPSMLTMQAALPTVSAPISVQ  547

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQ----NLAGSMPQRPRDQalgfgldga  388
                     P+ + +P Q   Y  T     Y+GQ    N+A ++PQ         G D A
Sbjct  548  -----PQQLPYAFALPPQTANYGMTISGGPYVGQQIPNNMALTVPQ----GNTSIGKDEA  598

Query  387  afgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            AF +++  QQ  G +  PA  N+FS   GNPFG
Sbjct  599  AFASLNPLQQSNGTYPTPATSNSFSSGGGNPFG  631



>ref|XP_008394008.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Malus domestica]
 ref|XP_008361060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Malus domestica]
Length=686

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 44/87 (51%), Gaps = 10/87 (11%)
 Frame = -2

Query  681  PIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGT---------PT  529
            P K  NPFD   E S + ++ FPSM+SLQGAL NV  P GL   SSL T         PT
Sbjct  593  PAKPKNPFDLDEEKSLVTSTHFPSMSSLQGALHNVPVP-GLMHASSLPTMSQFKIPQSPT  651

Query  528  PHPYRMPQQPPXYASTQPPNAYMGQNL  448
                 MP   P + +   P AY+G  L
Sbjct  652  NESMMMPSHSPSFTNAFSPRAYLGHQL  678



>ref|XP_008352294.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=609

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 6/71 (8%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVG--APTG  562
            +G  MPYN  V  P   Q  KS+NPFD   EP  +QAS FP   SLQ  LPN    +P+G
Sbjct  519  MGFPMPYNTAVPMPNYQQSSKSANPFDVNREPQ-IQASAFP---SLQAPLPNAQPLSPSG  574

Query  561  LHRTSSLGTPT  529
            L R S+LG P+
Sbjct  575  LMRMSNLGAPS  585



>ref|XP_003620547.1| Arf-GAP domain and FG repeats-containing protein [Medicago truncatula]
 gb|AES76765.1| ARF GTPase activator [Medicago truncatula]
Length=658

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNV  577
            G  M YN      +  QP +S+NPFD +S+ +P QA +FPSM+SL GALPNV
Sbjct  473  GIPMQYNNVAPVSSFSQPSRSTNPFDVSSKQTPDQAPSFPSMSSLHGALPNV  524



>ref|XP_009139640.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Brassica rapa]
Length=596

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 75/158 (47%), Gaps = 34/158 (22%)
 Frame = -2

Query  723  MPYNMQVQTPTLV--QPIKSSNPFDATSEP-SPLQAST-FPSMASLQGALPNVGA--PTG  562
            MPY MQ    T+   QP +S NPFD +SEP S  Q  T FPSMASLQGALP  G     G
Sbjct  460  MPYGMQQYNNTMNVPQPARSMNPFDLSSEPPSVTQTETMFPSMASLQGALPPSGMMPSQG  519

Query  561  LHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMP---QRPRDQalgfgldg  391
            LH          + + MP Q   + S  PP  Y+   + GSMP    RP           
Sbjct  520  LH----------NHFSMPPQVSGHPSAMPPR-YISPQIPGSMPPSSLRPIGNMGAP----  564

Query  390  aafgAMHTSQQLGGLHAAPAAQNTFSPPA----GNPFG  289
                  + +QQ   +  +P A N+ +PP+    GNPFG
Sbjct  565  ------YDTQQTYQIFGSPFAANSSNPPSFPLGGNPFG  596



>ref|XP_003620495.1| Arf-GAP domain and FG repeats-containing protein [Medicago truncatula]
Length=698

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  732  GXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNV  577
            G  M YN      +  QP +S+NPFD +S+ +P QA +FPSM+SL GALPNV
Sbjct  506  GIPMQYNNVAPVSSFSQPSRSTNPFDVSSKQTPDQAPSFPSMSSLHGALPNV  557



>ref|XP_004139426.1| PREDICTED: uncharacterized protein LOC101209764 [Cucumis sativus]
Length=630

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 68/159 (43%), Gaps = 22/159 (14%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +MPYN  +  P+  Q   S+NPFD +SE        FPSM  LQ  LP+      L    
Sbjct  481  AMPYNPAMPVPSFPQSSTSTNPFDLSSE-----QPQFPSMGPLQNTLPSGQPAPNLIHNP  535

Query  546  SLGTPTPHPYRMPQQPPXYASTQPPNA-----------YMGQNLAGSMPQRPRDQalgfg  400
              G PT     MP QPP   S  PP             YMGQ +A ++  +P        
Sbjct  536  GYGNPTS--TWMPHQPPSNLSQLPPQGPYQPTMPSRPPYMGQQIASNV--QPYRHPGLGN  591

Query  399  ldgaafgAMHT--SQQLGGLHAAPAAQNTFSPPAGNPFG  289
                    ++T  SQQ  G  +AP+  N FS   GNPFG
Sbjct  592  YGNEGATGVYTDMSQQTAGRFSAPSTPNPFSSTGGNPFG  630



>ref|XP_009592974.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009592976.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
Length=634

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 74/156 (47%), Gaps = 21/156 (13%)
 Frame = -2

Query  720  PYNMQ-----VQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            P+ MQ     +  P L    KS NPFD   +   +QA  FPSM ++Q ALP V AP  + 
Sbjct  488  PHGMQYHPAAMSIPALPNSAKSRNPFDIGQDGPQVQAPEFPSMLTMQAALPTVSAPISVQ  547

Query  555  RTSSLGTPTPHPYRMPQQPPXYAST---QPPNAYMGQ----NLAGSMPQRPRDQalgfgl  397
                     P+ + +P Q   Y  T    P   Y+GQ    N+A ++PQ         G 
Sbjct  548  -----PQQLPYAFALPPQTANYGMTISGVPAGPYVGQQIPNNMALTVPQ----GNTSIGK  598

Query  396  dgaafgAMHTSQQLGGLHAAPAAQNTFSPPAGNPFG  289
            D AAF +++  QQ  G +  PA  N+FS   GNPFG
Sbjct  599  DEAAFASLNPLQQSNGTYPTPATSNSFSSGGGNPFG  634



>ref|XP_004167945.1| PREDICTED: uncharacterized LOC101209764 [Cucumis sativus]
 gb|KGN60631.1| hypothetical protein Csa_2G005280 [Cucumis sativus]
Length=711

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 68/159 (43%), Gaps = 22/159 (14%)
 Frame = -2

Query  726  SMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTS  547
            +MPYN  +  P+  Q   S+NPFD +SE        FPSM  LQ  LP+      L    
Sbjct  562  AMPYNPAMPVPSFPQSSTSTNPFDLSSE-----QPQFPSMGPLQNTLPSGQPAPNLIHNP  616

Query  546  SLGTPTPHPYRMPQQPPXYASTQPPNA-----------YMGQNLAGSMPQRPRDQalgfg  400
              G PT     MP QPP   S  PP             YMGQ +A ++  +P        
Sbjct  617  GYGNPTS--TWMPHQPPSNLSQLPPQGPYQPTMPSRPPYMGQQIASNV--QPYRHPGLGN  672

Query  399  ldgaafgAMHT--SQQLGGLHAAPAAQNTFSPPAGNPFG  289
                    ++T  SQQ  G  +AP+  N FS   GNPFG
Sbjct  673  YGNEGATGVYTDMSQQTAGRFSAPSTPNPFSSTGGNPFG  711



>ref|XP_008219908.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=730

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 66/143 (46%), Gaps = 23/143 (16%)
 Frame = -2

Query  666  NPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPTPHPYRMPQQP----  499
            NPFD   E S   ++ FPSMA LQGAL +V A  GL   SSL T      + PQ P    
Sbjct  594  NPFDLNEEKSVEHSTHFPSMAPLQGALHHVSATPGLMHASSLPTHFSQ-LKAPQSPTNES  652

Query  498  ------PXYASTQPPNAYMGQNLAGSMPQRP-------RDQalgfgldgaafgAMHTSQQ  358
                  P +A+   P+AYMGQ L  +   RP       RD+A+   L           QQ
Sbjct  653  MTPSHSPSFATAFSPSAYMGQQLHNNY-MRPQGVGGFGRDEAVFGALSTTQQPF----QQ  707

Query  357  LGGLHAAPAAQNTFSPPAGNPFG  289
                + AP+   TFS   GNPFG
Sbjct  708  PSIRYPAPSNSETFSSMRGNPFG  730



>ref|XP_006450579.1| hypothetical protein CICLE_v10010498mg, partial [Citrus clementina]
 gb|ESR63819.1| hypothetical protein CICLE_v10010498mg, partial [Citrus clementina]
Length=776

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = -2

Query  696  PTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGA-PTGLHRTSSLGTPTPHP  520
            P    P KS+NPFD +S+ +PLQA  FPSM  LQGALPNV +  T      SLG      
Sbjct  698  PAYSNPAKSTNPFDISSDTTPLQAPPFPSMVPLQGALPNVNSMSTSNAAAHSLGL-----  752

Query  519  YRMPQQPPXYA  487
              M QQ P YA
Sbjct  753  --MTQQLPSYA  761



>ref|XP_009139639.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Brassica rapa]
Length=598

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 78/156 (50%), Gaps = 28/156 (18%)
 Frame = -2

Query  723  MPYNMQVQTPTLV-----QPIKSSNPFDATSE-PSPLQAST-FPSMASLQGALPNVGAPT  565
            MPY MQ    T+      QP +S NPFD +SE PS  Q  T FPSMASLQGALP    P+
Sbjct  460  MPYGMQQYNNTMPYQNVPQPARSMNPFDLSSEPPSVTQTETMFPSMASLQGALP----PS  515

Query  564  GLHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaa  385
            G+  +  L     + + MP Q   + S  PP  Y+   + GSMP   R            
Sbjct  516  GMMPSQGLH----NHFSMPPQVSGHPSAMPPR-YISPQIPGSMPPSLR--------PIGN  562

Query  384  fgAMHTSQQLGGLHAAPAAQNTFSPPA----GNPFG  289
             GA + +QQ   +  +P A N+ +PP+    GNPFG
Sbjct  563  MGAPYDTQQTYQIFGSPFAANSSNPPSFPLGGNPFG  598



>ref|XP_009139636.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
 ref|XP_009139637.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
 ref|XP_009139638.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
Length=599

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 77/159 (48%), Gaps = 33/159 (21%)
 Frame = -2

Query  723  MPYNMQVQTPTLV-----QPIKSSNPFDATSE-PSPLQAST-FPSMASLQGALPNVGAPT  565
            MPY MQ    T+      QP +S NPFD +SE PS  Q  T FPSMASLQGALP    P+
Sbjct  460  MPYGMQQYNNTMPYQNVPQPARSMNPFDLSSEPPSVTQTETMFPSMASLQGALP----PS  515

Query  564  GLHRTSSLGTPTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMP---QRPRDQalgfgld  394
            G+  +  L     + + MP Q   + S  PP  Y+   + GSMP    RP          
Sbjct  516  GMMPSQGLH----NHFSMPPQVSGHPSAMPPR-YISPQIPGSMPPSSLRPIGNMGAP---  567

Query  393  gaafgAMHTSQQLGGLHAAPAAQNTFSPPA----GNPFG  289
                   + +QQ   +  +P A N+ +PP+    GNPFG
Sbjct  568  -------YDTQQTYQIFGSPFAANSSNPPSFPLGGNPFG  599



>ref|XP_010670775.1| PREDICTED: uncharacterized protein LOC104887747 [Beta vulgaris 
subsp. vulgaris]
Length=830

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = -2

Query  708  QVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGTPT  529
            QVQ P +    KS+NPFD     +    + F S  +LQ  LPNV +P G+   +S G   
Sbjct  697  QVQIPLIPNVAKSTNPFDTNDNIAQPDVNMFASKGTLQSGLPNVFSPAGMSHITSSG---  753

Query  528  PHPYRMPQQPPXYASTQPPNAYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTSQQLGG  349
            PH    P   P  +   P  AYM Q L  +M         GFG    +   +H++Q +  
Sbjct  754  PH---FPGFAPTVSPACPAGAYMSQQLFQNMSPNSIQGTSGFGGGVGSTLPLHSNQHIPY  810

Query  348  LHAAPAAQNTFSPPAGNPF  292
             + AP  Q++F    GNPF
Sbjct  811  RYPAPTDQSSFPKGGGNPF  829



>ref|XP_007227166.1| hypothetical protein PRUPE_ppa024658mg [Prunus persica]
 gb|EMJ28365.1| hypothetical protein PRUPE_ppa024658mg [Prunus persica]
Length=741

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 66/148 (45%), Gaps = 23/148 (16%)
 Frame = -2

Query  666  NPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLHRTSSLGT-----PTP----HPYR  514
            NPFD   E S + ++ FPSMA LQGAL +V AP GL   SSL T      TP    +   
Sbjct  595  NPFDLNEEKSVVHSTHFPSMAPLQGALHHVSAPPGLMHASSLPTHFSQLKTPQSPTNESM  654

Query  513  MPQQPPXYASTQPPN----------AYMGQNLAGSMPQRPRDQalgfgldgaafgAMHTS  364
            MP   P +A+   P+          AYMGQ L  +   RP+        +        T 
Sbjct  655  MPSHSPSFATAFSPSKFISLSSVSCAYMGQQLQNNYV-RPQGVGGFGRGEAVFGALSTTQ  713

Query  363  ---QQLGGLHAAPAAQNTFSPPAGNPFG  289
               QQ    + AP+   TFS   GNPFG
Sbjct  714  QPFQQPSIRYPAPSNSETFSSKRGNPFG  741



>ref|XP_008378298.1| PREDICTED: uncharacterized protein LOC103441401 [Malus domestica]
Length=150

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 50/106 (47%), Gaps = 10/106 (9%)
 Frame = -2

Query  723  MPYNMQ---VQTPTLV--QPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGL  559
            M YNMQ     TP L    P K  NPFD   E S + ++ FPSM+SLQGAL N   P GL
Sbjct  36   MGYNMQYYPTATPALAIPGPAKPKNPFDLNEEKSLVTSTHFPSMSSLQGALTNAPVP-GL  94

Query  558  HRTSSLGT----PTPHPYRMPQQPPXYASTQPPNAYMGQNLAGSMP  433
               SSL T     +     MP   P +A+   P     Q   G MP
Sbjct  95   MHASSLPTMSQFESNESMTMPSHSPSFANAFSPRHLPYQKKEGYMP  140



>gb|KJB27131.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=715

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = -2

Query  735  IGXSMPYNMQVQTPTLVQPIKSSNPFDATSEPSPLQASTFPSMASLQGALPNVGAPTGLH  556
            +G +M Y+         Q  +S NPFD   E    Q  T  SMASLQGALPN+   +GL 
Sbjct  580  MGFTMQYHTAAPLSAFPQLSRSINPFDLGGEAPRAQTQTPLSMASLQGALPNLPPASGLL  639

Query  555  RTSSLGTPTPHPYRMPQQPPXYASTQP  475
            RTSS GTP+     MP Q   YAS  P
Sbjct  640  RTSSRGTPSSA--WMPSQSLPYASGMP  664



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500