BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016C08

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004253113.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    317   2e-100   Solanum lycopersicum
ref|XP_006342524.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    315   5e-100   Solanum tuberosum [potatoes]
ref|XP_009607500.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    315   7e-100   Nicotiana tomentosiformis
ref|XP_009759651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    314   2e-99    Nicotiana sylvestris
gb|AHZ08764.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    308   4e-97    Nicotiana tabacum [American tobacco]
ref|XP_011074054.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    308   5e-97    Sesamum indicum [beniseed]
ref|XP_009608062.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    308   6e-97    Nicotiana tomentosiformis
gb|EYU36601.1|  hypothetical protein MIMGU_mgv1a003013mg                305   4e-96    Erythranthe guttata [common monkey flower]
ref|XP_010684564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    305   4e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002276269.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    305   4e-96    Vitis vinifera
ref|XP_010266302.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    304   9e-96    Nelumbo nucifera [Indian lotus]
emb|CBI40779.3|  unnamed protein product                                305   1e-95    Vitis vinifera
ref|XP_007210294.1|  hypothetical protein PRUPE_ppa002571mg             305   2e-95    
gb|KHG12069.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    303   2e-95    Gossypium arboreum [tree cotton]
ref|XP_010266301.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    304   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010094500.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    304   2e-95    
ref|XP_008237897.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    305   2e-95    
gb|ABK92538.1|  unknown                                                 295   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010063177.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    303   3e-95    Eucalyptus grandis [rose gum]
ref|XP_009777872.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    303   3e-95    Nicotiana sylvestris
gb|KJB29714.1|  hypothetical protein B456_005G115600                    302   9e-95    Gossypium raimondii
gb|KJB29713.1|  hypothetical protein B456_005G115600                    302   1e-94    Gossypium raimondii
gb|KDO85265.1|  hypothetical protein CISIN_1g006964mg                   301   1e-94    Citrus sinensis [apfelsine]
gb|ADZ96380.2|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    301   1e-94    Eriobotrya japonica [loquat]
ref|XP_004238468.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    301   1e-94    Solanum lycopersicum
ref|XP_006435472.1|  hypothetical protein CICLE_v10000595mg             301   3e-94    Citrus clementina [clementine]
ref|XP_007018640.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    301   3e-94    
ref|XP_006435473.1|  hypothetical protein CICLE_v10000595mg             300   4e-94    
ref|XP_008346428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    300   5e-94    
sp|P21342.2|PFPA_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    300   5e-94    Solanum tuberosum [potatoes]
ref|XP_008373335.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    300   5e-94    
gb|KDP36731.1|  hypothetical protein JCGZ_08022                         299   8e-94    Jatropha curcas
ref|XP_009372651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    299   8e-94    Pyrus x bretschneideri [bai li]
ref|XP_008796200.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    299   1e-93    Phoenix dactylifera
gb|AAC67587.1|  pyrophosphate-dependent phosphofructokinase alpha...    298   2e-93    Citrus x paradisi [grapefruit]
gb|EYU41211.1|  hypothetical protein MIMGU_mgv1a003012mg                298   2e-93    Erythranthe guttata [common monkey flower]
ref|XP_010527650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    298   2e-93    Tarenaya hassleriana [spider flower]
ref|XP_010932134.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    297   6e-93    Elaeis guineensis
ref|XP_010061240.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    297   6e-93    Eucalyptus grandis [rose gum]
ref|XP_011041142.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   7e-93    Populus euphratica
gb|AIE47261.1|  pyrophosphate-dependent phosphofructokinase             296   1e-92    Hevea brasiliensis [jebe]
gb|KHN01580.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    288   1e-92    Glycine soja [wild soybean]
ref|XP_008453023.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    296   3e-92    Cucumis melo [Oriental melon]
ref|XP_002307823.1|  pyrophosphate-dependent phosphofructokinase ...    295   5e-92    Populus trichocarpa [western balsam poplar]
ref|XP_004145564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    294   8e-92    
ref|XP_010927304.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    294   1e-91    Elaeis guineensis
ref|XP_008802157.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   2e-91    Phoenix dactylifera
gb|ACF80583.1|  unknown                                                 284   2e-91    Zea mays [maize]
ref|XP_011041141.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   2e-91    Populus euphratica
gb|ABK93964.1|  unknown                                                 293   3e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011099944.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    293   4e-91    Sesamum indicum [beniseed]
dbj|BAD95089.1|  putative pyrophosphate-dependent phosphofructoki...    283   4e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510738.1|  phosphofructokinase, putative                      292   6e-91    Ricinus communis
ref|XP_010270592.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    292   6e-91    Nelumbo nucifera [Indian lotus]
sp|Q41140.1|PFPA_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    292   6e-91    Ricinus communis
gb|AES59948.2|  pyrophosphate-fructose-6-phosphate 1-phosphotrans...    291   1e-90    Medicago truncatula
ref|XP_003589697.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    290   1e-90    
emb|CDY33660.1|  BnaC08g19600D                                          290   2e-90    Brassica napus [oilseed rape]
ref|XP_009410339.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007153134.1|  hypothetical protein PHAVU_003G009600g             290   3e-90    Phaseolus vulgaris [French bean]
emb|CDX96611.1|  BnaA08g21540D                                          290   3e-90    
ref|XP_009391869.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    289   6e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275358.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    289   8e-90    Solanum tuberosum [potatoes]
ref|XP_010537247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    289   9e-90    Tarenaya hassleriana [spider flower]
ref|XP_006849934.1|  hypothetical protein AMTR_s00022p00121950          289   1e-89    Amborella trichopoda
ref|XP_003555655.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   1e-89    Glycine max [soybeans]
ref|XP_006390180.1|  hypothetical protein EUTSA_v10018291mg             288   1e-89    Eutrema salsugineum [saltwater cress]
emb|CDY67022.1|  BnaC05g50320D                                          288   2e-89    Brassica napus [oilseed rape]
ref|XP_004953678.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   2e-89    Setaria italica
ref|XP_009149574.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    288   2e-89    Brassica rapa
gb|KFK42073.1|  hypothetical protein AALP_AA2G207700                    288   3e-89    Arabis alpina [alpine rockcress]
ref|XP_004965353.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    287   4e-89    Setaria italica
ref|XP_002452651.1|  hypothetical protein SORBIDRAFT_04g030000          287   5e-89    Sorghum bicolor [broomcorn]
ref|XP_008775478.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   7e-89    Phoenix dactylifera
ref|XP_003529192.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   9e-89    Glycine max [soybeans]
ref|NP_001146841.1|  LOC100280449                                       286   1e-88    Zea mays [maize]
ref|XP_004300090.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   1e-88    Fragaria vesca subsp. vesca
ref|XP_006659170.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    286   1e-88    Oryza brachyantha
dbj|BAJ92904.1|  predicted protein                                      286   1e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004498196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   2e-88    
ref|XP_009417287.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   2e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004498195.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   2e-88    Cicer arietinum [garbanzo]
gb|KFK35354.1|  hypothetical protein AALP_AA5G273800                    285   3e-88    Arabis alpina [alpine rockcress]
dbj|BAD33246.1|  putative Pyrophosphate--fructose 6-phosphate 1-p...    285   3e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539758.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   3e-88    Tarenaya hassleriana [spider flower]
gb|EEC80509.1|  hypothetical protein OsI_22776                          285   3e-88    Oryza sativa Indica Group [Indian rice]
ref|NP_001057528.1|  Os06g0326400                                       285   3e-88    
emb|CDX87587.1|  BnaA07g32860D                                          285   4e-88    
ref|XP_010235882.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   4e-88    
ref|XP_003570229.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   4e-88    Brachypodium distachyon [annual false brome]
ref|XP_010913868.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    285   5e-88    Elaeis guineensis
ref|XP_009106323.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    284   5e-88    Brassica rapa
emb|CDX88295.1|  BnaC06g37390D                                          284   7e-88    
ref|NP_001131947.1|  uncharacterized protein LOC100193340               284   8e-88    Zea mays [maize]
gb|EPS71673.1|  hypothetical protein M569_03082                         283   8e-88    Genlisea aurea
gb|AFW73096.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    284   8e-88    
ref|NP_001047918.1|  Os02g0714200                                       283   1e-87    
ref|XP_010498548.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    283   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010459789.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    283   1e-87    Camelina sativa [gold-of-pleasure]
ref|NP_173519.1|  pyrophosphate--fructose 6-phosphate 1-phosphotr...    283   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889091.1|  hypothetical protein ARALYDRAFT_476813             283   1e-87    
ref|NP_177781.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    283   2e-87    Arabidopsis thaliana [mouse-ear cress]
gb|EMS55626.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    278   2e-87    Triticum urartu
dbj|BAF01310.1|  putative pyrophosphate-dependent phosphofructoki...    283   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306984.1|  hypothetical protein CARUB_v10008559mg             283   2e-87    
ref|XP_006302013.1|  hypothetical protein CARUB_v10019988mg             283   2e-87    Capsella rubella
ref|XP_002300615.1|  pyrophosphate-dependent phosphofructokinase ...    283   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006386123.1|  hypothetical protein POPTR_0002s00490g             283   2e-87    
ref|XP_011034779.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    283   2e-87    Populus euphratica
ref|XP_009414937.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    283   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006416345.1|  hypothetical protein EUTSA_v10007087mg             282   3e-87    Eutrema salsugineum [saltwater cress]
ref|XP_006648988.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    282   4e-87    Oryza brachyantha
ref|XP_010428720.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    281   6e-87    Camelina sativa [gold-of-pleasure]
ref|XP_008659507.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    280   2e-86    
ref|XP_010471809.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    280   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010416575.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    280   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_002893141.1|  hypothetical protein ARALYDRAFT_472333             278   1e-85    
gb|EMT11806.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    276   1e-85    
gb|ACN26363.1|  unknown                                                 276   6e-85    Zea mays [maize]
gb|EMS68198.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    274   2e-84    Triticum urartu
ref|XP_003563894.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    274   6e-84    
gb|AEZ53899.1|  pyrophosphate-dependent fructose-6-phosphate 1-ph...    271   4e-83    Zea mays [maize]
gb|ABR17718.1|  unknown                                                 257   2e-80    Picea sitchensis
ref|XP_010275338.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    258   2e-78    Nelumbo nucifera [Indian lotus]
dbj|BAK04583.1|  predicted protein                                      256   3e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006837413.1|  hypothetical protein AMTR_s00111p00148440          255   5e-77    
gb|KJB29716.1|  hypothetical protein B456_005G115600                    253   3e-76    Gossypium raimondii
dbj|BAJ85819.1|  predicted protein                                      248   3e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB29715.1|  hypothetical protein B456_005G115600                    248   3e-74    Gossypium raimondii
dbj|BAJ94879.1|  predicted protein                                      248   7e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010935015.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    244   2e-73    Elaeis guineensis
ref|XP_002970269.1|  hypothetical protein SELMODRAFT_171380             246   3e-73    
ref|XP_002978426.1|  hypothetical protein SELMODRAFT_108705             245   3e-73    
gb|KCW68155.1|  hypothetical protein EUGRSUZ_F018231                    241   5e-72    Eucalyptus grandis [rose gum]
gb|KCW68156.1|  hypothetical protein EUGRSUZ_F018231                    241   8e-72    Eucalyptus grandis [rose gum]
ref|XP_009385723.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    242   8e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573791.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    239   1e-70    Brachypodium distachyon [annual false brome]
ref|XP_002444175.1|  hypothetical protein SORBIDRAFT_07g012720          234   2e-69    
gb|ACL53065.1|  unknown                                                 235   2e-69    Zea mays [maize]
ref|NP_001130747.1|  uncharacterized protein LOC100191851               235   3e-69    Zea mays [maize]
gb|AGN30570.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    234   5e-69    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD33224.1|  putative pyrophosphate-dependent phosphofructoki...    234   6e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973257.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    234   7e-69    Setaria italica
ref|XP_006660512.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    233   2e-68    Oryza brachyantha
ref|NP_001061602.1|  Os08g0345700                                       229   7e-67    
ref|XP_006660071.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    229   7e-67    
tpg|DAA60935.1|  TPA: hypothetical protein ZEAMMB73_638083              226   8e-67    
ref|XP_004956506.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    226   1e-66    
ref|XP_008652527.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    226   1e-65    Zea mays [maize]
ref|XP_004956505.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    225   2e-65    Setaria italica
ref|XP_002459996.1|  hypothetical protein SORBIDRAFT_02g020400          225   2e-65    Sorghum bicolor [broomcorn]
ref|XP_001773752.1|  predicted protein                                  215   1e-61    
ref|XP_009110202.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    200   3e-61    Brassica rapa
ref|XP_001755711.1|  predicted protein                                  210   8e-60    
gb|ABL10095.1|  pyrophosphate-fructose-6-phosphate1-phosphotransf...    189   7e-55    Saccharum spontaneum [fodder cane]
gb|EMS49340.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    198   8e-55    Triticum urartu
ref|XP_010935016.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    193   5e-54    
gb|EEC84297.1|  hypothetical protein OsI_30782                          158   4e-41    Oryza sativa Indica Group [Indian rice]
gb|EEE69397.1|  hypothetical protein OsJ_28754                          158   5e-41    Oryza sativa Japonica Group [Japonica rice]
gb|KCW70371.1|  hypothetical protein EUGRSUZ_F03611                     147   3e-37    Eucalyptus grandis [rose gum]
gb|KCW68157.1|  hypothetical protein EUGRSUZ_F018231                    144   4e-36    Eucalyptus grandis [rose gum]
ref|XP_010477351.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    132   3e-32    Camelina sativa [gold-of-pleasure]
ref|XP_008776682.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    116   3e-29    
ref|XP_008788669.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    121   5e-29    
ref|XP_008788668.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    122   7e-29    
ref|XP_008788667.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    121   1e-28    
gb|ABR16683.1|  unknown                                                 120   7e-28    Picea sitchensis
gb|AEK84249.1|  putative phosphofructokinase                            107   8e-26    Pinus pinaster [cluster pine]
emb|CBJ31829.1|  RecName: Full=Pyrophosphate--fructose 6-phosphat...    114   5e-25    Ectocarpus siliculosus
gb|AFW82614.1|  hypothetical protein ZEAMMB73_948861                    109   2e-24    
ref|XP_005854316.1|  pyrophosphate--fructose-6-phosphate 1-phosph...  97.4    3e-19    Nannochloropsis gaditana CCMP526
gb|AFW80250.1|  hypothetical protein ZEAMMB73_927911                  94.7    4e-19    
gb|EWM27417.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...  97.4    4e-19    Nannochloropsis gaditana
ref|XP_006435470.1|  hypothetical protein CICLE_v10000595mg           94.7    1e-18    
ref|XP_006435471.1|  hypothetical protein CICLE_v10000595mg           94.4    1e-18    
emb|CBK25474.2|  unnamed protein product                              92.4    8e-18    Blastocystis hominis
emb|CBK21183.2|  unnamed protein product                              89.7    7e-17    Blastocystis hominis
gb|ETW36820.1|  hypothetical protein PFTANZ_02488                     84.7    4e-16    Plasmodium falciparum Tanzania (2000708)
gb|AAL74381.1|AF359113_1  putative phosphofructokinase                78.6    2e-15    Pinus sylvestris [Scotch pine]
emb|CBI38094.3|  unnamed protein product                              79.3    2e-15    Vitis vinifera
gb|AIF75956.1|  putative phosphofructokinase                          78.6    2e-15    Pinus massoniana [Chinese red pine]
ref|XP_676653.1|  6-phosphofructokinase                               85.1    4e-15    
emb|CDS46264.1|  6-phosphofructokinase, putative                      85.1    4e-15    
emb|CDO64214.1|  6-phosphofructokinase                                85.1    4e-15    Plasmodium reichenowi
gb|ETW18551.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...  85.1    4e-15    Plasmodium falciparum Vietnam Oak-Knoll (FVO)
ref|XP_001352026.1|  6-phosphofructokinase, putative                  85.1    4e-15    Plasmodium falciparum 3D7
gb|EUR72395.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...  85.1    4e-15    Plasmodium falciparum 7G8
ref|XP_008625163.1|  6-phosphofructokinase                            84.3    7e-15    Plasmodium vinckei vinckei
ref|XP_004221675.1|  6-phosphofructokinase                            84.3    8e-15    Plasmodium cynomolgi strain B
gb|EUD71993.1|  6-phosphofructokinase                                 84.0    9e-15    Plasmodium vinckei petteri
emb|CDR12619.1|  6-phosphofructokinase, putative                      84.0    9e-15    
emb|CBK23161.2|  unnamed protein product                              80.1    1e-14    Blastocystis hominis
ref|XP_006429693.1|  hypothetical protein CICLE_v10013226mg           77.0    1e-14    
ref|XP_008815414.1|  6-phosphofructokinase                            83.2    2e-14    Plasmodium inui San Antonio 1
ref|XP_002141875.1|  phosphofructokinase family protein               83.2    2e-14    Cryptosporidium muris RN66
ref|XP_729053.1|  pyrophosphate-dependent phosphofructokinase         82.8    3e-14    Plasmodium yoelii
ref|XP_666221.1|  hypothetical protein                                82.4    3e-14    Cryptosporidium hominis TU502
ref|XP_626418.1|  pyrophosphate-dependent phosphofructokinase         82.4    3e-14    Cryptosporidium parvum Iowa II
ref|XP_005707151.1|  pyrophosphate--fructose-6-phosphate 1-phosph...  81.6    4e-14    Galdieria sulphuraria
ref|XP_001614690.1|  6-phosphofructokinase                            82.4    4e-14    Plasmodium vivax
ref|WP_022458553.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.9    6e-14    
ref|WP_021663363.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    7e-14    Porphyromonas gingivalis
ref|XP_002258426.1|  6-phosphofructokinase                            81.3    8e-14    Plasmodium knowlesi strain H
emb|CAN81375.1|  hypothetical protein VITISV_020870                   79.3    8e-14    Vitis vinifera
gb|AFW75214.1|  hypothetical protein ZEAMMB73_287145                  77.8    9e-14    
ref|XP_001610135.1|  6-phosphofructokinase                            80.9    9e-14    Babesia bovis T2Bo
ref|WP_022023024.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    1e-13    
emb|CBK24494.2|  unnamed protein product                              79.3    2e-13    Blastocystis hominis
ref|XP_009114586.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  79.3    2e-13    Brassica rapa
ref|WP_016777789.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    2e-13    Anaerophaga thermohalophila
ref|WP_012457385.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    3e-13    Porphyromonas gingivalis
ref|WP_023847292.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    3e-13    Porphyromonas gingivalis
ref|WP_004583807.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    3e-13    Porphyromonas gingivalis
ref|WP_013815410.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    3e-13    Porphyromonas gingivalis
ref|WP_021662033.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    3e-13    Porphyromonas gingivalis
ref|WP_021677112.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    3e-13    Porphyromonas gingivalis
ref|XP_006396719.1|  hypothetical protein EUTSA_v10028543mg           78.6    3e-13    Eutrema salsugineum [saltwater cress]
ref|WP_015423578.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    8e-13    uncultured Termite group 1 bacterium
emb|CDX94541.1|  BnaC09g22950D                                        77.4    8e-13    
ref|WP_021903099.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  75.1    8e-13    
ref|WP_024752338.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    9e-13    Treponema phagedenis
ref|WP_002701079.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    9e-13    Treponema phagedenis
gb|KHG04503.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  72.0    1e-12    Gossypium arboreum [tree cotton]
ref|WP_039420029.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  77.0    1e-12    Porphyromonas
ref|WP_039426896.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    1e-12    Porphyromonas gulae
ref|WP_040466458.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    1e-12    
ref|XP_011004484.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  72.4    1e-12    Populus euphratica
gb|EEC89467.1|  putative diphosphate--fructose-6-phosphate 1-phos...  73.9    1e-12    Holdemanella biformis DSM 3989
ref|XP_010422248.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  76.6    2e-12    Camelina sativa [gold-of-pleasure]
ref|NP_192313.3|  pyrophosphate--fructose-6-phosphate 1-phosphotr...  76.3    2e-12    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  76.3    2e-12    Camelina sativa [gold-of-pleasure]
ref|XP_010496159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  76.3    2e-12    Camelina sativa [gold-of-pleasure]
ref|WP_040451094.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    2e-12    Holdemania massiliensis
ref|XP_010422247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  76.3    2e-12    Camelina sativa [gold-of-pleasure]
gb|EFB41793.1|  hypothetical protein pah_c022o077                     76.3    2e-12    Parachlamydia acanthamoebae str. Hall's coccus
gb|AAC28214.1|  contains similarity to phosphofructokinases (Pfam...  76.3    2e-12    Arabidopsis thaliana [mouse-ear cress]
ref|WP_013924907.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    2e-12    Parachlamydia acanthamoebae
ref|XP_005652109.1|  pyrophosphate-fructose 6-phosphate 1-phospho...  75.9    2e-12    Coccomyxa subellipsoidea C-169
ref|XP_004340159.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  75.9    2e-12    Acanthamoeba castellanii str. Neff
ref|WP_026475518.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    2e-12    Alkaliflexus imshenetskii
ref|WP_022419924.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.7    3e-12    
ref|WP_022351630.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.5    3e-12    
ref|XP_004829199.1|  phosphofructokinase, putative                    76.3    3e-12    Theileria equi strain WA
ref|WP_039419596.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.5    3e-12    Porphyromonas gulae
ref|XP_004507660.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  75.5    3e-12    Cicer arietinum [garbanzo]
ref|WP_021851985.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.5    3e-12    
gb|KJB63313.1|  hypothetical protein B456_010G169500                  70.1    4e-12    Gossypium raimondii
ref|WP_026292223.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    4e-12    Porphyromonas gulae
ref|XP_765143.1|  6-phosphofructokinase                               75.9    4e-12    Theileria parva strain Muguga
ref|NP_001175755.1|  Os09g0298100                                     69.3    4e-12    
gb|KJB63314.1|  hypothetical protein B456_010G169500                  70.1    5e-12    Gossypium raimondii
ref|WP_018028382.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    5e-12    Porphyromonas somerae
gb|KJB63316.1|  hypothetical protein B456_010G169500                  70.5    5e-12    Gossypium raimondii
ref|XP_010529462.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  74.7    5e-12    Tarenaya hassleriana [spider flower]
gb|KJB63315.1|  hypothetical protein B456_010G169500                  70.5    6e-12    Gossypium raimondii
gb|KJB63311.1|  hypothetical protein B456_010G169500                  70.9    6e-12    Gossypium raimondii
ref|WP_004798470.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.7    6e-12    Absiella dolichum
ref|XP_011040650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  70.5    6e-12    Populus euphratica
ref|WP_010422435.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    7e-12    Anaerophaga thermohalophila
ref|XP_002872678.1|  hypothetical protein ARALYDRAFT_490075           74.3    8e-12    
ref|XP_007147679.1|  hypothetical protein PHAVU_006G145300g           74.3    8e-12    Phaseolus vulgaris [French bean]
ref|XP_006287381.1|  hypothetical protein CARUB_v10000587mg           74.3    8e-12    Capsella rubella
ref|WP_010527175.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    8e-12    Thermophagus xiamenensis
gb|KJB63312.1|  hypothetical protein B456_010G169500                  70.9    8e-12    Gossypium raimondii
gb|AEB10154.1|  phosphofructokinase                                   74.3    8e-12    Desulfobacca acetoxidans DSM 11109
ref|WP_041284548.1|  hypothetical protein                             74.3    8e-12    
ref|WP_016318768.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  74.3    8e-12    Firmicutes bacterium M10-2
ref|WP_013182152.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    9e-12    Waddlia chondrophila
ref|WP_026625143.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    9e-12    Dysgonomonas capnocytophagoides
ref|XP_010546562.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  74.3    9e-12    Tarenaya hassleriana [spider flower]
ref|WP_013607434.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    1e-11    Sphaerochaeta globosa
gb|EEF66458.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  73.9    1e-11    Holdemania filiformis DSM 12042
ref|WP_039865086.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    1e-11    Holdemania filiformis
ref|XP_011402204.1|  ATP-dependent zinc metalloprotease FTSH 5, m...  74.3    1e-11    Auxenochlorella protothecoides
ref|WP_022442023.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    1e-11    
emb|CDP09326.1|  unnamed protein product                              68.9    1e-11    Coffea canephora [robusta coffee]
ref|XP_952138.1|  pyrophosphate--fructose 6-phosphate 1-phosphotr...  74.3    1e-11    Theileria annulata
emb|CCB91524.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...  73.9    1e-11    Waddlia chondrophila 2032/99
ref|XP_006417279.1|  hypothetical protein EUTSA_v10007237mg           73.9    1e-11    Eutrema salsugineum [saltwater cress]
gb|KFK30957.1|  hypothetical protein AALP_AA6G049400                  73.6    1e-11    
ref|WP_044168564.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    1e-11    
gb|KHN35710.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  73.2    1e-11    
emb|CDX98086.1|  BnaA06g08370D                                        73.6    1e-11    
ref|WP_005467407.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    1e-11    
ref|XP_009148623.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  73.6    1e-11    
emb|CDY30046.1|  BnaC05g09740D                                        73.6    1e-11    
ref|XP_002308836.1|  hypothetical protein POPTR_0006s02540g           69.3    2e-11    
gb|EKD26922.1|  hypothetical protein ACD_79C00968G0001                73.2    2e-11    
ref|XP_008676288.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.6    2e-11    
ref|WP_013758252.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
gb|KFK43462.1|  hypothetical protein AALP_AA1G128500                  73.2    2e-11    
ref|XP_002892669.1|  hypothetical protein ARALYDRAFT_888516           73.2    2e-11    
gb|EYU27733.1|  hypothetical protein MIMGU_mgv1a003746mg              73.2    2e-11    
ref|XP_004486196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  73.2    2e-11    
ref|XP_737575.1|  hypothetical protein                                70.1    2e-11    
ref|WP_034931503.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
ref|XP_003594152.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...  73.2    2e-11    
ref|WP_042244225.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
ref|XP_006447632.1|  hypothetical protein CICLE_v10014750mg           72.8    2e-11    
ref|WP_032125634.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
ref|WP_039384525.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
emb|CDR94086.1|  6-phosphofructokinase, putative                      73.6    2e-11    
ref|WP_022491531.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
ref|WP_006626998.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    2e-11    
ref|WP_037547210.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    2e-11    
ref|WP_020954416.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    2e-11    
gb|KIC73621.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  72.8    2e-11    
ref|WP_007277807.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    2e-11    
ref|XP_010686769.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  72.8    2e-11    
ref|WP_025081450.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    2e-11    
gb|KDO54287.1|  hypothetical protein CISIN_1g008310mg                 72.8    2e-11    
ref|WP_014455241.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    3e-11    
ref|XP_006447633.1|  hypothetical protein CICLE_v10014750mg           72.8    3e-11    
ref|XP_002518416.1|  phosphofructokinase, putative                    72.8    3e-11    
ref|WP_022789788.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    3e-11    
ref|XP_006307130.1|  hypothetical protein CARUB_v10008719mg           72.8    3e-11    
sp|Q41141.1|PFPB_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...  72.4    3e-11    
emb|CCB88843.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...  72.4    3e-11    
ref|XP_007153992.1|  hypothetical protein PHAVU_003G082000g           72.4    3e-11    
ref|WP_044233209.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    3e-11    
ref|XP_010493617.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  72.4    3e-11    
ref|WP_010663795.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    3e-11    
ref|NP_172664.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...  72.4    3e-11    
ref|WP_044190829.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    3e-11    
ref|WP_041419260.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    3e-11    
gb|AAC17614.1|  Similar to pyrophosphate-dependent phosphofuctoki...  72.4    4e-11    
ref|WP_022356272.1|  pyrophosphate-dependent phosphofructokinase      72.4    4e-11    
ref|WP_014271836.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    4e-11    
ref|XP_005536036.1|  pyrophosphate--fructose-6-phosphate 1-phosph...  72.4    4e-11    
ref|WP_015535442.1|  pyrophosphate-dependent phosphofructokinase      72.0    4e-11    
ref|WP_021864006.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    4e-11    
gb|AAO72618.1|  fructose-6-phosphate 1-phosphotransferase             72.0    4e-11    
ref|WP_021667347.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    4e-11    
ref|WP_018358521.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    4e-11    
ref|XP_010458622.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  72.0    5e-11    
ref|WP_022486127.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    5e-11    
ref|WP_028973346.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    5e-11    
ref|WP_013968126.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    6e-11    
ref|WP_022458961.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    6e-11    
ref|WP_027435625.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    6e-11    
ref|WP_028512698.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    6e-11    
ref|XP_010476153.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  71.6    6e-11    
ref|XP_005850148.1|  hypothetical protein CHLNCDRAFT_34452            71.6    7e-11    
gb|AIE47260.1|  pyrophosphate-dependent phosphofructokinase           71.6    7e-11    
tpg|DAA49241.1|  TPA: hypothetical protein ZEAMMB73_624432            71.2    7e-11    
ref|WP_013739509.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    7e-11    
ref|WP_022245848.1|  hypothetical protein                             71.2    7e-11    
ref|XP_007024888.1|  Uncharacterized protein isoform 2                67.8    7e-11    
ref|WP_027456161.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    7e-11    
ref|WP_034449876.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    8e-11    
ref|WP_027449768.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    8e-11    
ref|XP_003529650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  71.2    8e-11    
ref|XP_006383850.1|  hypothetical protein POPTR_0004s00550g           71.2    8e-11    
ref|WP_008771783.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    9e-11    
ref|WP_021687206.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    9e-11    
ref|XP_011047000.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  70.9    1e-10    
ref|XP_007024887.1|  Uncharacterized protein isoform 1                67.8    1e-10    
ref|WP_019540988.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    1e-10    
ref|WP_028077990.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    1e-10    
ref|XP_002317176.2|  hypothetical protein POPTR_0011s01970g           70.5    1e-10    
ref|WP_021854968.1|  phosphofructokinase                              70.9    1e-10    
ref|WP_025444081.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    1e-10    
ref|WP_021947313.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    1e-10    
ref|WP_009433397.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    1e-10    
ref|WP_019893247.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    1e-10    
ref|WP_028507542.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    1e-10    
ref|XP_010534010.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.7    1e-10    
ref|WP_025863645.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    1e-10    
emb|CDY34604.1|  BnaC08g41630D                                        70.5    1e-10    
ref|WP_029901822.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    1e-10    
ref|XP_009802263.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.9    2e-10    
ref|XP_011002542.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...  70.5    2e-10    
ref|WP_007658653.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  70.5    2e-10    
ref|XP_002317160.2|  pyrophosphate--fructose-6-phosphate 1-phosph...  70.5    2e-10    
ref|WP_022499090.1|  pyrophosphate-dependent phosphofructokinase      70.5    2e-10    
ref|WP_008979581.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    2e-10    
ref|WP_008689162.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_028727537.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|XP_008887818.1|  6-phosphofructokinase                            70.9    2e-10    
ref|WP_021916966.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_022322946.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_005647732.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_005640886.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_025071710.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_044115791.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_008121761.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|WP_007133749.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    2e-10    
ref|XP_003881945.1|  Phosphofructokinase, related                     70.5    2e-10    
gb|KDU78280.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  70.1    2e-10    
ref|WP_024994586.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    2e-10    
gb|KFG48842.1|  6-phosphofructokinase                                 68.6    2e-10    
ref|XP_009391472.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.7    2e-10    
ref|XP_011129558.1|  6-phosphofructokinase                            70.5    2e-10    
ref|WP_005855923.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  69.7    2e-10    
ref|XP_009391474.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.7    2e-10    
gb|ABB54889.1|  phosphofructokinase                                   64.3    3e-10    
ref|WP_036650726.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    3e-10    
ref|WP_036613717.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    3e-10    
ref|XP_007215516.1|  hypothetical protein PRUPE_ppa003662mg           69.7    3e-10    
ref|XP_010316565.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...  69.7    3e-10    
ref|WP_044533005.1|  diphosphate--fructose-6-phosphate 1-phosphot...  66.2    3e-10    
ref|XP_003534704.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.7    3e-10    
gb|ABB54936.1|  phosphofructokinase                                   63.9    3e-10    
ref|WP_036851359.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    3e-10    
gb|ABB54890.1|  phosphofructokinase                                   63.9    3e-10    
gb|KHN40852.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  69.3    3e-10    
sp|P21343.3|PFPB_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...  69.7    3e-10    
ref|XP_009690609.1|  pyrophosphate--fructose 6-phosphate 1-phosph...  70.1    3e-10    
ref|WP_025004727.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    3e-10    
ref|WP_021914328.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    3e-10    
ref|WP_025079520.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    3e-10    
dbj|BAJ85690.1|  predicted protein                                    69.3    3e-10    
ref|WP_010261490.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    3e-10    
ref|WP_036927708.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    3e-10    
ref|XP_004965128.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.3    3e-10    
gb|KDP20694.1|  hypothetical protein JCGZ_21165                       69.3    4e-10    
ref|WP_022781712.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    4e-10    
ref|WP_027110374.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    4e-10    
ref|XP_003610482.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...  69.3    4e-10    
ref|WP_024996790.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    4e-10    
ref|XP_008230005.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.3    4e-10    
ref|XP_004955203.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  69.3    4e-10    
ref|WP_022482432.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.3    4e-10    
dbj|BAK07581.1|  predicted protein                                    69.3    4e-10    
gb|KFG59815.1|  6-phosphofructokinase                                 68.6    4e-10    
ref|WP_011771984.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.9    4e-10    
ref|WP_021945700.1|  diphosphate/fructose-6-phosphate1-phosphotra...  68.9    5e-10    
ref|XP_010057883.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.9    5e-10    
ref|WP_006434131.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.9    5e-10    
ref|WP_006843040.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.9    5e-10    
ref|WP_008158638.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.9    5e-10    
ref|WP_022092267.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.9    5e-10    
ref|XP_006357957.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.9    5e-10    
ref|XP_002986153.1|  hypothetical protein SELMODRAFT_234963           68.9    5e-10    
ref|WP_008145850.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  68.9    5e-10    
ref|WP_022158214.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.9    5e-10    
ref|XP_008805585.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.9    5e-10    
gb|KFH14889.1|  6-phosphofructokinase                                 68.6    5e-10    
ref|WP_022406493.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  68.6    6e-10    
ref|XP_004243522.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.6    6e-10    
gb|KCW75230.1|  hypothetical protein EUGRSUZ_E03983                   68.6    6e-10    
ref|XP_011086210.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.2    6e-10    
gb|KFH04414.1|  6-phosphofructokinase                                 68.6    7e-10    
gb|KFG38658.1|  6-phosphofructokinase                                 68.6    7e-10    
ref|WP_006798230.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    7e-10    
ref|WP_018109477.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    8e-10    
ref|XP_009610530.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...  68.2    8e-10    
ref|WP_004359492.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    8e-10    
gb|KFG39287.1|  6-phosphofructokinase                                 68.6    8e-10    
ref|WP_013265533.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    8e-10    
ref|WP_016525088.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  68.2    8e-10    
ref|WP_022302274.1|  phosphofructokinase                              65.1    8e-10    
ref|WP_036865072.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    8e-10    
ref|WP_036925131.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    8e-10    
ref|WP_021896515.1|  pyrophosphate-dependent phosphofructokinase      68.2    8e-10    
ref|XP_002984967.1|  hypothetical protein SELMODRAFT_234662           68.2    8e-10    
gb|EYU33871.1|  hypothetical protein MIMGU_mgv1a003790mg              68.2    8e-10    
gb|EFW24308.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  68.2    9e-10    
ref|WP_040627712.1|  diphosphate--fructose-6-phosphate 1-phosphot...  68.2    9e-10    
ref|WP_009036818.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  66.2    9e-10    
ref|XP_002366708.1|  phosphofructokinase, putative                    68.6    9e-10    
ref|WP_044654480.1|  diphosphate--fructose-6-phosphate 1-phosphot...  65.1    9e-10    
gb|KJB69226.1|  hypothetical protein B456_011G011600                  68.2    9e-10    
gb|EPR60584.1|  6-phosphofructokinase                                 68.6    9e-10    
gb|AIN94596.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  68.2    9e-10    
gb|KHG11353.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  67.8    9e-10    
ref|XP_010035533.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.2    9e-10    
ref|XP_006656840.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  68.2    9e-10    
ref|WP_016562813.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  68.2    9e-10    
ref|WP_009010591.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|WP_021887993.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|WP_042372185.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
gb|KJF43929.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  67.8    1e-09    
gb|KJB69223.1|  hypothetical protein B456_011G011600                  67.8    1e-09    
ref|WP_036853877.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|WP_036848678.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
gb|KIC72145.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  67.8    1e-09    
ref|WP_025406169.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|WP_044045408.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
emb|CAF23604.1|  putative 6-phosphofructokinase 1                     67.8    1e-09    
ref|WP_042282134.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
gb|EMS58307.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  67.8    1e-09    
ref|WP_022437430.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  67.8    1e-09    
ref|WP_039358021.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|WP_025407711.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|WP_027470899.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.8    1e-09    
ref|XP_009408423.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  67.8    1e-09    
ref|WP_021964522.1|  phosphofructokinase                              67.8    1e-09    
emb|CDJ66502.1|  phosphofructokinase, putative                        68.2    1e-09    
emb|CDJ37570.1|  phosphofructokinase, putative                        68.2    1e-09    
ref|WP_036851063.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.4    1e-09    
ref|XP_010533788.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  67.4    1e-09    
ref|WP_035455514.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.4    1e-09    
ref|WP_036787718.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.4    1e-09    
ref|WP_006947947.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.4    1e-09    
ref|XP_007026197.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...  67.4    1e-09    
gb|EPT34726.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  67.4    1e-09    
ref|WP_005780146.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  67.4    1e-09    
ref|WP_044160982.1|  diphosphate--fructose-6-phosphate 1-phosphot...  67.4    1e-09    
ref|XP_008384258.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  65.5    1e-09    



>ref|XP_004253113.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum lycopersicum]
Length=617

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+ATL NLKNPVNKWRCGAAPITAMM+V+RYG GP   S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATLTNLKNPVNKWRCGAAPITAMMSVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  LGKPAVHPATVDLKGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM---SNGGNTNF  213
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAM+SVT ILSVM   S+  NT F
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMSSVTEILSVMASPSSNANTPF  617



>ref|XP_006342524.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum tuberosum]
Length=617

 Score =   315 bits (808),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+ATL NLKNPVNKWRCGAAPITAMM+V+RYG GP   S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATLTNLKNPVNKWRCGAAPITAMMSVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  LGKPAVHPATVDLKGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM---SNGGNTNF  213
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAM+SVT ILSVM   S+  NT F
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMSSVTEILSVMTSPSSNVNTPF  617



>ref|XP_009607500.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Nicotiana tomentosiformis]
Length=616

 Score =   315 bits (807),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRC AAPITAMMTV+RYG GP   +
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCAAAPITAMMTVKRYGRGPGNAA  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAVHPATVDLKGKAYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTN  216
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+ILSVMS+    N
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSVMSSPSTVN  613



>ref|XP_009759651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRC AAPITAMMTV+RYG GP   +
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCAAAPITAMMTVKRYGRGPGNAA  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAVHPATVDLKGKAYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTN  216
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+ILS+MS+    N
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSLMSSPSTVN  613



>gb|AHZ08764.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Nicotiana 
tabacum]
Length=616

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRC AAPITAMMTV+RYG GP   +
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCAAAPITAMMTVKRYGRGPGNAA  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELL QNATKFLL DVYRNPGPLQFDG GADAKA+ LCVEDQD
Sbjct  502  IGKPAVHPATVDLKGKAYELLSQNATKFLLDDVYRNPGPLQFDGSGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTN  216
            YMGRIK+LQEYL KVRTIVKPGCSQDVLKAALSAMASVT+ILS+MS+    N
Sbjct  562  YMGRIKKLQEYLGKVRTIVKPGCSQDVLKAALSAMASVTDILSLMSSPSTVN  613



>ref|XP_011074054.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Sesamum indicum]
Length=616

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 2/175 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NLKNPVNKW+CGAAPITAMMTV+RYG G  A +
Sbjct  442  CDYAYVLGHIAYHILAAGLNGYMATVTNLKNPVNKWKCGAAPITAMMTVKRYGRGHGAST  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPALHPATVDL+GKAYELLRQNA KFL+ DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  LGKPALHPATVDLKGKAYELLRQNAIKFLMNDVYRNPGPLQFDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS--NGGNTNF  213
            YMGRIK+LQE+LDKVR+IVKPGCSQDVLKAALSAMASVT+ILSVMS  + G T F
Sbjct  562  YMGRIKKLQEHLDKVRSIVKPGCSQDVLKAALSAMASVTDILSVMSSPSTGGTPF  616



>ref|XP_009608062.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Nicotiana 
tomentosiformis]
Length=616

 Score =   308 bits (788),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YHILAAGLNGY+AT+ NLKNPVNKW CGAAPI+AMMTV+RYG GP   S
Sbjct  442  CDYAYVLGHVSYHILAAGLNGYMATVTNLKNPVNKWHCGAAPISAMMTVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G PALHPATVDL+GK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGVPALHPATVDLKGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTN  216
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+ILSV+S+  + N
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSVISSPSSVN  613



>gb|EYU36601.1| hypothetical protein MIMGU_mgv1a003013mg [Erythranthe guttata]
Length=616

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHI+AAGLNGY+ATL NLKNPVNKWRC AAPITAMMTV+RYG G  A  
Sbjct  442  CDYAYVLGHIGYHIIAAGLNGYMATLTNLKNPVNKWRCAAAPITAMMTVKRYGRGHGASI  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPALHPATVDL+GK+YELLRQN+TKFL+ DVYRNPGPLQ+DGPGADAKA+ LCVEDQD
Sbjct  502  LGKPALHPATVDLKGKSYELLRQNSTKFLMDDVYRNPGPLQYDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS--NGGNTNF  213
            YMGRIK LQE+LDKVR+IVKPGCSQDVLKAALSAMASVT ILSVMS  +GG+T F
Sbjct  562  YMGRIKLLQEHLDKVRSIVKPGCSQDVLKAALSAMASVTEILSVMSAASGGSTPF  616



>ref|XP_010684564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYH+LAAGLNGY+ATL NLKNP+NKW+CGAAP+TAMMTV+RY  GP + +
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATLTNLKNPLNKWKCGAAPLTAMMTVKRYSRGPGSLA  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVD++GKAYELLRQNA +FL+ D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDVKGKAYELLRQNAARFLVEDIYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNT  219
            YMGRIK+LQEYLDKVR IVKPGC QDVLKAALSAMASVT IL+VMS+  N+
Sbjct  562  YMGRIKQLQEYLDKVRAIVKPGCPQDVLKAALSAMASVTEILTVMSSSSNS  612



>ref|XP_002276269.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Vitis vinifera]
Length=616

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYH+LAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+RY  GP   S
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRYSRGPGTSS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP  +DL+GKAYELL QNATKFLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAVHPYALDLKGKAYELLSQNATKFLLDDLYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQ+YLDKVRTIVKPGCSQDVLKAALSAMASVT ILSVM++
Sbjct  562  YMGRIKKLQQYLDKVRTIVKPGCSQDVLKAALSAMASVTEILSVMTS  608



>ref|XP_010266302.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Nelumbo nucifera]
Length=597

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+ HGP A S
Sbjct  422  CDYAYVLGHVCYHILAAGLNGYMATITNLKNPVNKWRCGAAPITAMMTVKRWSHGPRAAS  481

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+GKAY LLRQNA KFL+ DVYRNPGPLQF+GPGADAK + LCVEDQD
Sbjct  482  IGKPAVHPAPVDLKGKAYGLLRQNAAKFLMDDVYRNPGPLQFEGPGADAKTVTLCVEDQD  541

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIK+LQEYLDKVR+IVKPGCSQ+VLKAALSAMASVT +LSV+S
Sbjct  542  YMGRIKKLQEYLDKVRSIVKPGCSQEVLKAALSAMASVTEVLSVIS  587



>emb|CBI40779.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYH+LAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+RY  GP   S
Sbjct  479  CDYAYVLGHICYHVLAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRYSRGPGTSS  538

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP  +DL+GKAYELL QNATKFLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  539  IGKPAVHPYALDLKGKAYELLSQNATKFLLDDLYRNPGPLQFDGPGADAKAVTLCVEDQD  598

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQ+YLDKVRTIVKPGCSQDVLKAALSAMASVT ILSVM++
Sbjct  599  YMGRIKKLQQYLDKVRTIVKPGCSQDVLKAALSAMASVTEILSVMTS  645



>ref|XP_007210294.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
 gb|EMJ11493.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
Length=657

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NL+NPVNKWRCGAAPITAMMTVRR+   P   S
Sbjct  482  CDYAYVLGHIGYHILAAGLNGYMATVTNLRNPVNKWRCGAAPITAMMTVRRWSQNPGTAS  541

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNATKFLL D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  542  IGKPAIHPATVDLKGKAYELLRQNATKFLLDDIYRNPGPLQFDGPGADSKAVTLCVEDQD  601

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDK+RTIVKPGCSQ+VLKAALS MASVT +LSVMS+
Sbjct  602  YMGRIKKLQEYLDKIRTIVKPGCSQEVLKAALSVMASVTEVLSVMSS  648



>gb|KHG12069.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Gossypium arboreum]
Length=616

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAP+ AMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKNPVNKWRCGAAPLPAMMTVKRWSQNPNAAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYE+LRQNAT+FLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYEMLRQNATRFLLDDIYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT +LSVM
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTEVLSVM  606



>ref|XP_010266301.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Nelumbo nucifera]
Length=617

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+ HGP A S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATITNLKNPVNKWRCGAAPITAMMTVKRWSHGPRAAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+GKAY LLRQNA KFL+ DVYRNPGPLQF+GPGADAK + LCVEDQD
Sbjct  502  IGKPAVHPAPVDLKGKAYGLLRQNAAKFLMDDVYRNPGPLQFEGPGADAKTVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIK+LQEYLDKVR+IVKPGCSQ+VLKAALSAMASVT +LSV+S
Sbjct  562  YMGRIKKLQEYLDKVRSIVKPGCSQEVLKAALSAMASVTEVLSVIS  607



>ref|XP_010094500.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
 gb|EXB56254.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
Length=631

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGA PIT MMTV+R+   P A S
Sbjct  456  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCGATPITVMMTVKRWSQNPGASS  515

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNAT+ L+ D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  516  IGKPAIHPATVDLKGKAYELLRQNATQLLIDDLYRNPGPLQFDGPGADAKAVTLCVEDQD  575

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALS MASVT++LS MS+
Sbjct  576  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSVMASVTDVLSTMSS  622



>ref|XP_008237897.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Prunus mume]
Length=668

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NL+NPVNKWRCGAAPITAMMTVRR+   P   S
Sbjct  493  CDYAYVLGHIGYHILAAGLNGYMATVTNLRNPVNKWRCGAAPITAMMTVRRWSQNPGTAS  552

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNATKFLL D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  553  IGKPAIHPATVDLKGKAYELLRQNATKFLLDDIYRNPGPLQFDGPGADSKAVTLCVEDQD  612

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDK+RTIVKPGCSQ+VLKAALS MASVT +LSVMS+
Sbjct  613  YMGRIKKLQEYLDKIRTIVKPGCSQEVLKAALSVMASVTEVLSVMSS  659



>gb|ABK92538.1| unknown [Populus trichocarpa]
Length=353

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+   P A S
Sbjct  178  CDYAYVLGHISYHILAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRWAQSPGASS  237

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA +F + D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  238  IGKPAIHPATVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQD  297

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG IK+LQEYLDKVR IVKPGCSQ+VLKAALS M+SVT++LSVMS+
Sbjct  298  YMGGIKKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSS  344



>ref|XP_010063177.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
 gb|KCW70370.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=616

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPI +MMTV+R+   PAA S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCGAAPIASMMTVKRWAQNPAASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HPATVDL+GKAYELLRQNATKFL+ DVYRNPGPLQFDGPG D+K + LCVEDQD
Sbjct  502  IGKPTIHPATVDLKGKAYELLRQNATKFLMEDVYRNPGPLQFDGPGVDSKPVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIK+LQE+LDKVRTIVKPGCSQDVLKAALS MASVT++LSVMS
Sbjct  562  YMGRIKKLQEHLDKVRTIVKPGCSQDVLKAALSIMASVTDVLSVMS  607



>ref|XP_009777872.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNPVNKW CGAAPI+AMMTV+RYG GP   S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKNPVNKWHCGAAPISAMMTVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G PALHPATVDL+GK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGVPALHPATVDLKGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+IL
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDIL  603



>gb|KJB29714.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=617

 Score =   302 bits (773),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAP+ AMMTV+R+   P A S
Sbjct  443  CDYAYVLGHICYHILAAGLNGYMATITNLKNPVNKWRCGAAPLPAMMTVKRWSQNPNAAS  502

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYE+LRQNA +FLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  503  IGKPAIHPATVDLKGKAYEMLRQNAARFLLDDIYRNPGPLQFDGPGADAKAVTLCVEDQD  562

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT +LSVM
Sbjct  563  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTEVLSVM  607



>gb|KJB29713.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=616

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAP+ AMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKNPVNKWRCGAAPLPAMMTVKRWSQNPNAAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYE+LRQNA +FLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYEMLRQNAARFLLDDIYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT +LSVM
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTEVLSVM  606



>gb|KDO85265.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=588

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPIT+MMTV+R+   P A S
Sbjct  415  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPANKWRCGAAPITSMMTVKRWSQNPGASS  474

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA++PATVD+RGKAYELLRQNAT+FLL D+YRNPGP+QFDGPGADAKA+ LCVED+D
Sbjct  475  IGRPAINPATVDMRGKAYELLRQNATRFLLDDLYRNPGPVQFDGPGADAKAVTLCVEDRD  534

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS-NGGNTNF  213
            YMGRIKELQ+YLD+VRTIVKPGCSQ+VLKAALS MASVT +LS MS +GG T  
Sbjct  535  YMGRIKELQKYLDEVRTIVKPGCSQEVLKAALSVMASVTEVLSAMSASGGQTTL  588



>gb|ADZ96380.2| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Eriobotrya 
japonica]
Length=617

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NL+NPVNKWRCGAAP+TAMMTV+R+   P   S
Sbjct  442  CDYAYVLGHIGYHILAAGLNGYMATVTNLRNPVNKWRCGAAPLTAMMTVKRWAQNPGTAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNATKFLL D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNATKFLLDDIYRNPGPLQFDGPGADSKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT +LSVMS+
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTEVLSVMSS  608



>ref|XP_004238468.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Solanum lycopersicum]
Length=616

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNP NKW CGAAPI+AMMTV+RYG GP   S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATITNLKNPANKWHCGAAPISAMMTVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G PALHPATVDLRGK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGVPALHPATVDLRGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            Y+GRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+IL
Sbjct  562  YIGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDIL  603



>ref|XP_006435472.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006473868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Citrus sinensis]
 gb|ABY25305.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
sinensis x Citrus trifoliata]
 gb|ESR48712.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85266.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=615

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPIT+MMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPANKWRCGAAPITSMMTVKRWSQNPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA++PATVD+RGKAYELLRQNAT+FLL D+YRNPGP+QFDGPGADAKA+ LCVED+D
Sbjct  502  IGRPAINPATVDMRGKAYELLRQNATRFLLDDLYRNPGPVQFDGPGADAKAVTLCVEDRD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS-NGGNTNF  213
            YMGRIKELQ+YLD+VRTIVKPGCSQ+VLKAALS MASVT +LS MS +GG T  
Sbjct  562  YMGRIKELQKYLDEVRTIVKPGCSQEVLKAALSVMASVTEVLSAMSASGGQTTL  615



>ref|XP_007018640.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
 gb|EOY15865.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
Length=617

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPI AMM+V+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKNPVNKWRCGAAPIAAMMSVKRWSQNPNALS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA +FLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNAARFLLDDIYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYL+KVRTIVKPGCSQ+VLKAALS MASVT +LSVM
Sbjct  562  YMGRIKKLQEYLEKVRTIVKPGCSQEVLKAALSVMASVTEVLSVM  606



>ref|XP_006435473.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006435474.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48713.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48714.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85267.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85268.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=623

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPIT+MMTV+R+   P A S
Sbjct  450  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPANKWRCGAAPITSMMTVKRWSQNPGASS  509

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA++PATVD+RGKAYELLRQNAT+FLL D+YRNPGP+QFDGPGADAKA+ LCVED+D
Sbjct  510  IGRPAINPATVDMRGKAYELLRQNATRFLLDDLYRNPGPVQFDGPGADAKAVTLCVEDRD  569

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS-NGGNTNF  213
            YMGRIKELQ+YLD+VRTIVKPGCSQ+VLKAALS MASVT +LS MS +GG T  
Sbjct  570  YMGRIKELQKYLDEVRTIVKPGCSQEVLKAALSVMASVTEVLSAMSASGGQTTL  623



>ref|XP_008346428.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NL+NPVNKWRCGAAP+TAMMTV+R+   P   S
Sbjct  442  CDYAYVLGHIGYHILAAGLNGYMATITNLRNPVNKWRCGAAPLTAMMTVKRWAQNPGTAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAY+LLRQNATKFLL D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYDLLRQNATKFLLDDIYRNPGPLQFDGPGADSKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDK+RTIVKPGCSQ+VLKAALS MASVT +LSVMS+
Sbjct  562  YMGRIKKLQEYLDKIRTIVKPGCSQEVLKAALSVMASVTEVLSVMSS  608



>sp|P21342.2|PFPA_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Solanum tuberosum]
Length=616

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNP NKW CGA+PI+AMMTV+RYG GP   S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATITNLKNPANKWHCGASPISAMMTVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G PALHPATVDLRGK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGVPALHPATVDLRGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            Y+GRIK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+IL
Sbjct  562  YIGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDIL  603



>ref|XP_008373335.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NL+NPVNKWRCGAAP+TAMMTV+R+   P   S
Sbjct  442  CDYAYVLGHIGYHILAAGLNGYMATITNLRNPVNKWRCGAAPLTAMMTVKRWAQNPGTAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAY+LLRQNATKFLL D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYDLLRQNATKFLLDDIYRNPGPLQFDGPGADSKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDK+RTIVKPGCSQ+VLKAALS MASVT +LSVMS+
Sbjct  562  YMGRIKKLQEYLDKIRTIVKPGCSQEVLKAALSVMASVTEVLSVMSS  608



>gb|KDP36731.1| hypothetical protein JCGZ_08022 [Jatropha curcas]
Length=617

 Score =   299 bits (766),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRWAQSPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GK YELLR NATKFL+ D+YRNPGPLQF+GPGADA+ + LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKVYELLRLNATKFLMDDIYRNPGPLQFEGPGADARPVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLD+VRTIVKPGCSQ+VLKAALS MASVT++LS MS+
Sbjct  562  YMGRIKKLQEYLDQVRTIVKPGCSQEVLKAALSVMASVTDVLSAMSS  608



>ref|XP_009372651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Pyrus x bretschneideri]
Length=617

 Score =   299 bits (766),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NL+NPVNKWRCGAAP+TAMMTV+R+   P   S
Sbjct  442  CDYAYVLGHIGYHILAAGLNGYMATITNLRNPVNKWRCGAAPLTAMMTVKRWAQNPGTAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA KFLL D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNARKFLLDDIYRNPGPLQFDGPGADSKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT +LSVMS+
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTEVLSVMSS  608



>ref|XP_008796200.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Phoenix dactylifera]
Length=620

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNPVNKW+CGAAPITAMMTV+R+  GPAA  
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATITNLKNPVNKWKCGAAPITAMMTVKRWSRGPAASM  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKA+ELLR NA+ FL+ D+YRN GPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAVHPATVDLKGKAFELLRHNASSFLMDDIYRNLGPLQFDGPGADAKAITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK LQEYLDKV++IVKPGCSQDVLKAALS+MASVT++LSVM++
Sbjct  562  YMGRIKLLQEYLDKVKSIVKPGCSQDVLKAALSSMASVTDVLSVMAS  608



>gb|AAC67587.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
x paradisi]
Length=615

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPIT+MMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPANKWRCGAAPITSMMTVKRWSQNPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA++PATVD+RGKAYELLRQNAT+FLL D+YRNPGP+QFDGPGADAKA+ LCVED+D
Sbjct  502  IGRPAINPATVDMRGKAYELLRQNATRFLLDDLYRNPGPVQFDGPGADAKAVTLCVEDRD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS-NGGNTNF  213
            YMGRIKELQ+YLD+VRTIVKPGCSQ+VLKAALS MASVT +LS +S +GG T  
Sbjct  562  YMGRIKELQKYLDEVRTIVKPGCSQEVLKAALSVMASVTEVLSAISASGGQTTL  615



>gb|EYU41211.1| hypothetical protein MIMGU_mgv1a003012mg [Erythranthe guttata]
Length=616

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHI+AAGLNGY+AT+ NLKNP+NKWRC AAPITAM+TV+RYG G  A +
Sbjct  442  CDYAYVLGHIGYHIIAAGLNGYMATVTNLKNPLNKWRCAAAPITAMLTVKRYGRGHGASN  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPALHPATVDL+GKAYELLRQNATKFL+ DVYRNPGPLQFDGPGADAK + LCVEDQD
Sbjct  502  LGKPALHPATVDLKGKAYELLRQNATKFLMDDVYRNPGPLQFDGPGADAKPVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS--NGGNTNF  213
            YMGRIK+LQEYLDKVR+IVKPGCS DVLKAAL AM SVT+ILSVMS  + G T F
Sbjct  562  YMGRIKKLQEYLDKVRSIVKPGCSPDVLKAALCAMTSVTDILSVMSSPSSGTTPF  616



>ref|XP_010527650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Tarenaya hassleriana]
Length=614

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+C HILAAGL+GY+AT+ NLKNP+NKWRCGA PITAMM+V+R+   P A S
Sbjct  442  CDYAYVLGHICRHILAAGLSGYMATITNLKNPINKWRCGATPITAMMSVKRWSPNPGAIS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HPATVDL+GKAYELLRQNA K L+ DVYRNPGPLQFDGPGADAK++ LCVEDQD
Sbjct  502  MGKPTIHPATVDLKGKAYELLRQNAQKCLMEDVYRNPGPLQFDGPGADAKSITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTN  216
            YMGRIK+LQEYLD+VRTIVKPGCSQDV+KAALS MASVT++LSVMS+  N+N
Sbjct  562  YMGRIKKLQEYLDRVRTIVKPGCSQDVVKAALSIMASVTDVLSVMSSTSNSN  613



>ref|XP_010932134.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=622

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YH LAAGLNGY+AT+ NLKNPVNKWRCGA+PITAMMTV+R+ HGPAA  
Sbjct  442  CDYAYVLGHVSYHTLAAGLNGYMATITNLKNPVNKWRCGASPITAMMTVKRWSHGPAASL  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA+ FL+ DVY NPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAMHPATVDLKGKAYELLRQNASSFLMDDVYSNPGPLQFDGPGADAKAITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNT  219
            YMG+IK LQE+LDKV+ IVKPGCSQDVLKAALSAMASVT++LS+M++  ++
Sbjct  562  YMGQIKLLQEHLDKVKRIVKPGCSQDVLKAALSAMASVTDVLSMMASHSSS  612



>ref|XP_010061240.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
Length=617

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 4/175 (2%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPITAMMTV+R+   P +  
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPQNKWRCGAAPITAMMTVKRWAQNPNSSF  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELL+QNA KFLL D+YRNPGPLQFDGPGADAK + LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLQQNAVKFLLDDLYRNPGPLQFDGPGADAKPVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM----SNGGNT  219
            YMGRIK LQEYLDKVRTIVKPGCSQ+VLKAALS+MASVT +LSV+    SNG N+
Sbjct  562  YMGRIKLLQEYLDKVRTIVKPGCSQEVLKAALSSMASVTEVLSVLSTPSSNGMNS  616



>ref|XP_011041142.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Populus euphratica]
Length=489

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YHILAAG+NGY+ T+ NLKNPVNKWRCGAAPITAMMTV+R+   P A S
Sbjct  314  CDYAYVLGHVSYHILAAGMNGYMTTVTNLKNPVNKWRCGAAPITAMMTVKRWAQSPGASS  373

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA +F + D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  374  IGKPAIHPATVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQD  433

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG IK+LQEYLDKVR IVKPGCSQ+VLKAALS M+SVT++LSVMS+
Sbjct  434  YMGGIKKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSS  480



>gb|AIE47261.1| pyrophosphate-dependent phosphofructokinase [Hevea brasiliensis]
Length=617

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHIL AGLNGY+AT+ NLKNPVNKWRC AAPITAMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILVAGLNGYMATVTNLKNPVNKWRCSAAPITAMMTVKRWAQSPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+GKAYELLR+NA KFL+ D+YRNPGPLQF+GPGADAK L LCVEDQD
Sbjct  502  IGKPAIHPAAVDLKGKAYELLRENAIKFLMDDLYRNPGPLQFEGPGADAKPLTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTN  216
            YMGRIK+LQ+YLDKVRTIVKPGCSQ+VLKAALS MASVT++LS MS+    N
Sbjct  562  YMGRIKKLQDYLDKVRTIVKPGCSQEVLKAALSVMASVTDVLSAMSSTSINN  613



>gb|KHN01580.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Glycine soja]
Length=353

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPI +MMTV+R+   P A S
Sbjct  178  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCGAAPIASMMTVKRWSPNPGATS  237

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLRQ A  FL+ D+YRNPGPLQFDGPGA AK + L VEDQD
Sbjct  238  IGKPAIHPATVDLRGKAYELLRQKAQSFLMDDIYRNPGPLQFDGPGAGAKVITLSVEDQD  297

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMGRIK+LQEYL++VRTIVKPGC Q+VLKAALS MASVT +L+ MS       
Sbjct  298  YMGRIKKLQEYLEQVRTIVKPGCPQEVLKAALSVMASVTEVLAAMSTSSTNTL  350



>ref|XP_008453023.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Cucumis melo]
Length=619

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+VLGHVCYHILAAGLNGY+ATL NLKNPVNKWRCGAAPI AMMTV+R+   P A S
Sbjct  442  CDYAFVLGHVCYHILAAGLNGYMATLTNLKNPVNKWRCGAAPIAAMMTVKRWAQNPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA++FL+ D+YRNPGPLQFDGPGADAK + LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNASQFLMDDLYRNPGPLQFDGPGADAKPVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVL  603



>ref|XP_002307823.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE94819.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+   P A S
Sbjct  442  CDYAYVLGHISYHILAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRWAQSPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA +F + D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG IK+LQEYLDKVR IVKPGCSQ+VLKAALS M+SVT++LSVMS+
Sbjct  562  YMGGIKKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSS  608



>ref|XP_004145564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Cucumis sativus]
 ref|XP_004157061.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Cucumis sativus]
 gb|KGN55545.1| hypothetical protein Csa_4G664520 [Cucumis sativus]
Length=619

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+VLGHVCYHILAAGLNGY+ATL NLKNPVNKWRCGAAPI AMMTV+R+   P + S
Sbjct  442  CDYAFVLGHVCYHILAAGLNGYMATLTNLKNPVNKWRCGAAPIAAMMTVKRWAQNPGSSS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA +FL+ D+YRNPGPLQFDGPGADAK + LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNANQFLMDDLYRNPGPLQFDGPGADAKPVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVL  603



>ref|XP_010927304.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
 ref|XP_010927305.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=617

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAA LNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+  GPAA  
Sbjct  442  CDYAYVLGHVCYHILAARLNGYMATITNLKNPVNKWRCGAAPITAMMTVKRWSRGPAASL  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATV+L+GKA+ELLR NA+ FL+ D+YRN GPLQFDGPGADAK + LCVEDQD
Sbjct  502  IGKPAVHPATVELKGKAFELLRHNASSFLMDDIYRNLGPLQFDGPGADAKTITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK LQEYL+KV++IVKPGCSQDVLKAALSAMASVT++LSVM++
Sbjct  562  YMGRIKLLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTDVLSVMAS  608



>ref|XP_008802157.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YH LAAGLNGY+AT+ NLKNP+NKWRCGAAPITAMM+V+R+ HGPAA  
Sbjct  442  CDYAYVLGHVSYHTLAAGLNGYMATITNLKNPMNKWRCGAAPITAMMSVKRWSHGPAASL  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPALHPAT+DL+GKAYELLRQNA+  L+ DVY N GPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPALHPATIDLKGKAYELLRQNASSLLMDDVYSNTGPLQFDGPGADAKAITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG+IK LQEYLDKV++IVKPGCSQDVLKAALSAMASVT++L+VM++
Sbjct  562  YMGQIKLLQEYLDKVKSIVKPGCSQDVLKAALSAMASVTDVLAVMAS  608



>gb|ACF80583.1| unknown [Zea mays]
Length=335

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLN Y+AT+ NLKNPVNKWRCGA PI++MMTV+R+  GP+A  
Sbjct  159  CDYAYVLGHVCYHIIAAGLNSYMATVTNLKNPVNKWRCGATPISSMMTVKRWSRGPSATQ  218

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAY++LRQN++ FLL DVYRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  219  IGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGPLQFEGPGADSKPISLCVEDQD  278

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            YMGRIK+LQEYL+KV+ IVKPGCSQDVLKAALSAM+SVT  L++M++   
Sbjct  279  YMGRIKKLQEYLEKVKRIVKPGCSQDVLKAALSAMSSVTETLNIMTSSST  328



>ref|XP_011041141.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Populus euphratica]
Length=617

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YHILAAG+NGY+ T+ NLKNPVNKWRCGAAPITAMMTV+R+   P A S
Sbjct  442  CDYAYVLGHVSYHILAAGMNGYMTTVTNLKNPVNKWRCGAAPITAMMTVKRWAQSPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLRQNA +F + D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG IK+LQEYLDKVR IVKPGCSQ+VLKAALS M+SVT++LSVMS+
Sbjct  562  YMGGIKKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSS  608



>gb|ABK93964.1| unknown [Populus trichocarpa]
Length=617

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+R+   P A S
Sbjct  442  CDYAYVLGHISYHILAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRWAQSPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+GKAYELLRQNA +F + D+YRNPGPLQFDGPGAD+KA+ LCVEDQD
Sbjct  502  IGKPAIHPAAVDLKGKAYELLRQNAGRFWMDDLYRNPGPLQFDGPGADSKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG IK+LQEYLDKVR IVKPGCSQ+VLKAALS M+SVT++LSVMS+
Sbjct  562  YMGGIKKLQEYLDKVRNIVKPGCSQEVLKAALSVMSSVTDVLSVMSS  608



>ref|XP_011099944.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Sesamum indicum]
Length=626

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+ YHILAAGLNGY+AT+NNLKNPVNKWRCGAAPITAM+TV+ YGHG  A +
Sbjct  442  CDYAYVLGHIGYHILAAGLNGYMATVNNLKNPVNKWRCGAAPITAMLTVKHYGHGNGALT  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPAL+PATVDL G+AYELLRQNATKFL+ D+YRNPGPLQFDGPGADAK + LC+ED D
Sbjct  502  IGKPALYPATVDLNGRAYELLRQNATKFLMDDLYRNPGPLQFDGPGADAKVVTLCLEDHD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRI++LQEYLDKVR+IVKPGCSQDVLKAALSAMASVT+IL
Sbjct  562  YMGRIQKLQEYLDKVRSIVKPGCSQDVLKAALSAMASVTDIL  603



>dbj|BAD95089.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Arabidopsis thaliana]
Length=310

 Score =   283 bits (723),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPI+AMMTV+R+     + +
Sbjct  135  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPISAMMTVKRWSQNSGSTT  194

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA+VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  195  IGRPVIHPASVDLKGKAYDLLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  254

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMG+IK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L
Sbjct  255  YMGKIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVL  296



>ref|XP_002510738.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF52925.1| phosphofructokinase, putative [Ricinus communis]
Length=617

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYH+LAAGLNGY+AT  NLKNPVNKWRCGAAPI AMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATATNLKNPVNKWRCGAAPIAAMMTVKRWAQNPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+GKAYELLR NA KFL+ D+YRNPGPLQF+GPGADAK + LCVEDQD
Sbjct  502  IGKPAIHPAAVDLKGKAYELLRLNAVKFLMDDLYRNPGPLQFEGPGADAKPITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT++L  MS+
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVLLTMSS  608



>ref|XP_010270592.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=617

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+VLGHVC HIL+AGLNGY+AT+ NLKNPVNKWRCGAAP+TAMMTV+R+ HGP   S
Sbjct  442  CDYAFVLGHVCCHILSAGLNGYMATITNLKNPVNKWRCGAAPMTAMMTVKRWSHGPGVAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A VDL+GKAYELLRQNA KFL+ DVYRNPGPLQ++GPGADAK + LCVEDQD
Sbjct  502  IGKPAIHTANVDLKGKAYELLRQNAAKFLMDDVYRNPGPLQYEGPGADAKTVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIK+LQEYLDKVR IVKPGCS DVLKAALS+M+SVT +LSVMS
Sbjct  562  YMGRIKKLQEYLDKVRNIVKPGCSLDVLKAALSSMSSVTEVLSVMS  607



>sp|Q41140.1|PFPA_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Ricinus communis]
 emb|CAA83682.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Ricinus 
communis]
Length=617

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYH+LAAGLNGY+AT  NLKNPVNKWRCGAAPI AMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATATNLKNPVNKWRCGAAPIAAMMTVKRWAQNPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+GKAYELLR NA KFL+ D+YRNPGPLQF+GPGADAK + LCVEDQD
Sbjct  502  IGKPAIHPAAVDLKGKAYELLRLNAVKFLMDDLYRNPGPLQFEGPGADAKPITLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKVRTIVKPGCSQ+VLKAALS MASVT++L  MS+
Sbjct  562  YMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVLLTMSS  608



>gb|AES59948.2| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=597

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGYLAT+ NLKNPVNKW+CGAAPI+AMMTV+R+   P A S
Sbjct  423  CDYAYVLGHICYHILAAGLNGYLATVTNLKNPVNKWKCGAAPISAMMTVKRWSPNPGATS  482

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLRQNAT FL+ D+YRNPGPLQFDGPGADAK + L VEDQD
Sbjct  483  IGKPAIHPATVDLRGKAYELLRQNATSFLMDDIYRNPGPLQFDGPGADAKPITLNVEDQD  542

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYL++VRTIVKPGC Q+VLKAALS M SVT +L+ M
Sbjct  543  YMGRIKKLQEYLEQVRTIVKPGCPQEVLKAALSVMGSVTEVLTAM  587



>ref|XP_003589697.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Medicago truncatula]
Length=596

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGYLAT+ NLKNPVNKW+CGAAPI+AMMTV+R+   P A S
Sbjct  422  CDYAYVLGHICYHILAAGLNGYLATVTNLKNPVNKWKCGAAPISAMMTVKRWSPNPGATS  481

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLRQNAT FL+ D+YRNPGPLQFDGPGADAK + L VEDQD
Sbjct  482  IGKPAIHPATVDLRGKAYELLRQNATSFLMDDIYRNPGPLQFDGPGADAKPITLNVEDQD  541

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYL++VRTIVKPGC Q+VLKAALS M SVT +L+ M
Sbjct  542  YMGRIKKLQEYLEQVRTIVKPGCPQEVLKAALSVMGSVTEVLTAM  586



>emb|CDY33660.1| BnaC08g19600D [Brassica napus]
Length=598

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGH--GPAA  558
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    G  +
Sbjct  421  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKNWSQNAGSTS  480

Query  557  DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAYELLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  481  TSIGRPAIHPAMVDLKGKAYELLRQNAEKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  540

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+ +S+  N
Sbjct  541  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSSSN  592



>ref|XP_009410339.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Musa 
acuminata subsp. malaccensis]
Length=613

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+VLGHVCYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPITAMM+V+R+ HGP A  
Sbjct  442  CDYAFVLGHVCYHILAAGLNGYMATITNLKNPVNKWRCGAAPITAMMSVKRWSHGPGAMP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLR++A+ FL+ D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLRRSASSFLMDDIYRNPGPLQFDGPGADAKAISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTN  252
            YMGRIK LQEYLDKVR+IVKPGC Q+VLKAALS+MASVT+
Sbjct  562  YMGRIKLLQEYLDKVRSIVKPGCPQEVLKAALSSMASVTD  601



>ref|XP_007153134.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
 gb|ESW25128.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
Length=617

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+ATL NLKNPVNKWRCGAAPI +MMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATLTNLKNPVNKWRCGAAPIASMMTVKRWSPNPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLR+NA  FL+ D+YRNPGPLQFDGPGAD+K + L VEDQD
Sbjct  502  IGKPAIHPATVDLRGKAYELLRKNAESFLMDDIYRNPGPLQFDGPGADSKVITLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMGRIK+LQEYL++VRTIVKPGC Q+VLKAALS MASVT +L+ MS   + + 
Sbjct  562  YMGRIKKLQEYLEQVRTIVKPGCPQEVLKAALSVMASVTEVLAAMSTTSSNSL  614



>emb|CDX96611.1| BnaA08g21540D [Brassica napus]
Length=598

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGH--GPAA  558
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    G  +
Sbjct  421  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKNWSQNAGSTS  480

Query  557  DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAYELLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  481  TSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  540

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+ +S+  N
Sbjct  541  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSSSN  592



>ref|XP_009391869.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=618

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKWRCGAAP+TAMMTV+RY  GP A  
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKHPVNKWRCGAAPLTAMMTVKRYSRGPGATP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+TVDL+GK YELLRQ A  FL+ D+YRNPGPLQF+GPGAD K   L VEDQD
Sbjct  502  IGKPAIHPSTVDLKGKVYELLRQKALSFLMDDLYRNPGPLQFEGPGADVKTYTLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKV++IVKPGCSQDVLKAALS+MASVT +LSVMS 
Sbjct  562  YMGRIKKLQEYLDKVKSIVKPGCSQDVLKAALSSMASVTEVLSVMST  608



>ref|NP_001275358.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Solanum tuberosum]
 gb|AAA63451.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha-subunit 
[Solanum tuberosum]
Length=616

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKNP NKW CGA+PI+AMMTV+RYG GP   S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATITNLKNPANKWHCGASPISAMMTVKRYGRGPGKAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G PALHPATVDLRGK+YELL QNATKFLL DVYRNPGPLQFDGPGADAKA  L VED D
Sbjct  502  IGVPALHPATVDLRGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAGSLVVEDAD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            Y+G IK+LQEYLDKVRTIVKPGCSQDVLKAALSAMASVT+IL
Sbjct  562  YIGAIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDIL  603



>ref|XP_010537247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Tarenaya hassleriana]
Length=610

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+P NKW+CGAAP+TAMMTV+R+     + S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPSNKWKCGAAPMTAMMTVKRWSQNAGSAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA+HPATVDLRGKAYELLRQNA +F+  D+YRNPGPLQ+DGPG+D+KA+ LCVEDQD
Sbjct  502  IGRPAIHPATVDLRGKAYELLRQNAERFMKDDLYRNPGPLQYDGPGSDSKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++LS MS+
Sbjct  562  YMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLSTMSS  608



>ref|XP_006849934.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
 gb|ERN11515.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
Length=615

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YH++AA LNGY+AT+ NLKNPV KWRCG APITAMMTVRRY  GP    
Sbjct  440  CDYAYVLGHVSYHLIAANLNGYMATVTNLKNPVAKWRCGGAPITAMMTVRRYARGPGVIP  499

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLRQNA  +L  D+YRNPGPLQF+GPG+DAK + LCVEDQD
Sbjct  500  IGKPAVHPATVDLRGKAYELLRQNAVSYLTDDIYRNPGPLQFEGPGSDAKPISLCVEDQD  559

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIK+LQEYLDKV++IVKPGCSQDVLKAALSAM+SVT+ILSVM+
Sbjct  560  YMGRIKKLQEYLDKVKSIVKPGCSQDVLKAALSAMSSVTDILSVMT  605



>ref|XP_003555655.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
 gb|KHM99024.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Glycine soja]
Length=617

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+ATL NLKNPVNKW+CGAAPI +MMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATLTNLKNPVNKWKCGAAPIASMMTVKRWSPNPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLRQ A  FL+ D+YRNPGPLQFDGPGADAK + L VEDQD
Sbjct  502  IGKPAIHPATVDLRGKAYELLRQKAQSFLMDDIYRNPGPLQFDGPGADAKVITLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL++VRTIVKPGC Q+VLKAALS MASVT +L+ MS 
Sbjct  562  YMGRIKKLQEYLEQVRTIVKPGCPQEVLKAALSVMASVTEVLAAMST  608



>ref|XP_006390180.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
 gb|ESQ27466.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
Length=617

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+R+     + S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPATVDL+GKAYELLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPATVDLKGKAYELLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVL  603



>emb|CDY67022.1| BnaC05g50320D [Brassica napus]
Length=619

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT++NLK+PVNKW+CGAAPITAMMTV+ +    ++ S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVSNLKSPVNKWKCGAAPITAMMTVKNWSQNASSTS  501

Query  551  --FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
               G+PA+HPA VDL+GKAYELLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+ +S+  N
Sbjct  562  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSSSN  613



>ref|XP_004953678.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=616

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLNGY+AT+ NLK+PVNKWRCGAAPI+AMMTV+++  GP+A  
Sbjct  442  CDYAYVLGHVCYHIIAAGLNGYMATVTNLKSPVNKWRCGAAPISAMMTVKQWSRGPSAAQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELLRQN++ FLL D+YRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLKGKAYELLRQNSSSFLLEDIYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLNIMTS  608



>ref|XP_009149574.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Brassica rapa]
 emb|CDY67203.1| BnaA06g38560D [Brassica napus]
Length=619

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT++NLK+PVNKW+CGAAPITAMMTV+ +    ++ S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVSNLKSPVNKWKCGAAPITAMMTVKNWSQNASSTS  501

Query  551  --FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
               G+PA+HPA VDL+GKAYELLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+ +S+  N
Sbjct  562  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSSSN  613



>gb|KFK42073.1| hypothetical protein AALP_AA2G207700 [Arabis alpina]
Length=617

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+R+     + S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKRWSQNAGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPATVDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPATVDLKGKAYDLLRQNAQKFLMEDMYRNPGPLQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVL  603



>ref|XP_004965353.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=622

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPIT+MMTV+R+  GP A  
Sbjct  447  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITSMMTVKRWSRGPTASQ  506

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELLRQN++ FL+ D+YRNPGPLQF+GPGA+ K + LCVED+D
Sbjct  507  IGKPAVHMASVDLKGKAYELLRQNSSSFLMEDIYRNPGPLQFEGPGAETKPISLCVEDRD  566

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAA+SAMASVT +L++MS 
Sbjct  567  YMGRIKQLQEYLEKVKSIVKPGCSQDVLKAAVSAMASVTEMLTIMST  613



>ref|XP_002452651.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
 gb|EES05627.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
Length=616

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLNGY+AT+ NLK+PVNKWRCGAAPI++MMTV+R+  GP+A  
Sbjct  442  CDYAYVLGHVCYHIIAAGLNGYMATVTNLKSPVNKWRCGAAPISSMMTVKRWSRGPSATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAY++LRQN++ FLL DVYRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM--SNGGNT  219
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M  S+ G T
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLNIMTSSSAGQT  614



>ref|XP_008775478.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+VLGH+CYHILAAGLNGY+AT+ NLK+PV+KWRCGAAP+TAMMTV+RY  GP +  
Sbjct  442  CDYAFVLGHICYHILAAGLNGYMATVTNLKHPVHKWRCGAAPLTAMMTVKRYSRGPGSIP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA+VDL+GK YELLRQ A  FL+ D+YRNPGPLQFDGPGAD K   L VEDQD
Sbjct  502  IGKPAIHPASVDLKGKVYELLRQKAPSFLMDDLYRNPGPLQFDGPGADVKTYTLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIK+LQEYLDKVR+IVKPGCSQDVLKAALS+MASVT++LSVM+
Sbjct  562  YMGRIKKLQEYLDKVRSIVKPGCSQDVLKAALSSMASVTDVLSVMT  607



>ref|XP_003529192.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
Length=617

 Score =   286 bits (732),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPI +MMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCGAAPIASMMTVKRWSPNPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDLRGKAYELLRQ A  FL+ D+YRNPGPLQFDGPGA AK + L VEDQD
Sbjct  502  IGKPAIHPATVDLRGKAYELLRQKAQSFLMDDIYRNPGPLQFDGPGAGAKVITLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMGRIK+LQEYL++VRTIVKPGC Q+VLKAALS MASVT +L+ MS       
Sbjct  562  YMGRIKKLQEYLEQVRTIVKPGCPQEVLKAALSVMASVTEVLAAMSTSSTNTL  614



>ref|NP_001146841.1| LOC100280449 [Zea mays]
 gb|ACG23899.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
 gb|ACN28159.1| unknown [Zea mays]
 gb|AFW63610.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=616

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLNGY+AT+ N+K+PVNKWRCGAAPI++MMTV+R+  GP+A  
Sbjct  442  CDYAYVLGHVCYHIIAAGLNGYMATVTNVKSPVNKWRCGAAPISSMMTVQRWSRGPSATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAY++LRQN+++FLL DVYRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLKGKAYDVLRQNSSRFLLEDVYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLNIMTS  608



>ref|XP_004300090.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Fragaria vesca subsp. vesca]
Length=618

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 150/166 (90%), Gaps = 1/166 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP-AAD  555
            CDYAYVLGH+CYH+LAAGLNGY+AT+ NLKNP+NKWRCGA P TAMM+V+R+   P +A 
Sbjct  442  CDYAYVLGHICYHMLAAGLNGYMATVTNLKNPLNKWRCGATPFTAMMSVKRWSQNPGSAA  501

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQ  375
            S GKP + PATVDL+GKAYELLRQNATKFLL D+YRNPGPLQF+GPGAD+KA+ LCVEDQ
Sbjct  502  SIGKPGIFPATVDLKGKAYELLRQNATKFLLDDIYRNPGPLQFEGPGADSKAVTLCVEDQ  561

Query  374  DYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            DYMGRIK+LQEYLD++RTIVKPGCSQ+VLKAALS M SV+ +L+VM
Sbjct  562  DYMGRIKKLQEYLDQIRTIVKPGCSQEVLKAALSVMGSVSEVLTVM  607



>ref|XP_006659170.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=622

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPIT+MMTV+R+  GPAA  
Sbjct  447  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITSMMTVKRWSRGPAASQ  506

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GK YELLRQN++ FL+ D+YRNPGPLQF+GPG + K + LCVED+D
Sbjct  507  IGKPAVHMASVDLKGKPYELLRQNSSNFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRD  566

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAMASVT +L++MS+
Sbjct  567  YMGRIKQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSS  613



>dbj|BAJ92904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=616

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+P+NKWRCGAAPI++MMTV+R+  GPA   
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPLNKWRCGAAPISSMMTVKRWSRGPATTQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDLRGKAYE+LRQN++  LL D+YRNPGPLQF+GPGADAK + LCVEDQD
Sbjct  502  IGKPAVHMASVDLRGKAYEMLRQNSSSCLLEDIYRNPGPLQFEGPGADAKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLAIMTS  608



>ref|XP_004498196.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Cicer arietinum]
Length=604

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKW+CGAAPI++MMTV+R+   P A S
Sbjct  430  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWKCGAAPISSMMTVKRWSPNPGATS  489

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDLRGK YELLR+NAT FLL D+YRNPGPLQFDGPGADAK L L VEDQD
Sbjct  490  IGKPAIHPAAVDLRGKPYELLRKNATSFLLDDIYRNPGPLQFDGPGADAKPLTLSVEDQD  549

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMGRIK+LQEYL++VR IVKPGC Q+VLKAALS M SVT +L+ MS+  +TN 
Sbjct  550  YMGRIKKLQEYLEQVRNIVKPGCPQEVLKAALSVMGSVTEVLTAMSS-SSTNL  601



>ref|XP_009417287.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=616

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LGHVCYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPI AMMTV+R  +GP A +
Sbjct  442  CDYAYALGHVCYHILAAGLNGYMATITNLKNPVNKWRCGAAPIPAMMTVKRL-YGPGATA  500

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL GKAYEL+R  A+ FL+ D+YRNPGP+QF+GPGADAK++ LCVEDQD
Sbjct  501  IGKPAIHPATVDLEGKAYELVRLRASSFLMDDIYRNPGPIQFEGPGADAKSISLCVEDQD  560

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK LQEYLDKV++IVKPGCSQDVLKAALSAMASVT++L++MS+
Sbjct  561  YMGRIKLLQEYLDKVKSIVKPGCSQDVLKAALSAMASVTDVLALMSS  607



>ref|XP_004498195.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Cicer arietinum]
Length=616

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKW+CGAAPI++MMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWKCGAAPISSMMTVKRWSPNPGATS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDLRGK YELLR+NAT FLL D+YRNPGPLQFDGPGADAK L L VEDQD
Sbjct  502  IGKPAIHPAAVDLRGKPYELLRKNATSFLLDDIYRNPGPLQFDGPGADAKPLTLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMGRIK+LQEYL++VR IVKPGC Q+VLKAALS M SVT +L+ MS+  +TN 
Sbjct  562  YMGRIKKLQEYLEQVRNIVKPGCPQEVLKAALSVMGSVTEVLTAMSS-SSTNL  613



>gb|KFK35354.1| hypothetical protein AALP_AA5G273800 [Arabis alpina]
Length=619

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHG--PAA  558
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +       +
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKSPVNKWKCGAAPITAMMTVKHWSQNACSTS  501

Query  557  DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQN+ KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYDLLRQNSQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+ +S+  N
Sbjct  562  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSSSN  613



>dbj|BAD33246.1| putative Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
alpha subunit [Oryza sativa Japonica Group]
Length=617

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NL++PVNKW+CGAAPIT+MMTV+R+  GPAA  
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLRSPVNKWKCGAAPITSMMTVKRWSRGPAASQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A++DL+GK YELLRQN++ FL+ D+YRNPGPLQF+GPG + K + LCVED+D
Sbjct  502  IGKPAVHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAMASVT +L++MS+
Sbjct  562  YMGRIKQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSS  608



>ref|XP_010539758.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Tarenaya hassleriana]
Length=613

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY+LGH+CYHILAAGLNGY+AT+ NLK+P NKW+CGAAP+TAMMTV+R+     + S
Sbjct  442  CDYAYILGHICYHILAAGLNGYMATVTNLKSPANKWKCGAAPMTAMMTVKRWSQNAGSAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA+HP TVDL+GKAYE+LRQNA +FL+ D+YRNPGPLQ+DGPG+DAKA+ LCVEDQD
Sbjct  502  IGRPAIHPGTVDLKGKAYEVLRQNAERFLMEDLYRNPGPLQYDGPGSDAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            YMGRIK+LQEYL++VRTIVKPGCSQDVLKAALS MASVT++LS M
Sbjct  562  YMGRIKKLQEYLEQVRTIVKPGCSQDVLKAALSVMASVTDVLSTM  606



>gb|EEC80509.1| hypothetical protein OsI_22776 [Oryza sativa Indica Group]
Length=622

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NL++PVNKW+CGAAPIT+MMTV+R+  GPAA  
Sbjct  447  CDYAYVLGHVCYHILAAGLNGYMATVTNLRSPVNKWKCGAAPITSMMTVKRWSRGPAASQ  506

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A++DL+GK YELLRQN++ FL+ D+YRNPGPLQF+GPG + K + LCVED+D
Sbjct  507  IGKPAVHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRD  566

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAMASVT +L++MS+
Sbjct  567  YMGRIKQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSS  613



>ref|NP_001057528.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAF19442.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAG89341.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65619.1| hypothetical protein OsJ_21179 [Oryza sativa Japonica Group]
Length=622

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NL++PVNKW+CGAAPIT+MMTV+R+  GPAA  
Sbjct  447  CDYAYVLGHVCYHILAAGLNGYMATVTNLRSPVNKWKCGAAPITSMMTVKRWSRGPAASQ  506

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A++DL+GK YELLRQN++ FL+ D+YRNPGPLQF+GPG + K + LCVED+D
Sbjct  507  IGKPAVHMASIDLKGKPYELLRQNSSSFLMEDIYRNPGPLQFEGPGGETKPISLCVEDRD  566

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAMASVT +L++MS+
Sbjct  567  YMGRIKQLQEYLEKVKSIVKPGCSQDVLKAALSAMASVTEMLTIMSS  613



>emb|CDX87587.1| BnaA07g32860D [Brassica napus]
Length=617

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLG +CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAP+TAMMTV+R+     + S
Sbjct  442  CDYAYVLGRICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPMTAMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA+HPATVDL+GKAYELLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPAIHPATVDLKGKAYELLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRT+VKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTLVKPGCSQDVLKAALSVMASVTDVL  603



>ref|XP_010235882.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Brachypodium distachyon]
Length=618

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+P+NKWRCGAAPI++MMTV+R+  GPA   
Sbjct  443  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPLNKWRCGAAPISSMMTVKRWSRGPATTQ  502

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDLRGKA+ELLRQN++  LL D+YRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  503  IGKPAVHMASVDLRGKAFELLRQNSSSCLLEDIYRNPGPLQFEGPGADSKPISLCVEDQD  562

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  563  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLAIMTS  609



>ref|XP_003570229.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Brachypodium distachyon]
Length=617

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+P+NKWRCGAAPI++MMTV+R+  GPA   
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPLNKWRCGAAPISSMMTVKRWSRGPATTQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDLRGKA+ELLRQN++  LL D+YRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLRGKAFELLRQNSSSCLLEDIYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLAIMTS  608



>ref|XP_010913868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Elaeis guineensis]
Length=617

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDY+YVLGH+CYHILAA LNGY+AT+ NLK+PVNKWRCGAAP+TAMMTV+RY  GP +  
Sbjct  442  CDYSYVLGHICYHILAADLNGYMATVTNLKHPVNKWRCGAAPLTAMMTVKRYSRGPGSIP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA+VDL+GK YELLRQ A  FL+ D+YRNPGPLQFDG GADAK   L VEDQD
Sbjct  502  IGKPAIHPASVDLKGKVYELLRQKAPSFLMDDLYRNPGPLQFDGSGADAKTYTLSVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYLDKVR+IVKPGCSQDVLKAALS+MASVT++LSVM+ 
Sbjct  562  YMGRIKKLQEYLDKVRSIVKPGCSQDVLKAALSSMASVTDVLSVMTT  608



>ref|XP_009106323.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Brassica rapa]
Length=617

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLN Y+AT+ NLK+PVNKW+CGAAP+TAMMTV+R+     + S
Sbjct  442  CDYAYVLGHICYHILAAGLNCYMATVTNLKSPVNKWKCGAAPMTAMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA+HPATVDL+GKAYELLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPAIHPATVDLKGKAYELLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRT+VKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTLVKPGCSQDVLKAALSVMASVTDVL  603



>emb|CDX88295.1| BnaC06g37390D [Brassica napus]
Length=617

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAP+TAMMTV+R+     + S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPMTAMMTVKRWSQNCGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+PA+HPATVDL+GKAYELLRQN  KFL+ D+YRNPGP+Q+DGPGAD KA+ LCVEDQD
Sbjct  502  IGRPAIHPATVDLKGKAYELLRQNEQKFLMEDMYRNPGPVQYDGPGADVKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRT+VKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTLVKPGCSQDVLKAALSVMASVTDVL  603



>ref|NP_001131947.1| uncharacterized protein LOC100193340 [Zea mays]
 gb|ACG24291.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=618

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLN Y+AT+ NLKNPVNKWRCGA PI++MMTV+R+  GP+A  
Sbjct  442  CDYAYVLGHVCYHIIAAGLNSYMATVTNLKNPVNKWRCGATPISSMMTVKRWSRGPSATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAY++LRQN++ FLL DVYRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            YMGRIK+LQEYL+KV+ IVKPGCSQDVLKAALSAM+SVT  L++M++   
Sbjct  562  YMGRIKKLQEYLEKVKRIVKPGCSQDVLKAALSAMSSVTETLNIMTSSST  611



>gb|EPS71673.1| hypothetical protein M569_03082, partial [Genlisea aurea]
Length=608

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 5/169 (3%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+  HI+AAGLNGY+AT+ NLKNPVNKWRCGAAPITAMMTV+RYG      S
Sbjct  443  CDYAYVLGHIASHIIAAGLNGYMATVTNLKNPVNKWRCGAAPITAMMTVKRYGR-----S  497

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
            F KPALHPA VDL+GKAYELLRQ+A+KFL+ D+YRNPGPLQFDGPGADA+ + L VEDQD
Sbjct  498  FAKPALHPANVDLKGKAYELLRQSASKFLVDDLYRNPGPLQFDGPGADARPITLNVEDQD  557

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGG  225
            YMGRIK LQEYLD+VR+IVKPGCSQDVLKAALSAM+SVT+IL+VM++  
Sbjct  558  YMGRIKRLQEYLDQVRSIVKPGCSQDVLKAALSAMSSVTDILTVMASSS  606



>gb|AFW73096.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 1 [Zea mays]
 gb|AFW73097.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 2 [Zea mays]
Length=618

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLN Y+AT+ NLKNPVNKWRCGA PI++MMTV+R+  GP+A  
Sbjct  442  CDYAYVLGHVCYHIIAAGLNSYMATVTNLKNPVNKWRCGATPISSMMTVKRWSRGPSATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAY++LRQN++ FLL DVYRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            YMGRIK+LQEYL+KV+ IVKPGCSQDVLKAALSAM+SVT  L++M++   
Sbjct  562  YMGRIKKLQEYLEKVKRIVKPGCSQDVLKAALSAMSSVTETLNIMTSSST  611



>ref|NP_001047918.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAD07793.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
alpha chain [Oryza sativa Japonica Group]
 dbj|BAF09832.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAG91865.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73886.1| hypothetical protein OsI_08678 [Oryza sativa Indica Group]
 gb|EEE57680.1| hypothetical protein OsJ_08132 [Oryza sativa Japonica Group]
Length=617

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+P NKWRCGAAPI++MMTV+R+  GPAA  
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPANKWRCGAAPISSMMTVKRWSRGPAATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H ATVDL+GKA+ELLR N+T FL+ D+YRNPGPLQF+G GAD+K + LCVEDQD
Sbjct  502  IGKPAVHMATVDLKGKAFELLRNNSTSFLIDDIYRNPGPLQFEGAGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLAIMTS  608



>ref|XP_010498548.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Camelina sativa]
Length=614

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 153/171 (89%), Gaps = 2/171 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAAD-  555
            CDYAYVLGH+CYH+LAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    ++  
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKHWSQNASSTL  501

Query  554  -SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGG  225
            QDYMGRIK+LQEYLD+VR IVKPGCSQDVLKAALS MASVT++L+ +S+ G
Sbjct  562  QDYMGRIKKLQEYLDQVRKIVKPGCSQDVLKAALSVMASVTDVLTTISSTG  612



>ref|XP_010459789.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=614

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 153/171 (89%), Gaps = 2/171 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAAD-  555
            CDYAYVLGH+CYH+LAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    ++  
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKHWSQNASSTL  501

Query  554  -SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGG  225
            QDYMGRIK+LQEYLD+VR IVKPGCSQDVLKAALS MASVT++L+ +S+ G
Sbjct  562  QDYMGRIKKLQEYLDQVRKIVKPGCSQDVLKAALSVMASVTDVLTTISSTG  612



>ref|NP_173519.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
 sp|Q9SYP2.1|PFPA1_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1; Short=PFP 1; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 1; AltName: Full=PPi-PFK 
1; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
1 [Arabidopsis thaliana]
 gb|AAD30596.1|AC007369_6 pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAL24337.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAP37733.1| At1g20950 [Arabidopsis thaliana]
 gb|AEE30045.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
Length=614

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 152/171 (89%), Gaps = 2/171 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPA--A  558
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGA PITAMMTV+ +    +   
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGATPITAMMTVKHWSQDASYTL  501

Query  557  DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGG  225
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+ +S+ G
Sbjct  562  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSNG  612



>ref|XP_002889091.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65350.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
Length=617

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPI AMMTV+R+     + S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPILAMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HPA+VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGKPVIHPASVDLKGKAYDLLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMG+IK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGKIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVL  603



>ref|NP_177781.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|Q9C9K3.1|PFPA2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AAG51940.1|AC015450_1 putative pyrophosphate-dependent phosphofructokinase alpha subunit; 
63231-59202 [Arabidopsis thaliana]
 gb|AEE35858.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=617

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPI+AMMTV+R+     + +
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPISAMMTVKRWSQNSGSTT  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA+VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPASVDLKGKAYDLLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMG+IK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGKIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVL  603



>gb|EMS55626.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
Length=451

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLNGY+AT+ NLK+PV++W+CGAAPIT+MMTVR +  GP A  
Sbjct  276  CDYAYVLGHVCYHIIAAGLNGYMATVTNLKSPVDQWKCGAAPITSMMTVRGWSRGPTASQ  335

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELLRQN++  L+ D+Y+NPGPLQF+GPGADAK + LCVED+D
Sbjct  336  IGKPAVHMASVDLKGKAYELLRQNSSSLLMEDIYKNPGPLQFEGPGADAKPISLCVEDRD  395

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV+ IVKPGCSQDVLKAALS+MA VT +L++MS+
Sbjct  396  YMGRIKQLQEYLEKVKNIVKPGCSQDVLKAALSSMAHVTELLTIMSS  442



>dbj|BAF01310.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Arabidopsis thaliana]
Length=617

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPI+AMMTV+R+     + +
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPISAMMTVKRWSQNSGSTT  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA+VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPASVDLKGKAYDLLRQNAQKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMG+IK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L
Sbjct  562  YMGKIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVL  603



>ref|XP_006306984.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
 gb|EOA39882.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
Length=639

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 153/171 (89%), Gaps = 2/171 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAAD-  555
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    ++  
Sbjct  467  CDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKHWSQNASSTL  526

Query  554  -SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  527  TSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  586

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGG  225
            QDYMGRIK+LQEYLD+VR IVKPGCSQDVLKAALS MASVT++L+ +S+ G
Sbjct  587  QDYMGRIKKLQEYLDQVRKIVKPGCSQDVLKAALSVMASVTDVLTTISSTG  637



>ref|XP_006302013.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
 gb|EOA34911.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
Length=617

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPIT MMTV+R+     + S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATITNLKSPVNKWKCGAAPITTMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA VDL+GKAYELLRQNA +F++ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPAAVDLKGKAYELLRQNAQRFMMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS M+SVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMSSVTDVL  603



>ref|XP_002300615.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE79888.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT++NLKNP NKWRCGAAPITAMMTV+ +   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVSNLKNPSNKWRCGAAPITAMMTVKHWAQSPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLR NA +FL+ D+YRNPGPLQFDGPGAD+KA+ L VED D
Sbjct  502  IGKPAIHPATVDLKGKAYELLRVNAGRFLMEDLYRNPGPLQFDGPGADSKAVSLSVEDAD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLDKVR IVKPGCSQDVLKAALS M+SVT +L
Sbjct  562  YMGRIKKLQEYLDKVRNIVKPGCSQDVLKAALSVMSSVTEVL  603



>ref|XP_006386123.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
 gb|ERP63920.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
Length=618

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT++NLKNP NKWRCGAAPITAMMTV+ +   P A S
Sbjct  443  CDYAYVLGHICYHILAAGLNGYMATVSNLKNPSNKWRCGAAPITAMMTVKHWAQSPGASS  502

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLR NA +FL+ D+YRNPGPLQFDGPGAD+KA+ L VED D
Sbjct  503  IGKPAIHPATVDLKGKAYELLRVNAGRFLMEDLYRNPGPLQFDGPGADSKAVSLSVEDAD  562

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLDKVR IVKPGCSQDVLKAALS M+SVT +L
Sbjct  563  YMGRIKKLQEYLDKVRNIVKPGCSQDVLKAALSVMSSVTEVL  604



>ref|XP_011034779.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Populus euphratica]
Length=617

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPITAMMTV+ +   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPSNKWRCGAAPITAMMTVKHWAQSPGASS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELLR NA +FL+ D+YRNPGPLQFDGPGAD+KA+ L VED D
Sbjct  502  IGKPAIHPATVDLKGKAYELLRVNAGRFLMEDLYRNPGPLQFDGPGADSKAVSLSVEDAD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLDKVR IVKPGCSQDVLKAALS M+SVT +L
Sbjct  562  YMGRIKKLQEYLDKVRNIVKPGCSQDVLKAALSVMSSVTEVL  603



>ref|XP_009414937.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415019.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=617

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT  NLK+PVNKWRCGAAP+TAMMTV+RY  GP A  
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATATNLKHPVNKWRCGAAPLTAMMTVKRYSRGPGAVP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+TVDL+GK YELLRQ A  FL+ D+YRNPGPLQF+GPGADAK   L +EDQD
Sbjct  502  VGKPAIHPSTVDLKGKVYELLRQKAPSFLMDDLYRNPGPLQFEGPGADAKTYTLAIEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGR+K+LQEYLDKV++IVKPGCSQ+V+KAALS+MASVT +LSVM+ 
Sbjct  562  YMGRMKKLQEYLDKVKSIVKPGCSQEVVKAALSSMASVTEVLSVMTT  608



>ref|XP_006416345.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
 gb|ESQ34698.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
Length=619

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGH--GPAA  558
            CD AYVLGH+CYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    G  +
Sbjct  442  CDCAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKHWSQNGGSTS  501

Query  557  DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSTGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            QDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++LS +S
Sbjct  562  QDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLSTIS  609



>ref|XP_006648988.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=617

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKWRCGAAPI++MMTV+R+  GPAA  
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWRCGAAPISSMMTVKRWSRGPAATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H ATVDL+GKA+ELLR +++ FL+ D+YRNPGPLQF+G GAD K + LCVEDQD
Sbjct  502  IGKPAVHMATVDLKGKAFELLRNSSSSFLMDDIYRNPGPLQFEGAGADTKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  562  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLAIMTS  608



>ref|XP_010428720.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPI+AMMTV+R+     + S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPISAMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPAAVDLKGKAYDLLRQNAHKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRTIV+PGCSQDVLKAALS M+SVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTIVRPGCSQDVLKAALSVMSSVTDVL  603



>ref|XP_008659507.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Zea mays]
Length=622

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDY YVLGHVCYHI+AAGLNGY+AT+ NLK+PVNKW+CGAAPIT+MMTV+R+  G A   
Sbjct  447  CDYGYVLGHVCYHIVAAGLNGYMATVTNLKSPVNKWKCGAAPITSMMTVKRWSRGAATSQ  506

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELLRQN++ F++ D+YRNPGPLQF+G GAD K + LCVEDQD
Sbjct  507  IGKPAVHMASVDLKGKAYELLRQNSSSFMMEDIYRNPGPLQFEGSGADTKPISLCVEDQD  566

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAA+SAMASVT +L++MS+
Sbjct  567  YMGRIKKLQEYLEKVKSIVKPGCSQDVLKAAVSAMASVTEMLTIMSS  613



>ref|XP_010471809.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PVNKW+CGAAPI+ MMTV+R+     + S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCGAAPISTMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPAAVDLKGKAYDLLRQNAHKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRTIV+PGCSQDVLKAALS M+SVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTIVRPGCSQDVLKAALSVMSSVTDVL  603



>ref|XP_010416575.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Camelina sativa]
Length=617

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK PVNKW+CGAAPI+AMMTV+R+     + S
Sbjct  442  CDYAYVLGHVCYHILAAGLNGYMATVTNLKCPVNKWKCGAAPISAMMTVKRWSQNSGSTS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGP+Q+DGPGADAKA+ LCVEDQD
Sbjct  502  IGRPVIHPAAVDLKGKAYDLLRQNAHKFLMEDMYRNPGPVQYDGPGADAKAVSLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNIL  246
            YMGRIK+LQEYLD+VRTIV+PGCSQDVLKAALS M+SVT++L
Sbjct  562  YMGRIKKLQEYLDQVRTIVRPGCSQDVLKAALSVMSSVTDVL  603



>ref|XP_002893141.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69400.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 2/171 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPA--A  558
            CDYAYVLGH+CYH LAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMM+V+ +    +   
Sbjct  442  CDYAYVLGHICYHALAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMSVKHWSQDASYTL  501

Query  557  DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             S G+PA+HPA VDL+GKAY+LLRQNA KFL+ D+YRNPGPLQ+DGPGADAKA+ LCVED
Sbjct  502  TSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVED  561

Query  377  QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGG  225
            QDYMGRIK+LQEYLD+VR IVKPGCSQDVLKAALS MASVT++L+ +S+ G
Sbjct  562  QDYMGRIKKLQEYLDQVRKIVKPGCSQDVLKAALSVMASVTDVLTTISSTG  612



>gb|EMT11806.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=558

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK+PV++W+CGAAPIT+MMTVR +  GP A  
Sbjct  383  CDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVDQWKCGAAPITSMMTVRGWSRGPTASQ  442

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELLRQN++  L+ D+Y+NPGPLQF GPGAD K + LCVED+D
Sbjct  443  IGKPAVHIASVDLKGKAYELLRQNSSSLLMEDIYKNPGPLQFQGPGADLKPISLCVEDRD  502

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV+ IVKPGCSQDVLKAALS+MA VT +L++MS+
Sbjct  503  YMGRIKQLQEYLEKVKNIVKPGCSQDVLKAALSSMAHVTELLTIMSS  549



>gb|ACN26363.1| unknown [Zea mays]
Length=616

 Score =   276 bits (706),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLN Y+AT+ NLKNPVNKWRCGA PI++MMTV+R+  GP+A  
Sbjct  442  CDYAYVLGHVCYHIIAAGLNSYMATVTNLKNPVNKWRCGATPISSMMTVKRWSRGPSATQ  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAY++LRQN++ FLL DVYRNPGPLQF+GPGAD+K + LCVEDQD
Sbjct  502  IGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGPLQFEGPGADSKPISLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            YMGRIK+LQEYL+K   IVKPGCSQDVLKAALSAM+SVT  L++M++   
Sbjct  562  YMGRIKKLQEYLEK--RIVKPGCSQDVLKAALSAMSSVTETLNIMTSSST  609



>gb|EMS68198.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
 gb|EMT25737.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=581

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  716  VLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFGKPA  537
            VLGHVCYHILAAGLNGY+AT+ NLK+P+NKWRCGAAPI++MMTV+R+  GPA    GKPA
Sbjct  412  VLGHVCYHILAAGLNGYMATVTNLKSPLNKWRCGAAPISSMMTVKRWSRGPATTQIGKPA  471

Query  536  LHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQDYMGRI  357
            +H A+VDLRGKAYE+LRQN++  LL D+YRNPGPLQF+GPGADAK + LCVEDQDYMGRI
Sbjct  472  VHMASVDLRGKAYEMLRQNSSSCLLEDIYRNPGPLQFEGPGADAKPISLCVEDQDYMGRI  531

Query  356  KELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            K+LQEYL+KV++IVKPGCSQDVLKAALSAM+SVT  L++M++
Sbjct  532  KKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVTETLAIMTS  573



>ref|XP_003563894.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=626

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLKN + +W+CGAAPIT+MMTV+ +  GPAA  
Sbjct  450  CDYAYVLGHVCYHILAAGLNGYMATVTNLKNHLVRWKCGAAPITSMMTVKGWSRGPAATQ  509

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELLRQN++ FL+ D+Y+NPGPLQF+GPGA+AK + LCVED+D
Sbjct  510  IGKPAVHMASVDLKGKAYELLRQNSSSFLMEDIYKNPGPLQFEGPGAEAKPISLCVEDRD  569

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV+ IVKPGCSQDVLKAALSAMA V  +L++MS+
Sbjct  570  YMGRIKQLQEYLEKVKCIVKPGCSQDVLKAALSAMAHVIELLTIMSS  616



>gb|AEZ53899.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant, partial [Zea mays]
 gb|AEZ53900.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant [Zea mays]
Length=587

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            D   VLGHVCYHI+AAGLNGY+AT+ NLK+PVNKW+CGAAPIT+MMTV+R+  G A    
Sbjct  413  DKRLVLGHVCYHIVAAGLNGYMATVTNLKSPVNKWKCGAAPITSMMTVKRWSRGAATSQI  472

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQDY  369
            GKPA+H A+VDL+GKAYELLRQN++ F++ D+YRNPGPLQF+G GAD K + LCVEDQDY
Sbjct  473  GKPAVHMASVDLKGKAYELLRQNSSSFMMEDIYRNPGPLQFEGSGADTKPISLCVEDQDY  532

Query  368  MGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            MGRIK+LQEYL+KV++IVKPGCSQDVLKAA+SAMASVT +L++MS+
Sbjct  533  MGRIKKLQEYLEKVKSIVKPGCSQDVLKAAVSAMASVTEMLTIMSS  578



>gb|ABR17718.1| unknown [Picea sitchensis]
Length=351

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LGH+ YH++ AGLNGY+AT+ NLK PV++W+CG APITAMMTV+R+  G  A  
Sbjct  178  CDYAYALGHIAYHLIGAGLNGYMATVTNLKKPVSQWQCGGAPITAMMTVKRWLRGRRASQ  237

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDL+G+ Y+LL +NAT+FL+ D+YRNPGPLQF+GPGA+AK + L VEDQD
Sbjct  238  IGKPAVHPANVDLKGRPYQLLMRNATRFLMDDIYRNPGPLQFEGPGANAKTITLSVEDQD  297

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+GRI++L+ YLDKVR IVKPGC+++VLKAALSAMASV+++L+VMS
Sbjct  298  YIGRIQQLRSYLDKVRDIVKPGCAEEVLKAALSAMASVSDVLTVMS  343



>ref|XP_010275338.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=562

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHV YH+LAAG+NGY+AT+ NLK+PV KW CG AP+TAMMTV+R   GP A S
Sbjct  389  CDYAYVLGHVSYHLLAAGVNGYMATVTNLKDPVCKWSCGGAPLTAMMTVKR-SQGPGASS  447

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPA VDLRGK Y+ L  N  K L+ D+YRNPGP+QF+GPG+D+K + LC+EDQD
Sbjct  448  IGKPAIHPAPVDLRGKPYQTLVFNGEKLLMDDLYRNPGPIQFEGPGSDSKTITLCIEDQD  507

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            YMGRIKELQ Y+D V+ +VKPGCSQDVLKAA+S+MASV NILS+MS
Sbjct  508  YMGRIKELQTYIDMVKKLVKPGCSQDVLKAAVSSMASVVNILSLMS  553



>dbj|BAK04583.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHILAAGLNGY+AT+ NLK  V +W+CGAAPIT+MMTV  +  GPAA  
Sbjct  447  CDYAYVLGHVCYHILAAGLNGYMATVTNLKCHVEQWKCGAAPITSMMTVTGWSRGPAASQ  506

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A+VDL+GKAYELL QN++  L+ D+Y+NPGPLQF GPGADAK + LCVED+D
Sbjct  507  IGKPAVHMASVDLKGKAYELLSQNSSSLLMEDIYKNPGPLQFQGPGADAKPISLCVEDRD  566

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMGRIK+LQEYL+KV++IVKPGCSQDVLKAALSAMA VT +L++MS+
Sbjct  567  YMGRIKQLQEYLEKVKSIVKPGCSQDVLKAALSAMAHVTELLTIMSS  613



>ref|XP_006837413.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
 gb|ERN00267.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
Length=589

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYH+LAAG+NGY+AT+ NLK PV+KW CG AP+TAMMTV+R  H P + S
Sbjct  418  CDYAYVLGHICYHLLAAGVNGYMATVTNLKQPVSKWCCGGAPMTAMMTVKRCLHFPGSSS  477

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP+++ A VDL+GK Y +L  +A KFL+ D+YRNPGPLQF+GPG+DAKA+ LC+ED D
Sbjct  478  IGKPSINHAAVDLKGKPYAMLMCSAEKFLMEDLYRNPGPLQFEGPGSDAKAISLCIEDLD  537

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNT  219
            YMGRIK+LQ+ LDKVR +VKPGCSQ+VLKAALS+MASVT ILS++S  G T
Sbjct  538  YMGRIKKLQDSLDKVRRMVKPGCSQEVLKAALSSMASVTEILSLISIRGPT  588



>gb|KJB29716.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=586

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAP+ AMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKNPVNKWRCGAAPLPAMMTVKRWSQNPNAAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYE+LRQNA +FLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYEMLRQNAARFLLDDIYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKP  309
            YMGRIK+LQEYLDKVR  + P
Sbjct  562  YMGRIKKLQEYLDKVRDFLLP  582



>dbj|BAJ85819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+  H++AAGL GY+AT+ NLK+PV KWRC AAP+TAMM+VRR+  GP A  
Sbjct  420  CDYAYVLGHISLHMIAAGLTGYMATVANLKDPVYKWRCAAAPLTAMMSVRRHLRGPGAIP  479

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +EDQD
Sbjct  480  IGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIEDQD  539

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMG I+ L+ YLDKV+TIVKPGCS+D LKAA+S+M SVT++L+VMS+  NT  
Sbjct  540  YMGDIEMLKLYLDKVKTIVKPGCSRDTLKAAISSMISVTHVLTVMSHPLNTEL  592



>gb|KJB29715.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=589

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAP+ AMMTV+R+   P A S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATITNLKNPVNKWRCGAAPLPAMMTVKRWSQNPNAAS  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYE+LRQNA +FLL D+YRNPGPLQFDGPGADAKA+ LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYEMLRQNAARFLLDDIYRNPGPLQFDGPGADAKAVTLCVEDQD  561

Query  371  YMGRIKELQEYLDKV  327
            YMGRIK+LQEYLDK+
Sbjct  562  YMGRIKKLQEYLDKL  576



>dbj|BAJ94879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+  H++AAGL GY+AT+ NLK+PV KWRC AAP+TAMM+VRR+  GP A  
Sbjct  444  CDYAYVLGHISLHMIAAGLTGYMATVANLKDPVYKWRCAAAPLTAMMSVRRHLRGPGAIP  503

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +EDQD
Sbjct  504  IGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIEDQD  563

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMG I+ L+ YLDKV+TIVKPGCS+D LKAA+S+M SVT++L+VMS+  NT  
Sbjct  564  YMGDIEMLKLYLDKVKTIVKPGCSRDTLKAAISSMISVTHVLTVMSHPLNTEL  616



>ref|XP_010935015.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Elaeis guineensis]
Length=543

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+ LGH  YH+LAAGLNGY+AT+ NLKN V KWRCG AP TAMMTVRR   GP +  
Sbjct  365  CDYAHALGHASYHLLAAGLNGYMATVTNLKNDVYKWRCGGAPFTAMMTVRRLLRGPGSSL  424

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP++HP  VDL+GK YELL ++A KFL+ D+Y NPGP+Q+ G G+D K + L VEDQD
Sbjct  425  IGKPSIHPVAVDLKGKPYELLLRDAEKFLMDDLYSNPGPIQYIGSGSDNKTICLSVEDQD  484

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF*ARADY  195
            YMGR+ ELQ YL+KVRT+VKPGCSQ+VLKAALS+MASV  IL++MS    ++      Y
Sbjct  485  YMGRVTELQAYLEKVRTMVKPGCSQEVLKAALSSMASVLEILTLMSPAAKSSITGHVKY  543



>ref|XP_002970269.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
 gb|EFJ28399.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
Length=616

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C YA  LGH+ +H+ +AGLNGY+AT+ NLK  V++WRCG APITAMM+V+R+  GP    
Sbjct  441  CTYANALGHIAFHLASAGLNGYMATVTNLKESVDQWRCGGAPITAMMSVKRWQRGPGVSQ  500

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A VDL+GK YELL QNA+  L+ D+YRNPGPLQFDGPGAD K + L VED+D
Sbjct  501  IGKPAVHSARVDLKGKPYELLSQNASALLMDDLYRNPGPLQFDGPGADLKTITLSVEDRD  560

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            Y+GRI+EL+ YLDKV+ I+KPGC +++LKAALS+MASVT +LSVMS+ G  N 
Sbjct  561  YIGRIQELRSYLDKVKDIIKPGCPEEILKAALSSMASVTEVLSVMSSPGYRNL  613



>ref|XP_002978426.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
 gb|EFJ20412.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
Length=616

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C YA  LGH+ +H+ +AGLNGY+AT+ NLK  V++WRCG APITAMM+V+R+  GP    
Sbjct  441  CTYANALGHIAFHLASAGLNGYMATVTNLKESVDQWRCGGAPITAMMSVKRWQRGPGVSQ  500

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H A VDL+GK YELL QNA+  L+ D+YRNPGPLQFDGPGAD K + L VED+D
Sbjct  501  IGKPAVHSARVDLKGKPYELLSQNASALLMDDLYRNPGPLQFDGPGADLKTITLSVEDRD  560

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            Y+GRI+EL+ YLDKV+ I+KPGC +++LKAALS+MASVT +LSVMS+ G  N 
Sbjct  561  YIGRIQELRSYLDKVKDIIKPGCPEEILKAALSSMASVTEVLSVMSSPGYRNL  613



>gb|KCW68155.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=575

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPITAMMTV+R+   P +  
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPQNKWRCGAAPITAMMTVKRWAQNPNSSF  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELL+QNA KFLL D+YRNPGPLQFDGPGADAK + LCVEDQD
Sbjct  502  IGKPAIHPATVDLKGKAYELLQQNAVKFLLDDLYRNPGPLQFDGPGADAKPVTLCVEDQD  561

Query  371  YMGRIKELQEYLDK  330
            YMGRIK LQEYLDK
Sbjct  562  YMGRIKLLQEYLDK  575



>gb|KCW68156.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=599

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPITAMMTV+R+   P +  
Sbjct  466  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPQNKWRCGAAPITAMMTVKRWAQNPNSSF  525

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HPATVDL+GKAYELL+QNA KFLL D+YRNPGPLQFDGPGADAK + LCVEDQD
Sbjct  526  IGKPAIHPATVDLKGKAYELLQQNAVKFLLDDLYRNPGPLQFDGPGADAKPVTLCVEDQD  585

Query  371  YMGRIKELQEYLDK  330
            YMGRIK LQEYLDK
Sbjct  586  YMGRIKLLQEYLDK  599



>ref|XP_009385723.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LGH  YH+LAAGLNGY+AT+ NLKN V++WRCG AP+TAMMT+RR   G     
Sbjct  440  CDYAYALGHGAYHLLAAGLNGYIATVTNLKNDVSRWRCGGAPLTAMMTIRRLLRGLGTPL  499

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP++HP  VDL+GK+Y LL QNA K+L+ D+Y NPGP+Q+ GPG+D+K + LCVED D
Sbjct  500  IGKPSIHPVGVDLKGKSYGLLVQNAEKYLMDDLYSNPGPIQYKGPGSDSKTICLCVEDHD  559

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGN  222
            YMGR+K+LQ YLDKV+T V+PGCSQ+VLKAA+SAMA V  ILS+MS  G 
Sbjct  560  YMGRLKKLQSYLDKVKTSVRPGCSQEVLKAAVSAMAYVVEILSLMSPAGT  609



>ref|XP_003573791.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=617

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LGH+  HI+AAGL GY+AT+ NLK+ V+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  439  CDYAYALGHISLHIIAAGLTGYMATVANLKDSVDKWRCAAAPLTAMMSVKRHLRGPGAIP  498

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+ +DL+GKAYELLR+ A+ FLL D YR PG +Q++GPG+DAK + L +EDQD
Sbjct  499  VGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQYEGPGSDAKPITLTIEDQD  558

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            Y+G I+ L++YLDKV+ IVKPGCS+D+LKAA+S+M SVT++L+VMS+
Sbjct  559  YIGDIEILKQYLDKVKVIVKPGCSRDILKAAISSMVSVTDVLTVMSH  605



>ref|XP_002444175.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
 gb|EES13670.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
Length=582

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG +  H++  GL GY+A++ NLK+PV+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  404  CDYAYALGRISLHMITVGLTGYMASVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIP  463

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P++HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +E+QD
Sbjct  464  IGRPSIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIENQD  523

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            YMG I+ L+EYL KVRT+VKPGCS+++LKAA+S+M SVT++L+VMS+  NT  
Sbjct  524  YMGDIEILKEYLGKVRTMVKPGCSREILKAAISSMVSVTDVLTVMSHPLNTEL  576



>gb|ACL53065.1| unknown [Zea mays]
 gb|ACN27719.1| unknown [Zea mays]
 tpg|DAA49242.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=618

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG +  H++A GL GY+AT+ NLK+PV+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  440  CDYAYALGRISLHMIAVGLTGYMATVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIP  499

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P++HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +E+QD
Sbjct  500  IGRPSIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIENQD  559

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG I+ L+EYL KVRT+VKPGCS+++LKAA+S+M SVT++L+VMS+
Sbjct  560  YMGDIEILKEYLGKVRTMVKPGCSREILKAAISSMVSVTDVLTVMSH  606



>ref|NP_001130747.1| uncharacterized protein LOC100191851 [Zea mays]
 gb|ACF79089.1| unknown [Zea mays]
Length=618

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG +  H++A GL GY+AT+ NLK+PV+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  440  CDYAYALGRISLHMIAVGLTGYMATVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIP  499

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P++HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +E+QD
Sbjct  500  IGRPSIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIENQD  559

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG I+ L+EYL KVRT+VKPGCS+++LKAA+S+M SVT++L+VMS+
Sbjct  560  YMGDIEILKEYLGKVRTMVKPGCSREILKAAISSMVSVTDVLTVMSH  606



>gb|AGN30570.1| pyrophosphate-fructose-6-phosphate-phosphotransferase PFPA4 [Oryza 
sativa Japonica Group]
Length=627

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+C HILAAGLNGY+A   NLK P NKWRC A P+TAMM+V+R+   P A  
Sbjct  449  CDYAYVLGHICMHILAAGLNGYMAFATNLKEPTNKWRCAAVPLTAMMSVKRHSRSPGAVP  508

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HP+ VDL+GKAY LLR+ A+ FLL D YR PG +QFDG G + K + L VEDQD
Sbjct  509  TGKPVIHPSPVDLQGKAYALLREKASSFLLDDFYRTPGGIQFDGSGTNVKPITLTVEDQD  568

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+G I+ LQ+YL+KVR IVKPGCS+++LKAA+S+M+SV ++L VMS
Sbjct  569  YLGDIELLQDYLEKVRNIVKPGCSREILKAAISSMSSVKDVLKVMS  614



>dbj|BAD33224.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAD32985.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
Length=618

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+C HILAAGLNGY+A   NLK P NKWRC A P+TAMM+V+R+   P A  
Sbjct  440  CDYAYVLGHICMHILAAGLNGYMAFATNLKEPTNKWRCAAVPLTAMMSVKRHSRSPGAVP  499

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HP+ VDL+GKAY LLR+ A+ FLL D YR PG +QFDG G + K + L VEDQD
Sbjct  500  TGKPVIHPSPVDLQGKAYALLREKASSFLLDDFYRTPGGIQFDGSGTNVKPITLTVEDQD  559

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+G I+ LQ+YL+KVR IVKPGCS+++LKAA+S+M+SV ++L VMS
Sbjct  560  YLGDIELLQDYLEKVRNIVKPGCSREILKAAISSMSSVKDVLKVMS  605



>ref|XP_004973257.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=618

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG +  H++AAGL GY+AT+ NLK+PV+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  440  CDYAYALGRISLHMIAAGLTGYMATVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIP  499

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP++HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +E+QD
Sbjct  500  IGKPSIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIENQD  559

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG I+ L+E L KVRT+VKPGCS+++LKAA+S+M SVT++L+VMS+
Sbjct  560  YMGDIEILKECLSKVRTMVKPGCSREILKAAISSMLSVTDVLTVMSH  606



>ref|XP_006660512.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=620

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDY+YVLGH+C HILAAGLNGY+A   NLK P NKWRC A P+TAMM+++R+   P A  
Sbjct  442  CDYSYVLGHICMHILAAGLNGYMAFATNLKEPTNKWRCAAVPLTAMMSLKRHSRSPGAVP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HP+ VDL+GKAY +LR+ A+ FLL D YR PG +Q+DG GAD K + L VEDQD
Sbjct  502  TGKPVIHPSPVDLQGKAYAVLREKASSFLLDDFYRTPGGIQYDGSGADVKPITLTVEDQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            Y+G I+ LQ+YL+KVR IVKPGCS+++LKAA+S+M+SV ++L VMS 
Sbjct  562  YLGDIELLQDYLEKVRNIVKPGCSREILKAAISSMSSVKDVLKVMST  608



>ref|NP_001061602.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAC75438.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAF23516.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAG94900.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83431.1| hypothetical protein OsI_28900 [Oryza sativa Indica Group]
 gb|EEE68536.1| hypothetical protein OsJ_26990 [Oryza sativa Japonica Group]
Length=617

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG +  H++AAGL GY+AT+ NLK+PV+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  439  CDYAYALGRISLHMIAAGLTGYMATVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIP  498

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+ +DL+GKAYELLR+ A+ FLL D YR PG +Q++GPG +AK + L +E+QD
Sbjct  499  IGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQYEGPGCNAKPITLTIENQD  558

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG I+ L++ L KVRT+VKPGCS++VLKAA+S+M SVT++L+VMS+
Sbjct  559  YMGDIEILKDCLSKVRTMVKPGCSREVLKAAISSMLSVTDVLTVMSH  605



>ref|XP_006660071.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=631

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG +  H++AAGL GY+AT+ NLK+PV+KWRC AAP+TAMM+V+R+  GP A  
Sbjct  453  CDYAYALGRISLHMIAAGLTGYMATVANLKDPVDKWRCAAAPLTAMMSVKRHLRGPGAIP  512

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+ +DL+GKAYELLR+ A+ FLL D YR PG +Q++GPG +AK + L +E+QD
Sbjct  513  IGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQYEGPGCNAKPITLTIENQD  572

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
            YMG I+ L++ L KVRT+VKPGCS++VLKAA+S+M SVT++L+VMS+
Sbjct  573  YMGDIEILKDCLSKVRTMVKPGCSREVLKAAISSMLSVTDVLTVMSH  619



>tpg|DAA60935.1| TPA: hypothetical protein ZEAMMB73_638083 [Zea mays]
Length=509

 Score =   226 bits (577),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAYVLGH+C  I+AAGLNGY+AT+ NLK+  NKWRC A P+TAMM+VRR+  GP A  
Sbjct  331  CNYAYVLGHICVQIMAAGLNGYMATVTNLKDSTNKWRCAAVPLTAMMSVRRHLRGPGAVP  390

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HP+ +DL+ ++Y +LR+ A+ FLL D YR PG +QF+GPGA  K + + +E+QD
Sbjct  391  IGRPVIHPSPIDLKAESYAVLREKASSFLLDDFYRTPGGIQFEGPGAGTKPITVTIEEQD  450

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            Y+G I+ LQ+YLDKVRTI+KPGCS+++LKA++S++ASV ++L  MS   NT  
Sbjct  451  YLGDIEILQDYLDKVRTILKPGCSREILKASISSIASVNDVLKFMSAPLNTEL  503



>ref|XP_004956506.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Setaria italica]
Length=509

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAYVLGH+C  ILA GLNGY+AT+ NLK+  NKWRC A P+TAMM+VRR+  GP A  
Sbjct  331  CNYAYVLGHICVQILATGLNGYMATITNLKDSTNKWRCAAVPLTAMMSVRRHLRGPGAVP  390

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HP+ +DL+ ++Y +LR+ A+ FLL D YR PG +QF+GPGA+ K + L +E QD
Sbjct  391  IGRPVIHPSPIDLKAESYAVLREKASSFLLDDFYRTPGGIQFEGPGANTKPITLTIEGQD  450

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+G I+ LQ+YL+KVRTI+KPGCS+++LKAA+S+++SV ++L VMS
Sbjct  451  YLGDIEILQDYLNKVRTILKPGCSREILKAAISSLSSVNDVLKVMS  496



>ref|XP_008652527.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit alpha [Zea mays]
Length=623

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAYVLGH+C  I+AAGLNGY+AT+ NLK+  NKWRC A P+TAMM+VRR+  GP A  
Sbjct  445  CNYAYVLGHICVQIMAAGLNGYMATVTNLKDSTNKWRCAAVPLTAMMSVRRHLRGPGAVP  504

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HP+ +DL+ ++Y +LR+ A+ FLL D YR PG +QF+GPGA  K + + +E+QD
Sbjct  505  IGRPVIHPSPIDLKAESYAVLREKASSFLLDDFYRTPGGIQFEGPGAGTKPITVTIEEQD  564

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            Y+G I+ LQ+YLDKVRTI+KPGCS+++LKA++S++ASV ++L  MS   NT  
Sbjct  565  YLGDIEILQDYLDKVRTILKPGCSREILKASISSIASVNDVLKFMSAPLNTEL  617



>ref|XP_004956505.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Setaria italica]
Length=620

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAYVLGH+C  ILA GLNGY+AT+ NLK+  NKWRC A P+TAMM+VRR+  GP A  
Sbjct  442  CNYAYVLGHICVQILATGLNGYMATITNLKDSTNKWRCAAVPLTAMMSVRRHLRGPGAVP  501

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+P +HP+ +DL+ ++Y +LR+ A+ FLL D YR PG +QF+GPGA+ K + L +E QD
Sbjct  502  IGRPVIHPSPIDLKAESYAVLREKASSFLLDDFYRTPGGIQFEGPGANTKPITLTIEGQD  561

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+G I+ LQ+YL+KVRTI+KPGCS+++LKAA+S+++SV ++L VMS
Sbjct  562  YLGDIEILQDYLNKVRTILKPGCSREILKAAISSLSSVNDVLKVMS  607



>ref|XP_002459996.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
 gb|EER96517.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
Length=626

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAYVLGH+C  I+AAGLNGY+AT+ NLK+  NKWRC A P+ AMM+VRR+  GP A  
Sbjct  448  CNYAYVLGHICVQIIAAGLNGYMATVTNLKDSTNKWRCAAVPLAAMMSVRRHLRGPGAVP  507

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP +HP+ +DL+ ++Y +LR+ A+ FLL D YR PG +QF+GPGA  K + L +E+QD
Sbjct  508  IGKPVIHPSPIDLKAESYAVLREKASSFLLDDFYRTPGGIQFEGPGAGTKPITLTIEEQD  567

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNGGNTNF  213
            Y+G I+ LQ YLDKVRTI+KPGCS+++LKA++S++ASV ++L  MS   NT  
Sbjct  568  YLGDIEILQAYLDKVRTILKPGCSREILKASISSIASVNDVLKFMSAPLNTEL  620



>ref|XP_001773752.1| predicted protein [Physcomitrella patens]
 gb|EDQ61369.1| predicted protein [Physcomitrella patens]
Length=613

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAY LG   Y++  AGL GYLAT+ NLK  V++WRCG AP+TAMM+V+R+  GP    
Sbjct  438  CNYAYTLGQTAYYLAQAGLTGYLATVANLKQDVSEWRCGGAPLTAMMSVKRWLRGPGVSQ  497

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H   VDL+GK YELL Q A+ +L+ D+YRNPGP+Q+ G GAD K + L  ED D
Sbjct  498  IGKPAVHRTKVDLKGKPYELLTQKASSWLMDDLYRNPGPIQYAGAGADLKTITLLAEDND  557

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+G+++EL  YLDKV+ IVKPGC  +VLKAAL +MASVT IL+VMS
Sbjct  558  YIGKVQELCAYLDKVKEIVKPGCPGEVLKAALCSMASVTEILTVMS  603



>ref|XP_009110202.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Brassica rapa]
Length=133

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  596  MMTVRRYGH--GPAADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFD  423
            MMTV+ +    G  + S G+PA+HPA VDL+GKAYELLRQNA KFL+ D+YRNPGPLQ+D
Sbjct  1    MMTVKNWSQNAGSTSTSIGRPAIHPAMVDLKGKAYELLRQNADKFLMEDLYRNPGPLQYD  60

Query  422  GPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILS  243
            GPGADAKA+ LCVEDQDYMGRIK+LQEYLD+VRTIVKPGCSQDVLKAALS MASVT++L+
Sbjct  61   GPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLT  120

Query  242  VMSNGGN  222
             +S+  N
Sbjct  121  TISSSSN  127



>ref|XP_001755711.1| predicted protein [Physcomitrella patens]
 gb|EDQ79384.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+YAY LG   Y++  AGL GY+AT+ NLK  V++WRCG AP+TAMM+V+R+  GP    
Sbjct  443  CNYAYTLGQTAYYVAQAGLTGYMATVANLKQDVSEWRCGGAPLTAMMSVKRWLRGPGVSQ  502

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+H   VDL+GK Y LL Q+A+ +L+ D+YRNPGP+Q+ GPGAD   + L +ED D
Sbjct  503  TGKPAVHTTEVDLKGKPYGLLTQHASSWLMDDLYRNPGPIQYAGPGADLTTITLSIEDND  562

Query  371  YMGRIKELQEYLDK---VRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+G I+E   YLDK   V+ IVKPGC+ +VLKAALS+MASVT+IL+ MS
Sbjct  563  YIGEIQEFYAYLDKAMQVKEIVKPGCAGEVLKAALSSMASVTDILTAMS  611



>gb|ABL10095.1| pyrophosphate-fructose-6-phosphate1-phosphotransferase alpha 
subunit [Saccharum spontaneum]
 dbj|BAF47282.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Saccharum 
officinarum]
Length=299

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLNGY+AT+ NLK+PVNKWRCGAAPI++MMTV+R+  GP+A  
Sbjct  194  CDYAYVLGHVCYHIIAAGLNGYMATVTNLKSPVNKWRCGAAPISSMMTVKRWSRGPSATQ  253

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG  414
             GKPA+H A+VDL+GKAY++LRQN++ FLL DVYRNPGPLQFDGPG
Sbjct  254  IGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGPLQFDGPG  299



>gb|EMS49340.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
Length=794

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+  H++AAGL GY+AT+ NLK+PV+KWRC AAP+TAMM+VRR+  GP A  
Sbjct  536  CDYAYVLGHISLHMIAAGLTGYMATVANLKDPVHKWRCAAAPLTAMMSVRRHLRGPGAIP  595

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKPA+HP+ +DL+GKAYELLR+ A+ FLL D YR PG +QF+GPG+DAK + L +EDQD
Sbjct  596  IGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQFEGPGSDAKPITLTIEDQD  655

Query  371  YMGRIKELQEYLDKV  327
            YMG I+ L+ YLDK+
Sbjct  656  YMGDIEMLKLYLDKI  670



>ref|XP_010935016.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Elaeis guineensis]
Length=527

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+ LGH  YH+LAAGLNGY+AT+ NLKN V KWRCG AP TAMMTVRR   GP +  
Sbjct  365  CDYAHALGHASYHLLAAGLNGYMATVTNLKNDVYKWRCGGAPFTAMMTVRRLLRGPGSSL  424

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             GKP++HP  VDL+GK YELL ++A KFL+ D+Y NPGP+Q+ G G+D K + L VEDQD
Sbjct  425  IGKPSIHPVAVDLKGKPYELLLRDAEKFLMDDLYSNPGPIQYIGSGSDNKTICLSVEDQD  484

Query  371  YMGRIKELQEYLDK  330
            YMGR+ ELQ YL+K
Sbjct  485  YMGRVTELQAYLEK  498



>gb|EEC84297.1| hypothetical protein OsI_30782 [Oryza sativa Indica Group]
Length=581

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -3

Query  599  AMMTVRRYGHGPAADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDG  420
            AMM+V+R+   P A   GKP +HP+ VDL+GKAY LLR+ A+ FLL D YR PG +QFDG
Sbjct  447  AMMSVKRHSRSPGAVPTGKPVIHPSPVDLQGKAYALLREKASSFLLDDFYRTPGGIQFDG  506

Query  419  PGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSV  240
             G + K + L VEDQDY+G I+ LQ+YL+KVR IVKPGCS+++LKAA+S+M+SV ++L V
Sbjct  507  SGTNVKPITLTVEDQDYLGDIELLQDYLEKVRNIVKPGCSREILKAAISSMSSVKDVLKV  566

Query  239  MS  234
            MS
Sbjct  567  MS  568



>gb|EEE69397.1| hypothetical protein OsJ_28754 [Oryza sativa Japonica Group]
Length=579

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -3

Query  599  AMMTVRRYGHGPAADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDG  420
            AMM+V+R+   P A   GKP +HP+ VDL+GKAY LLR+ A+ FLL D YR PG +QFDG
Sbjct  445  AMMSVKRHSRSPGAVPTGKPVIHPSPVDLQGKAYALLREKASSFLLDDFYRTPGGIQFDG  504

Query  419  PGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSV  240
             G + K + L VEDQDY+G I+ LQ+YL+KVR IVKPGCS+++LKAA+S+M+SV ++L V
Sbjct  505  SGTNVKPITLTVEDQDYLGDIELLQDYLEKVRNIVKPGCSREILKAAISSMSSVKDVLKV  564

Query  239  MS  234
            MS
Sbjct  565  MS  566



>gb|KCW70371.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=520

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNPVNKWRCGAAPI +MMTV+R+   PAA S
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPVNKWRCGAAPIASMMTVKRWAQNPAASS  501

Query  551  FGKPALHPATVDLRGKAYE  495
             GKP +HPATVDL+GKAYE
Sbjct  502  IGKPTIHPATVDLKGKAYE  520



>gb|KCW68157.1| hypothetical protein EUGRSUZ_F018231 [Eucalyptus grandis]
Length=520

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPITAMMTV+R+   P +  
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPQNKWRCGAAPITAMMTVKRWAQNPNSSF  501

Query  551  FGKPALHPATVDLRGKAYE  495
             GKPA+HPATVDL+GKAYE
Sbjct  502  IGKPAIHPATVDLKGKAYE  520



>ref|XP_010477351.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=522

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAA--  558
            CDYAYVLGH+CYH+LAAGLNGY+AT+ NLK+PVNKW+CGAAPITAMMTV+ +    ++  
Sbjct  442  CDYAYVLGHICYHVLAAGLNGYMATVTNLKSPVNKWKCGAAPITAMMTVKHWSQNASSTL  501

Query  557  DSFGKPALHPATVDLRGKAYE  495
             S G+PA+HPA VDL+GKAYE
Sbjct  502  TSIGRPAIHPAMVDLKGKAYE  522



>ref|XP_008776682.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Phoenix dactylifera]
Length=88

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  464  LXDVYRNPGPLQFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
            + D+Y NPGP+Q+ G G+D K + L VEDQDYMGR+KELQ YL++VRTIVKPGCSQ+VLK
Sbjct  1    MDDLYSNPGPIQYIGSGSDNKTICLSVEDQDYMGRVKELQAYLEQVRTIVKPGCSQEVLK  60

Query  284  AALSAMASVTNILSVMS  234
            AALS+MASV  IL++MS
Sbjct  61   AALSSMASVLEILTLMS  77



>ref|XP_008788669.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X3 [Phoenix dactylifera]
Length=290

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+ LGHV YH+LAAG NGY+AT+ NLKN V KWRCG AP TAMMTVRR   GP +  
Sbjct  212  CDYAHALGHVSYHLLAAGFNGYMATVTNLKNDVYKWRCGGAPFTAMMTVRRLLRGPGSSL  271

Query  551  FGKPALHPATVDLRGKAYE  495
             GKP +HP  VDL+GK YE
Sbjct  272  IGKPLIHPVAVDLKGKPYE  290



>ref|XP_008788668.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Phoenix dactylifera]
Length=339

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+ LGHV YH+LAAG NGY+AT+ NLKN V KWRCG AP TAMMTVRR   GP +  
Sbjct  261  CDYAHALGHVSYHLLAAGFNGYMATVTNLKNDVYKWRCGGAPFTAMMTVRRLLRGPGSSL  320

Query  551  FGKPALHPATVDLRGKAYE  495
             GKP +HP  VDL+GK YE
Sbjct  321  IGKPLIHPVAVDLKGKPYE  339



>ref|XP_008788667.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Phoenix dactylifera]
Length=361

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYA+ LGHV YH+LAAG NGY+AT+ NLKN V KWRCG AP TAMMTVRR   GP +  
Sbjct  283  CDYAHALGHVSYHLLAAGFNGYMATVTNLKNDVYKWRCGGAPFTAMMTVRRLLRGPGSSL  342

Query  551  FGKPALHPATVDLRGKAYE  495
             GKP +HP  VDL+GK YE
Sbjct  343  IGKPLIHPVAVDLKGKPYE  361



>gb|ABR16683.1| unknown [Picea sitchensis]
Length=558

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C YA+ LG + + ++   LNGY+AT+ NL  PV+KWRCGA P TAM+TV +      A  
Sbjct  439  CSYAFTLGQLAFFLVMHSLNGYMATVTNLSQPVSKWRCGAVPFTAMLTVDKRPKDCNAVI  498

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             G+ A+H   V+L+GK   LL QNA K L+ DVY + GP+Q+ GPG+D++ + + +E +D
Sbjct  499  PGELAIHSEKVNLKGKPIRLLLQNAEKRLMDDVYISSGPIQYQGPGSDSRIMTVSIEAED  558



>gb|AEK84249.1| putative phosphofructokinase [Pinus pinaster]
Length=78

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  443  PGPLQFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMA  264
            PGPLQF+GPGA+AK + L VEDQDY+GRI+ L+ YLDKVR +VKPGC ++VLKAALSAMA
Sbjct  1    PGPLQFEGPGANAKTITLSVEDQDYIGRIQLLRSYLDKVRDMVKPGCPEEVLKAALSAMA  60

Query  263  SVTNILSVMS  234
            SV+++L+ M+
Sbjct  61   SVSDVLTTMA  70



>emb|CBJ31829.1| RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=Pyrophosphate-dependent 
6-ph [Ectocarpus siliculosus]
Length=1147

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 95/167 (57%), Gaps = 2/167 (1%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             CDYA+ LG     ++   ++GYLAT+  LK PV  W+ G  P+T+++        P    
Sbjct  981   CDYAFTLGGAVAILMHRRMSGYLATVTGLKEPVEGWKGGGVPLTSLLGADDQEKLPTGQC  1040

Query  551   FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
               +P + P  ++LRG AY  L++        D+YRNPGP+QF G  AD + + L +E  D
Sbjct  1041  --RPRVPPTPINLRGDAYLSLQKVLANGQRKDLYRNPGPVQFAGDTADNRLMSLELETDD  1098

Query  371   YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSN  231
             Y+G++ EL+  L  ++   +PGCS ++LK +   + ++T I+ + ++
Sbjct  1099  YLGQLAELRGALRGIQESCRPGCSSNILKLSTKTLQNLTEIMELQAH  1145


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 56/121 (46%), Gaps = 11/121 (9%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
            C Y Y LG+    + + G+N  +A  NNL  P+  W  G  PIT M  + RR G      
Sbjct  439  CSYCYALGYTAGALTSKGMNALMACANNLDMPIEDWTVGGVPITMMCHMERRKGK-----  493

Query  554  SFGKPALHPATVDL---RGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
               KP +  A V+L   R + ++       K++  D+YR PG +QF   GA    + L  
Sbjct  494  --DKPVIMKALVELDGPRSQPFQAFAAEREKWMEHDMYRAPGAIQFYSEGARNANMTLMY  551

Query  383  E  381
            E
Sbjct  552  E  552



>gb|AFW82614.1| hypothetical protein ZEAMMB73_948861 [Zea mays]
Length=347

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAYVLGHVCYHI+AAGLNGY+ATL NLKNPVNK RCGA PI++MMT++R+  GPA   
Sbjct  168  CDYAYVLGHVCYHIIAAGLNGYMATLTNLKNPVNKCRCGATPISSMMTMKRWSRGPATTQ  227

Query  551  FGKPAL  534
             GK  +
Sbjct  228  IGKTVV  233



>ref|XP_005854316.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase, partial 
[Nannochloropsis gaditana CCMP526]
 gb|EKU22040.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase, partial 
[Nannochloropsis gaditana CCMP526]
Length=1065

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 88/167 (53%), Gaps = 2/167 (1%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNK-WRCGAAPITAMMTVRRY-GHGPAA  558
             C+  Y +G     ++  G  GYLAT+  LK    + W+    P+TAM+       H  A 
Sbjct  895   CNLGYSMGGAAAVLVHTGRTGYLATITGLKGVEEEDWKVAGVPLTAMLAYDELEQHRLAY  954

Query  557   DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             +   +P +    VDLRG AY+ L      + + D+Y N GPLQF G  AD +   +  ED
Sbjct  955   NGQLRPRVPAKKVDLRGAAYKFLMGKRQLWGMHDMYENSGPLQFHGLTADDRPATVVEED  1014

Query  377   QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
             +DY+  ++ L   L +VR   +PGCS  +L  A  ++ ++T+++S+M
Sbjct  1015  RDYLEELEVLHAALRQVRRACRPGCSSALLHLATKSILTLTDVVSMM  1061


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            +Y Y LG    H++  GL   + ++  +  PV  W+CG  P+T MM + +  HG      
Sbjct  250  NYCYSLGLTAGHLIGNGLTSLMVSITGVCGPVEDWKCGGVPLTMMMNMEKR-HGKF----  304

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
             KP +  A V L GK +++L++   K+ + D YR PGP+QFDGP +    L L  E
Sbjct  305  -KPVIRKALVQLEGKPFKILKKRRDKWAVEDCYRAPGPIQFDGPCSQDVNLTLQYE  359



>gb|AFW80250.1| hypothetical protein ZEAMMB73_927911 [Zea mays]
Length=391

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  494  LLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQDYMGRIKELQEYLDK  330
            +LRQN++ FLL DVYRNPGPLQF+GPG D+  + LCVEDQDYMGRIK+LQEYL K
Sbjct  206  VLRQNSSSFLLEDVYRNPGPLQFEGPGVDSNPISLCVEDQDYMGRIKKLQEYLKK  260



>gb|EWM27417.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Nannochloropsis gaditana]
Length=1190

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 88/167 (53%), Gaps = 2/167 (1%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNK-WRCGAAPITAMMTVRRY-GHGPAA  558
             C+  Y +G     ++  G  GYLAT+  LK    + W+    P+TAM+       H  A 
Sbjct  1020  CNLGYSMGGAAAVLVHTGRTGYLATITGLKGVEEEDWKVAGVPLTAMLAYDELEQHRLAY  1079

Query  557   DSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             +   +P +    VDLRG AY+ L      + + D+Y N GPLQF G  AD +   +  ED
Sbjct  1080  NGQLRPRVPAKKVDLRGAAYKFLMGKRQLWGMHDMYENSGPLQFHGLTADDRPATVVEED  1139

Query  377   QDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
             +DY+  ++ L   L +VR   +PGCS  +L  A  ++ ++T+++S+M
Sbjct  1140  RDYLEELEVLHAALRQVRRACRPGCSSALLHLATKSILTLTDVVSMM  1186


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            +Y Y LG    H++  GL   + ++  +  PV  W+CG  P+T MM + +  HG      
Sbjct  375  NYCYSLGLTAGHLIGNGLTSLMVSITGVCGPVEDWKCGGVPLTMMMNMEKR-HGKF----  429

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
             KP +  A V L GK +++L++   K+ + D YR PGP+QFDGP +    L L  E
Sbjct  430  -KPVIRKALVQLEGKPFKILKKRRDKWAVEDCYRAPGPIQFDGPCSQDVNLTLQYE  484



>ref|XP_006435470.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48710.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85269.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85270.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=494

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMT  588
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPIT   +
Sbjct  442  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPANKWRCGAAPITVRFS  489



>ref|XP_006435471.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48711.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
Length=502

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMT  588
            CDYAYVLGH+CYHILAAGLNGY+AT+ NLKNP NKWRCGAAPIT   +
Sbjct  450  CDYAYVLGHICYHILAAGLNGYMATVTNLKNPANKWRCGAAPITVRFS  497



>emb|CBK25474.2| unnamed protein product [Blastocystis hominis]
Length=529

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 84/166 (51%), Gaps = 6/166 (4%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG     ++   L GY+ATL NLK   ++W   A P+ A  TV       A   
Sbjct  366  CDYAYALGREAAALIQNNLTGYMATLRNLKEEPSEWIPYAVPLLAFCTVE------AKQG  419

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
              +P++  + VD+    +     +   + + D Y NPG +QF G G+    L L +E  D
Sbjct  420  VYRPSIPESNVDMNDIPFLKFVAHRDSWAVKDDYCNPGSVQFGGAGSWNTTLSLQIEKHD  479

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            Y+ RI+ L++ L  V  I  PGC   ++ +A++ +  V   L++MS
Sbjct  480  YLKRIQLLRDELKAVEKICLPGCDPLLVDSAIAGVEGVIEQLNIMS  525



>emb|CBK21183.2| unnamed protein product [Blastocystis hominis]
 emb|CBK23261.2| unnamed protein product [Blastocystis hominis]
Length=606

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 82/165 (50%), Gaps = 6/165 (4%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            CDYAY LG     ++   L GY+ATL NLK   ++W   A P+ A  TV       A   
Sbjct  444  CDYAYALGREAAALIQNNLTGYMATLRNLKEEPSEWIPYAVPLLAFCTVE------AKQG  497

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
              +P++  + VD+    +     +   + + D Y NPG +QF G G+    L L +E  D
Sbjct  498  VYRPSIPESNVDMNDAPFLKFVAHRDSWAVKDDYCNPGSVQFGGAGSWNTTLSLQIEKHD  557

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVM  237
            Y+ RI+ L++ L  V  I  PGC   ++ +A++ +  V   L ++
Sbjct  558  YLKRIQLLRDELKAVEKICLPGCDALLVDSAIAGVEGVIEQLEII  602



>gb|ETW36820.1| hypothetical protein PFTANZ_02488 [Plasmodium falciparum Tanzania 
(2000708)]
Length=249

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
            C  AY  GH    ++ +GL GY+ ++  L   V  W+  A P  ++M +   G G     
Sbjct  54   CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILPKGQGSKYLK  113

Query  563  AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
            +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  114  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  173

Query  383  EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
            E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  174  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  206



>gb|AAL74381.1|AF359113_1 putative phosphofructokinase [Pinus sylvestris]
 gb|AAL74382.1|AF359114_1 putative phosphofructokinase [Pinus sylvestris]
 gb|AIF75960.1| putative phosphofructokinase, partial [Pinus massoniana]
 gb|AIF75961.1| putative phosphofructokinase, partial [Pinus hwangshanensis]
 gb|AIF75962.1| putative phosphofructokinase, partial [Pinus hwangshanensis]
 gb|AIF75963.1| putative phosphofructokinase, partial [Pinus hwangshanensis]
 gb|AIF75964.1| putative phosphofructokinase, partial [Pinus hwangshanensis]
Length=61

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  392  LCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            L VEDQDY+GRI+ L+ YLDKVR +VKPGC ++VLKAALSAMASV+++L+ M+
Sbjct  1    LSVEDQDYIGRIQLLRSYLDKVRDMVKPGCPEEVLKAALSAMASVSDVLTTMA  53



>emb|CBI38094.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  431  QFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTN  252
            QF+   +  KA+ L V+DQDY G+IKELQ YLDKV  IVKPGCS +VLK AL++++S+ N
Sbjct  13   QFERSDSAEKAIELLVQDQDYTGKIKELQAYLDKVNEIVKPGCSPEVLKVALNSISSLVN  72

Query  251  ILSVMSNG  228
             LS +S+ 
Sbjct  73   FLSHISSS  80



>gb|AIF75956.1| putative phosphofructokinase, partial [Pinus massoniana]
 gb|AIF75957.1| putative phosphofructokinase, partial [Pinus massoniana]
 gb|AIF75958.1| putative phosphofructokinase, partial [Pinus massoniana]
 gb|AIF75959.1| putative phosphofructokinase, partial [Pinus massoniana]
 gb|AIF75965.1| putative phosphofructokinase, partial [Pinus hwangshanensis]
Length=61

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  392  LCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMS  234
            L VEDQDY+GRI+ L+ YLDKVR +VKPGC ++VLKAALSAMASV+++L+ M+
Sbjct  1    LSVEDQDYIGRIQLLRSYLDKVRDMVKPGCPEEVLKAALSAMASVSDVLTTMA  53



>ref|XP_676653.1| 6-phosphofructokinase [Plasmodium berghei strain ANKA]
 emb|CAH94255.1| 6-phosphofructokinase, putative [Plasmodium berghei]
Length=1252

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   VN W+  A P  ++M +   G G     
Sbjct  1057  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVNDWKLFAIPFISLMKILLRGQGSKSLK  1116

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D   NPGP+QF+G  ++  +  L  
Sbjct  1117  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPGPIQFEGNASNYYSRTLFE  1176

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1177  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1209


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NLKN    W     P   +M V         D+
Sbjct  444  CNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHV-------CKDN  496

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
            FGK  PA+    VDL    + +L Q    + L D+YR+PGP+QF+G  ++++   + + +
Sbjct  497  FGKEYPAVKKYLVDLNSPLFNVLTQVRKLWSLYDLYRSPGPIQFNGYLSNSRCYTVKIPE  556

Query  377  QD  372
            +D
Sbjct  557  KD  558



>emb|CDS46264.1| 6-phosphofructokinase, putative [Plasmodium berghei ANKA]
Length=1299

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   VN W+  A P  ++M +   G G     
Sbjct  1104  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVNDWKLFAIPFISLMKILLRGQGSKSLK  1163

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D   NPGP+QF+G  ++  +  L  
Sbjct  1164  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPGPIQFEGNASNYYSRTLFE  1223

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1224  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1256


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NLKN    W     P   +M V         D+
Sbjct  491  CNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHV-------CKDN  543

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
            FGK  PA+    VDL    + +L Q    + L D+YR+PGP+QF+G  ++++   + + +
Sbjct  544  FGKEYPAVKKYLVDLNSPLFNVLTQVRKLWSLYDLYRSPGPIQFNGYLSNSRCYTVKIPE  603

Query  377  QD  372
            +D
Sbjct  604  KD  605



>emb|CDO64214.1| 6-phosphofructokinase [Plasmodium reichenowi]
Length=1417

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   V  W+  A P  ++M +   G G     
Sbjct  1222  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILPKGQGSKYLK  1281

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  1282  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  1341

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1342  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1374


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 61/120 (51%), Gaps = 5/120 (4%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V +   G   + 
Sbjct  527  CNYCYALGYNAALLIDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTG---NE  583

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
            F  PA+    VDL    + +L++  + + L D+YR+PGP+QF+G   +A+   +    +D
Sbjct  584  F--PAVKRYLVDLNSPLFNVLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKD  641



>gb|ETW18551.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum Vietnam Oak-Knoll (FVO)]
 gb|ETW32083.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum FCH/4]
 gb|ETW49516.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum MaliPS096_E11]
 gb|EWC76735.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum UGT5.1]
Length=1417

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   V  W+  A P  ++M +   G G     
Sbjct  1222  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILPKGQGSKYLK  1281

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  1282  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  1341

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1342  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1374


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 61/120 (51%), Gaps = 5/120 (4%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V +   G   + 
Sbjct  527  CNYCYALGYNAALLIDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTG---NE  583

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
            F  PA+    VDL    + +L++  + + L D+YR+PGP+QF+G   +A+   +    +D
Sbjct  584  F--PAVKRYLVDLNSPLFNVLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKD  641



>ref|XP_001352026.1| 6-phosphofructokinase, putative [Plasmodium falciparum 3D7]
 emb|CAD51837.1| 6-phosphofructokinase, putative [Plasmodium falciparum 3D7]
 gb|ETW43095.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum NF135/5.C10]
 gb|ETW55095.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum Palo Alto/Uganda]
 gb|ETW61753.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum CAMP/Malaysia]
 gb|EUT86527.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum Santa Lucia]
 gb|EWC85854.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum NF54]
Length=1418

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   V  W+  A P  ++M +   G G     
Sbjct  1223  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILPKGQGSKYLK  1282

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  1283  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  1342

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1343  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1375


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 61/120 (51%), Gaps = 5/120 (4%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V +   G   + 
Sbjct  527  CNYCYALGYNAALLIDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTG---NE  583

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
            F  PA+    VDL    + +L++  + + L D+YR+PGP+QF+G   +A+   +    +D
Sbjct  584  F--PAVKRYLVDLNSPLFNVLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKD  641



>gb|EUR72395.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
falciparum 7G8]
Length=1420

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   V  W+  A P  ++M +   G G     
Sbjct  1225  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILPKGQGSKYLK  1284

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  1285  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  1344

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1345  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1377


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 61/120 (51%), Gaps = 5/120 (4%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V +   G   + 
Sbjct  527  CNYCYALGYNAALLIDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTG---NE  583

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
            F  PA+    VDL    + +L++  + + L D+YR+PGP+QF+G   +A+   +    +D
Sbjct  584  F--PAVKRYLVDLNSPLFNVLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKD  641



>ref|XP_008625163.1| 6-phosphofructokinase [Plasmodium vinckei vinckei]
 gb|KEG01773.1| 6-phosphofructokinase [Plasmodium vinckei vinckei]
Length=1301

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    I+ +GL GY+ ++  L   VN W+  A P  ++M +   G G     
Sbjct  1101  CKLAYTYGHAASIIVESGLTGYIVSIRGLCGNVNDWKLFAIPFISLMKILLRGQGSKTLK  1160

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D   NPGP+QF+G  ++     L  
Sbjct  1161  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPGPIQFEGNASNYYNRTLFE  1220

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1221  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1253


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NLKN    W     P   +M V         D+
Sbjct  487  CNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHV-------CKDN  539

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             GK  PA+    VDL    +++L++  + + L D+YR+PGP+QF G  ++++   + +  
Sbjct  540  LGKEYPAVKKYLVDLNSPLFKVLKEVQSLWSLYDLYRSPGPIQFTGYLSNSRCYTVKIPQ  599

Query  377  QD  372
            +D
Sbjct  600  KD  601



>ref|XP_004221675.1| 6-phosphofructokinase [Plasmodium cynomolgi strain B]
 dbj|GAB65728.1| 6-phosphofructokinase [Plasmodium cynomolgi strain B]
Length=1439

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 46/153 (30%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   +  W+  A P  ++M +   G G     
Sbjct  1244  CKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKDWKMFAIPFISLMKILPRGQGSKYLK  1303

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  1304  SASKGDLPVIPSAPVDLNGKAYRSLKVALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  1363

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1364  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1396


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 56/192 (29%), Positives = 87/192 (45%), Gaps = 27/192 (14%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V R       D+
Sbjct  528  CNYCYALGYNAALLIDHKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNR-------DN  580

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADA---------  405
             GK  PA+    VDL    + +L+Q    + L D+YR+PGP+QF+G  +++         
Sbjct  581  TGKEFPAVKRYLVDLNSPLFNVLKQVRNLWSLYDLYRSPGPIQFNGHLSNSRCYTVKIPT  640

Query  404  KALILCVEDQDYMGRIKELQEYLDKVRTIV-----KPGCSQDVLKAALSAMASVTNIL--  246
            K L+LC   +D +  I  L    + V   +     + G SQ  L    SA +   N L  
Sbjct  641  KDLLLCQNSED-LQLIISLTNKTNHVGDNITGGSEEEGGSQKDLSGISSADSQKGNELGS  699

Query  245  -SVMSNGGNTNF  213
             S  S G + NF
Sbjct  700  VSATSKGAHENF  711



>gb|EUD71993.1| 6-phosphofructokinase [Plasmodium vinckei petteri]
Length=1302

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   VN W+  A P  ++M +   G G     
Sbjct  1106  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVNDWKLFAIPFISLMKILLRGQGSKSLK  1165

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D   NPGP+QF+G  ++     L  
Sbjct  1166  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPGPIQFEGNASNYYNRTLFE  1225

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1226  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1258


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NLKN    W     P   +M V         D+
Sbjct  491  CNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHV-------CKDN  543

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             GK  PA+    VDL    ++++++  + + L D+YR+PGP+QF+G  ++ +   + +  
Sbjct  544  LGKEYPAVKKYLVDLNSPLFKVVKEVQSLWSLYDLYRSPGPIQFNGYLSNVRCYTVKIPQ  603

Query  377  QD  372
            +D
Sbjct  604  KD  605



>emb|CDR12619.1| 6-phosphofructokinase, putative [Plasmodium chabaudi chabaudi]
Length=1306

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   VN W+  A P  ++M +   G G     
Sbjct  1106  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVNDWKLFAIPFISLMKILLRGQGSKSLK  1165

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D   NPGP+QF+G  ++     L  
Sbjct  1166  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPGPIQFEGNASNYYNRTLFE  1225

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1226  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1258


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NLKN    W     P   +M V         D+
Sbjct  491  CNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHV-------CKDN  543

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDG  420
             GK  PA+    VDL    +++L++    + L D+YR+PGP+QF+G
Sbjct  544  LGKEYPAVKKYLVDLNSPLFKVLKEVQNLWSLYDLYRSPGPIQFNG  589



>emb|CBK23161.2| unnamed protein product [Blastocystis hominis]
Length=260

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 82/172 (48%), Gaps = 13/172 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGY----LATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP  564
            CDYAY LG     ++   L GY    +ATL NLK   ++W   A P+    TV       
Sbjct  93   CDYAYALGREAAALIQYNLTGYIYIYMATLRNLKEEPSEWIPYAVPLLDFCTVE------  146

Query  563  AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
            A     +P++  + V++    +     +  K+ + D   NPG +QF G G+    L L +
Sbjct  147  AKQGVYRPSIPESNVNMNDAPFLRFVAHCDKWAVKDETCNPGSVQFGGAGSWNTTLSLQI  206

Query  383  EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNILSVMSNG  228
            E  DY+ RI+ L++ L  V  I  PGC  D L    SA+A V  ++ +  NG
Sbjct  207  EKHDYLKRIQLLRDELKAVEKICLPGC--DAL-LVYSAIAGVEGVIELRENG  255



>ref|XP_006429693.1| hypothetical protein CICLE_v10013226mg [Citrus clementina]
 gb|ESR42933.1| hypothetical protein CICLE_v10013226mg [Citrus clementina]
Length=86

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  464  LXDVYRNPGPLQFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
            + ++  + G  Q + P  D K+  LC ED++Y+ +IKE Q YLD V+ I KPGCSQ+VLK
Sbjct  1    MDELCEDQGLPQVERPIYDVKSAGLCTEDEEYITKIKEFQAYLDLVQKIAKPGCSQEVLK  60

Query  284  AALSAMASVTNILSVMSN  231
             AL++MAS+  IL+ MS+
Sbjct  61   VALNSMASLVKILNCMSS  78



>ref|XP_008815414.1| 6-phosphofructokinase [Plasmodium inui San Antonio 1]
 gb|EUD67977.1| 6-phosphofructokinase [Plasmodium inui San Antonio 1]
Length=1436

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/162 (28%), Positives = 78/162 (48%), Gaps = 4/162 (2%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPA---  561
             C  AY  GH    ++ +GL GY+ ++  L   +  W+  A P  ++M +   G G     
Sbjct  1232  CKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKDWKLFAIPFISLMKILPRGQGSKYLK  1291

Query  560   -ADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
              A     P +  A VDL GKAY  L+    ++ + D + NPGP+QF+G  ++    IL  
Sbjct  1292  NASKGDLPVIPSAPVDLNGKAYRSLKIALQRWQMEDRFCNPGPIQFEGNASNYYNRILFE  1351

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASV  258
             E  +Y   ++ ++ Y + ++   + G S D LK     + S+
Sbjct  1352  EQSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQLCSM  1393


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 63/124 (51%), Gaps = 9/124 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V R       D+
Sbjct  525  CNYCYALGYNAALLIDHKKTGYMSIIQNLQDSYANWIPAAIPFLRIMHVNR-------DN  577

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             GK  PA+    VDL    + +L++    + L D+YR PGP+QF+G  ++++   + +  
Sbjct  578  TGKEFPAVKRYLVDLNSPLFNVLKEVRNLWSLYDLYRAPGPIQFNGHLSNSRCYTVKIPT  637

Query  377  QDYM  366
            +D +
Sbjct  638  KDLL  641



>ref|XP_002141875.1| phosphofructokinase family protein [Cryptosporidium muris RN66]
 gb|EEA07526.1| phosphofructokinase family protein [Cryptosporidium muris RN66]
Length=1496

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 77/164 (47%), Gaps = 11/164 (7%)
 Frame = -3

Query  722   AYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFGK  543
              Y LGH    ++ +GL G L ++  L   V+ WR  + P   +M +      P+ D    
Sbjct  1253  GYALGHFASIVVESGLTGQLCSIRGLCGEVSDWRMTSIPFNCLMRIV-----PSNDETHP  1307

Query  542   ------PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
                   P +  + VDL+GKAY  L+     + + D + NPGP+QFDGP A+     L  +
Sbjct  1308  ELPSNIPTIPSSEVDLKGKAYRWLKIVQDHWAMQDRFCNPGPIQFDGPAANFYFRTLHEQ  1367

Query  380   DQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNI  249
               +Y   +K +Q Y + VR     G ++  LK A   +  + N+
Sbjct  1368  QSEYYEMLKHVQNYAELVRETCTFGVNESFLKTAFVTLNGLLNL  1411


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 46/129 (36%), Positives = 71/129 (55%), Gaps = 15/129 (12%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLK-NPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            +Y Y LGH    ++  G+NGYLA + NL+ NP+N   CG + IT +M +++      +D 
Sbjct  593  NYCYALGHCAAALVYKGMNGYLALIRNLEENPINWQACGIS-ITRIMEIKK----SRSDD  647

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALI-------  393
                A+    VDL G  ++LL++    + + D+YR PGPLQF+GP +D+   I       
Sbjct  648  SLFAAVTRQLVDLNGPMFQLLKRVRNIWAIHDLYRAPGPLQFEGPCSDSIPYIVKSPTIE  707

Query  392  --LCVEDQD  372
              LC E+ D
Sbjct  708  DLLCGEETD  716



>ref|XP_729053.1| pyrophosphate-dependent phosphofructokinase [Plasmodium yoelii 
yoelii 17XNL]
 gb|EAA20618.1| pyrophosphate-dependent phosphofructokinase [Plasmodium yoelii 
yoelii]
 gb|ETB60304.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Plasmodium 
yoelii 17X]
 emb|CDU17556.1| 6-phosphofructokinase, putative [Plasmodium yoelii]
 emb|CDZ11823.1| 6-phosphofructokinase, putative [Plasmodium yoelii]
Length=1309

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 46/153 (30%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   V  W+  A P  ++M +   G G     
Sbjct  1114  CKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILLRGQGSKSLK  1173

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D   NPGP+QF+G  ++  +  L  
Sbjct  1174  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPGPIQFEGNASNYYSRTLFE  1233

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1234  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1266


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 36/121 (30%), Positives = 63/121 (52%), Gaps = 9/121 (7%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            +Y Y LG+    ++     GY++ + NLKN    W     P   +M V         D+F
Sbjct  492  NYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWIPAGIPFLRIMHV-------CKDNF  544

Query  548  GK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQ  375
            GK  PA+    VDL    + +L+Q  + + L D+YR+PGP+QF+G  ++++   + + ++
Sbjct  545  GKEYPAVKKYLVDLNSPLFNVLKQVRSLWSLYDLYRSPGPIQFNGYLSNSRCYTVKIPEK  604

Query  374  D  372
            D
Sbjct  605  D  605



>ref|XP_666221.1| hypothetical protein [Cryptosporidium hominis TU502]
Length=1426

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 77/164 (47%), Gaps = 11/164 (7%)
 Frame = -3

Query  722   AYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFGK  543
              Y LGH    ++ +GL G+L ++  L   V+ WR  A P   +M +      P+ D    
Sbjct  1185  GYALGHFASIVVESGLTGHLCSIRGLCGDVSDWRMTAIPFNCLMKIV-----PSNDETHP  1239

Query  542   ------PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
                   P +  + VDL+GKAY  L+     + + D + NPGP+QFDG  A+     L  +
Sbjct  1240  ELPSNIPTIPSSEVDLKGKAYRWLKIVQEHWAMQDRFCNPGPIQFDGAAANFYFRTLHEQ  1299

Query  380   DQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNI  249
               +Y   +K +Q Y + VR     G ++  LK A   +  + N+
Sbjct  1300  QSEYYEMLKHVQNYAELVRETCTFGVNESFLKTAFVTLNGLLNL  1343


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 57/173 (33%), Positives = 81/173 (47%), Gaps = 38/173 (22%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLK-NPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            +Y Y LGH    ++  G+NGYLA +  L+ NP++   CG + IT +M V++       D 
Sbjct  553  NYCYALGHCAGALVYKGMNGYLAVIRGLEGNPLSWQACGIS-ITRIMEVKK----SRQDG  607

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
                A+    VDL G  ++LL+Q    +   D+YR  GPLQF+GP         C E   
Sbjct  608  QCYAAVTRQLVDLNGPLFKLLKQVRDIWKFQDLYRATGPLQFEGP---------CSETIP  658

Query  371  YMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVT----NILSVMSNGG  225
            Y+ R  ELQ+ L          C +D         ASVT    NI+   + GG
Sbjct  659  YIVRTPELQDLL----------CGED---------ASVTDTDINIVQANNGGG  692



>ref|XP_626418.1| pyrophosphate-dependent phosphofructokinase [Cryptosporidium 
parvum Iowa II]
 gb|EAK88781.1| pyrophosphate-dependent phosphofructokinase [Cryptosporidium 
parvum Iowa II]
Length=1426

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 77/164 (47%), Gaps = 11/164 (7%)
 Frame = -3

Query  722   AYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFGK  543
              Y LGH    ++ +GL G+L ++  L   V+ WR  A P   +M +      P+ D    
Sbjct  1185  GYALGHFASIVVESGLTGHLCSIRGLCGDVSDWRMTAIPFNCLMKIV-----PSNDETHP  1239

Query  542   ------PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
                   P +  + VDL+GKAY  L+     + + D + NPGP+QFDG  A+     L  +
Sbjct  1240  ELPSNIPTIPSSEVDLKGKAYRWLKIVQEHWAMQDRFCNPGPIQFDGAAANFYFRTLHEQ  1299

Query  380   DQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTNI  249
               +Y   +K +Q Y + VR     G ++  LK A   +  + N+
Sbjct  1300  QSEYYEMLKHVQNYAELVRETCTFGVNESFLKTAFVTLNGLLNL  1343


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 15/132 (11%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLK-NPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            +Y Y LGH    ++  G+NGYLA +  L+ NP++   CG + IT +M V++       D 
Sbjct  553  NYCYALGHCAGALVYKGMNGYLAVIRGLEGNPLSWQACGIS-ITRIMEVKK----SRQDG  607

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
                A+    VDL G  ++LL+Q    +   D+YR PGPLQF+GP         C E   
Sbjct  608  QCYAAVTRQLVDLNGPLFKLLKQVRDIWKFQDLYRAPGPLQFEGP---------CSETIP  658

Query  371  YMGRIKELQEYL  336
            Y+ R  ELQ+ L
Sbjct  659  YIVRTPELQDLL  670



>ref|XP_005707151.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Galdieria 
sulphuraria]
 gb|EME30631.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Galdieria 
sulphuraria]
Length=569

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 8/121 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
            C+Y Y LGH    ++  G  G +AT+ +L  P  +W  G  P+T MM + RR G      
Sbjct  453  CNYCYTLGHTAGALIEGGRTGLVATVRHLTKPPEQWEVGGYPLTVMMDIERRKGK-----  507

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQ  375
                P +  A VDL+G+A+ +  +    + L + YR PGP+Q  GP AD+    L  E +
Sbjct  508  --NVPVIKKALVDLKGEAFRIFSEQRDSWRLAEDYRCPGPIQHFGPMADSINFTLMSEAR  565

Query  374  D  372
            D
Sbjct  566  D  566



>ref|XP_001614690.1| 6-phosphofructokinase [Plasmodium vivax Sal-1]
 gb|EDL44963.1| 6-phosphofructokinase, putative [Plasmodium vivax]
Length=1421

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 46/153 (30%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   +  W+  A P  ++M +   G G     
Sbjct  1226  CKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKDWKLFAIPFISLMKILPRGQGSKYLK  1285

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  +     IL  
Sbjct  1286  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASIYYNRILFE  1345

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1346  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1378


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 64/124 (52%), Gaps = 9/124 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V R       D+
Sbjct  525  CNYCYALGYNAALLIDHKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNR-------DN  577

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVED  378
             GK  PA+    VDL    + +L++  + + L D+YR PGP+QF+G  ++++   + +  
Sbjct  578  TGKEFPAVKRYLVDLNSPLFNVLKEVRSLWSLYDLYRAPGPIQFNGHLSNSRCYTVKIPT  637

Query  377  QDYM  366
            +D +
Sbjct  638  KDVL  641



>ref|WP_022458553.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Fusobacterium 
sp. CAG:439]
 emb|CDE58901.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Fusobacterium 
sp. CAG:439]
Length=559

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             DY Y LG   + ++  GL GYL+++ NL  P N W  G  P+T MM + R  HG     
Sbjct  439  ADYCYSLGFNAFALINFGLTGYLSSVRNLTEPANDWIAGGVPLTMMMNMERR-HGEM---  494

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGA--DAKALILCVED  378
              KP +  A V+L G  ++ L +N   + + D Y  PG +Q+ GP +  D   + L +E 
Sbjct  495  --KPVIKKALVELDGPVFKKLEENREDWAMNDRYLFPGAIQYFGPSSVCDITTVTLQLES  552

Query  377  QDYMGRI  357
            +  + RI
Sbjct  553  EAKLARI  559



>ref|WP_021663363.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 gb|ERJ64733.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis F0569]
Length=549

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  NPV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTANPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVE  381
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLE  545

Query  380  DQD  372
              D
Sbjct  546  KND  548



>ref|XP_002258426.1| 6-phosphofructokinase [Plasmodium knowlesi strain H]
 emb|CAQ39198.1| 6-phosphofructokinase, putative [Plasmodium knowlesi strain H]
Length=1417

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 45/153 (29%), Positives = 75/153 (49%), Gaps = 4/153 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGP----  564
             C  AY  GH    ++ +GL GY+ ++  L   +  W+  A P  ++M +   G       
Sbjct  1222  CKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKDWKLFAIPFISLMKILPRGQDSKYLK  1281

Query  563   AADSFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
             +A     P +  A VDL GKAY  L+    K+ + D + NPGP+QF+G  ++    IL  
Sbjct  1282  SASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFE  1341

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
             E  +Y   ++ ++ Y + ++   + G S D LK
Sbjct  1342  EQSEYFEMLRYVECYANILKDTCRFGVSADYLK  1374


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 64/131 (49%), Gaps = 18/131 (14%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
            C+Y Y LG+    ++     GY++ + NL++    W   A P   +M V R       D+
Sbjct  525  CNYCYALGYNAALLIDHKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNR-------DN  577

Query  551  FGK--PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADA---------  405
             GK  PA+    VDL    + +L++    + L D+YR+PGP+QF+G  +++         
Sbjct  578  TGKEFPAVKRYLVDLNSPLFNVLKEVRNLWSLYDLYRSPGPIQFNGHLSNSRCYTVKIPT  637

Query  404  KALILCVEDQD  372
            K ++LC    D
Sbjct  638  KNILLCQNSDD  648



>emb|CAN81375.1| hypothetical protein VITISV_020870 [Vitis vinifera]
Length=374

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -3

Query  431  QFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAALSAMASVTN  252
            QF+ P +  KA+ L V+DQDY G+IKELQ YLDKV  IVKPGCS +VLK AL++++S+ +
Sbjct  159  QFERPDSAEKAIELLVQDQDYTGKIKELQAYLDKVNEIVKPGCSPEVLKVALNSISSLNS  218

Query  251  ILSVM  237
             L +M
Sbjct  219  NLQLM  223



>gb|AFW75214.1| hypothetical protein ZEAMMB73_287145 [Zea mays]
Length=271

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  716  VLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYG  573
            VLGHVCYHI+AA LNGY++T+ NLKNPVNKWRCGA PI+    +R  G
Sbjct  181  VLGHVCYHIIAARLNGYMSTVTNLKNPVNKWRCGATPISYYYFIRLIG  228



>ref|XP_001610135.1| 6-phosphofructokinase [Babesia bovis T2Bo]
 gb|EDO06567.1| 6-phosphofructokinase, putative [Babesia bovis]
Length=1337

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 79/156 (51%), Gaps = 5/156 (3%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAA-D  555
             C  A+  GHV      +GL G   ++  L   +  W+  A P+T +M V      P + +
Sbjct  1140  CSLAFAYGHVASIAAESGLTGVCCSIRGLCGEIEAWKMYAVPLTCLMKVEPNIMTPISLN  1199

Query  554   SFGK---PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCV  384
              F K   P +  +TV L+ KA+  L     K+L+ D++ NPGP+QFDG    A++++L  
Sbjct  1200  DFKKGELPMVPSSTVSLKSKAFRKLSMARKKWLVEDLFINPGPIQFDGI-VTAQSMVLIT  1258

Query  383   EDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAAL  276
             E  +Y   +  ++ +L+ ++   K G S++ L  A 
Sbjct  1259  EHAEYYQMLHSVERFLNVLQNTCKFGVSEEYLNHAF  1294


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 6/125 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +++A  NGY++ + +LK P+++W     P   +M +   G   A     
Sbjct  558  YCYSLGYNAGVLISAKRNGYMSVIRDLKAPISEWIPLGVPFLHLMHMINLGGKRA-----  612

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQDYM  366
             PA+    ++L GK ++   +    +   D+YR+PGP+Q           I   + +D +
Sbjct  613  -PAIRKTLLNLDGKLFKTFEKVREIWAYNDLYRSPGPIQLFNSDYQRCFSISDPQVEDLI  671

Query  365  GRIKE  351
            G  KE
Sbjct  672  GSFKE  676



>ref|WP_022023024.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Acinetobacter 
sp. CAG:196]
 emb|CCZ50942.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Acinetobacter 
sp. CAG:196]
Length=559

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             DY Y LG   + ++  GL GYL+++ NL  P N W  G  P+T MM + R  HG     
Sbjct  439  ADYCYSLGFNAFALINFGLTGYLSSVRNLTEPANDWIAGGVPLTMMMNMERR-HGEM---  494

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGA--DAKALILCVED  378
              KP +  A V+L G  ++ L +N   + + D Y  PG +Q+ GP +  D   + L +E 
Sbjct  495  --KPVIKKALVELDGPVFKKLEENREDWAMNDRYLFPGAIQYFGPSSVCDITTVTLQLES  552

Query  377  QDYMGRI  357
            +  + R+
Sbjct  553  EAKLARV  559



>emb|CBK24494.2| unnamed protein product [Blastocystis hominis]
 emb|CBK25089.2| unnamed protein product [Blastocystis hominis]
 emb|CBK20473.2| unnamed protein product [Blastocystis hominis]
Length=538

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            +Y Y LG+    ++  GLNG ++T++NL  PV  W  G  P+T MM + R       +  
Sbjct  420  NYCYALGYNAGVLIHEGLNGMMSTISNLDAPVEAWTAGGVPVTMMMNIER------RNGK  473

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVEDQD  372
             +P +  A V+L G  Y    + A K+ L D Y  PGP+QF GP A+     L  E ++
Sbjct  474  DEPVIKKALVELDGLPYRRFVEQAKKWRLGDCYSFPGPIQFTGPAANVINQTLAYEIEE  532



>ref|XP_009114586.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2 [Brassica rapa]
Length=568

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV KW  G  P+T++M V R  HG       
Sbjct  455  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEKWTVGGTPLTSLMDVERR-HGKF-----  508

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA    L +E
Sbjct  509  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDAINHTLLLE  563



>ref|WP_016777789.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Anaerophaga 
thermohalophila]
Length=547

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 6/105 (6%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             DY Y LG+    ++A G  GY+A + NLK P ++W  G  PIT+MM + R  HG     
Sbjct  434  ADYTYSLGNTASILIAEGKTGYMAAVRNLKAPADEWIAGGVPITSMMNMERR-HGTM---  489

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
              KP +  A V L GK +    +N  ++ +  +Y  PGP+Q+ GP
Sbjct  490  --KPVIQKALVKLDGKPFMTFAENREEWAMNTLYVYPGPIQYFGP  532



>ref|WP_012457385.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 dbj|BAG32794.1| phosphofructokinase [Porphyromonas gingivalis ATCC 33277]
Length=549

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVE  381
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLE  545

Query  380  DQD  372
              D
Sbjct  546  KND  548



>ref|WP_023847292.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 gb|ETA26451.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis SJD2]
Length=549

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVE  381
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLE  545

Query  380  DQD  372
              D
Sbjct  546  KND  548



>ref|WP_004583807.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 sp|Q9FAF8.1|PFP_PORGN RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase; 
AltName: Full=6-phosphofructokinase, pyrophosphate 
dependent; AltName: Full=PPi-dependent phosphofructokinase; 
Short=PPi-PFK; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Porphyromonas gingivalis]
 dbj|BAB16715.1| phosphofructokinase [Porphyromonas gingivalis]
 gb|AAQ65403.1| phosphofructokinase [Porphyromonas gingivalis W83]
 gb|EIW90923.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis W50]
 gb|EOA10170.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis JCVI SC001]
 gb|ERJ69057.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis F0570]
 gb|ERJ88535.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis F0566]
 gb|ERJ91098.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis W4087]
Length=549

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVE  381
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLE  545

Query  380  DQD  372
              D
Sbjct  546  KND  548



>ref|WP_013815410.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 dbj|BAK24608.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis TDC60]
Length=549

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVE  381
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLE  545

Query  380  DQD  372
              D
Sbjct  546  KND  548



>ref|WP_021662033.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 gb|ERJ69442.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis F0568]
Length=549

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVE  381
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLE  545

Query  380  DQD  372
              D
Sbjct  546  KND  548



>ref|WP_021677112.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis]
 gb|ERJ84359.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gingivalis F0185]
Length=549

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + R       + 
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMER------RNG  486

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG--ADAKALILCVED  378
              KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP    D+  + L +E 
Sbjct  487  KMKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGPEHVCDSPTMTLRLEK  546

Query  377  QD  372
             D
Sbjct  547  ND  548



>ref|XP_006396719.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
 gb|ESQ38172.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
Length=570

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  P+ KW  G  P+T++M V R  HG       
Sbjct  457  YCYALGYGAGSLLQSGKTGLISSVGNLAAPIEKWTVGGTPLTSLMDVERR-HGKF-----  510

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA    L +E
Sbjct  511  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDAINHTLLLE  565



>ref|WP_015423578.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [uncultured 
Termite group 1 bacterium]
 ref|YP_001956514.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [uncultured 
Termite group 1 bacterium phylotype Rs-D17]
 dbj|BAG14053.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [uncultured 
Termite group 1 bacterium phylotype Rs-D17]
Length=561

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 6/105 (6%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             +Y Y LG+    ++  GL GYL+++ NL     +W CG  P+T MM + +  HG     
Sbjct  443  ANYTYALGYNAAVLVLNGLTGYLSSVRNLARSPKQWECGGIPLTMMMNIEKR-HGKE---  498

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
              KP +  A VDL GK ++   +N  K+ L + Y  PGP+Q+ GP
Sbjct  499  --KPVIQKALVDLNGKPFKEFVKNRDKWALSESYIFPGPIQYFGP  541



>emb|CDX94541.1| BnaC09g22950D [Brassica napus]
Length=634

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 61/115 (53%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV KW  G  P+T++M V R  HG       
Sbjct  521  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEKWTVGGTPLTSLMDVERR-HGKF-----  574

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+D     L +E
Sbjct  575  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDTINHTLLLE  629



>ref|WP_021903099.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
sp. CAG:1061]
 emb|CCY09226.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
sp. CAG:1061]
Length=257

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 6/105 (6%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            DY Y LG+    ++AAG  GY++++ N   P  +W+ G  PIT MM + R  HG      
Sbjct  144  DYCYSLGYNAAQLIAAGKTGYMSSIRNTTRPAAEWKAGGIPITMMMNMERR-HGSM----  198

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG  414
             KP +  A V+L GK ++   Q   K+     +  PGP+Q+ GP 
Sbjct  199  -KPVIRKALVELEGKPFKTFEQYRDKWAHETCFVYPGPIQYFGPS  242



>ref|WP_024752338.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis]
 emb|CEM61263.1| Diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis]
Length=555

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 8/119 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             DY Y LG   + ++A GL GYL+++ NL  P ++W+ G  P+T MM + +  HG     
Sbjct  437  ADYCYSLGFTAFLLIAQGLTGYLSSVRNLTAPADEWQAGGVPLTMMMNMEQR-HGSK---  492

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGA--DAKALILCVE  381
              KP +  A V+L GK ++   +N  K+ +   Y  PG +Q+ GP    DA +  L +E
Sbjct  493  --KPVIKKALVELDGKPFQEFAKNRDKWAITTSYLYPGAIQYYGPTEVCDAASKTLQLE  549



>ref|WP_002701079.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis]
 gb|EFW36626.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis F0421]
Length=558

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 6/105 (6%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             DY Y LG   + ++A GL GYL+++ NL  P ++W+ G  P+T MM + +  HG     
Sbjct  437  ADYCYSLGFTAFLLIAQGLTGYLSSVRNLTAPADEWQAGGVPLTMMMNMEQR-HGSK---  492

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
              KP +  A V+L GK ++   +N  K+ +   Y  PG +Q+ GP
Sbjct  493  --KPVIKKALVELDGKPFQEFAKNRDKWAITTSYLYPGAIQYYGP  535



>gb|KHG04503.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Gossypium arboreum]
Length=106

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  467  LLXDVYRNPGPLQFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVL  288
            ++ ++YR  G    + P +  + +    ED+D++ +IKE Q+YL KV+ ++KPGCS++VL
Sbjct  21   VMDELYREAGITLLEEPDSSMELMDTHSEDEDHIRKIKEFQDYLQKVKIMIKPGCSEEVL  80

Query  287  KAALSAMASVTNILSVMS  234
            K AL++M+S+  IL+ MS
Sbjct  81   KVALNSMSSLVGILAFMS  98



>ref|WP_039420029.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Porphyromonas]
 gb|KGL55500.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
sp. COT-052 OH4946]
 gb|KGN67618.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN75569.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN87751.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN92373.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGO02288.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGP  531



>ref|WP_039426896.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN83538.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++AAG  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIAAGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGP  531



>ref|WP_040466458.1| diphosphate--fructose-6-phosphate 1-phosphotransferase, partial 
[Holdemanella biformis]
Length=235

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             DY Y LG+  + ++  G NGYL+ ++NL  P  +W  G  PIT MM + RR G      
Sbjct  120  ADYCYSLGYNAFMLIQYGYNGYLSKVSNLSKPAEEWVAGGMPITKMMNIERRNGE-----  174

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A V+L GK ++    N   + +   Y  PG +Q+ GP
Sbjct  175  --DKPVIKKALVELDGKPFKFFEANRDTWAVETAYTYPGAIQYYGP  218



>ref|XP_011004484.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Populus euphratica]
Length=130

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = -3

Query  458  DVYRNPGPLQFDGPGADAKALI--LCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
            +V+   G +Q DG G+D KA    +  EDQ+Y+  IK+L  YLD V+ +V+PGCS +VLK
Sbjct  45   NVHGKTGAVQLDGAGSDKKACGHGILTEDQEYIKEIKKLHAYLDMVKKMVRPGCSPEVLK  104

Query  284  AALSAMASVTNILSVMSNG  228
             AL++M+++ N L+ +S+G
Sbjct  105  TALNSMSALFNTLAFVSSG  123



>gb|EEC89467.1| putative diphosphate--fructose-6-phosphate 1-phosphotransferase, 
partial [Holdemanella biformis DSM 3989]
Length=237

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             DY Y LG+  + ++  G NGYL+ ++NL  P  +W  G  PIT MM + RR G      
Sbjct  122  ADYCYSLGYNAFMLIQYGYNGYLSKVSNLSKPAEEWVAGGMPITKMMNIERRNGE-----  176

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A V+L GK ++    N   + +   Y  PG +Q+ GP
Sbjct  177  --DKPVIKKALVELDGKPFKFFEANRDTWAVETAYTYPGAIQYYGP  220



>ref|XP_010422248.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X2 [Camelina sativa]
Length=569

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV +W  G   +T++M V R  HG       
Sbjct  456  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEEWTVGGTALTSLMDVERR-HGKF-----  509

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA+   L +E
Sbjct  510  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDARNHTLMLE  564



>ref|NP_192313.3| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|F4JGR5.1|PFPB2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Protein MATERNAL EFFECT EMBRYO ARREST 
51; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AEE82365.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=569

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV +W  G   +T++M V R  HG       
Sbjct  456  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEEWTVGGTALTSLMDVERR-HGKF-----  509

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA+   L +E
Sbjct  510  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDARNHTLMLE  564



>ref|XP_010433059.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2 [Camelina sativa]
Length=569

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV +W  G   +T++M V R  HG       
Sbjct  456  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEEWTVGGTALTSLMDVERR-HGKF-----  509

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA+   L +E
Sbjct  510  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDARNHTLMLE  564



>ref|XP_010496159.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like [Camelina sativa]
Length=569

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV +W  G   +T++M V R  HG       
Sbjct  456  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEEWTVGGTALTSLMDVERR-HGKF-----  509

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA+   L +E
Sbjct  510  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDARNHTLMLE  564



>ref|WP_040451094.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Holdemania 
massiliensis]
Length=552

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 6/105 (6%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             DY Y LG+  + ++  G NGYL+ ++NL NP ++W  G  PIT MM + R  HG     
Sbjct  438  SDYCYSLGYNAFMLIQYGYNGYLSKISNLSNPASEWTAGGMPITKMMNIERR-HGE----  492

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
              KP +  A V+L GK ++    +  ++ +   +  PG +Q+ GP
Sbjct  493  -DKPVIKKALVELDGKPFKFFEAHREEWAVETSFVYPGAIQYYGP  536



>ref|XP_010422247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X1 [Camelina sativa]
Length=594

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV +W  G   +T++M V R  HG       
Sbjct  481  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEEWTVGGTALTSLMDVERR-HGKF-----  534

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA+   L +E
Sbjct  535  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDARNHTLMLE  589



>gb|EFB41793.1| hypothetical protein pah_c022o077 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 gb|KIA77973.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta 1 [Parachlamydia acanthamoebae]
Length=567

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 8/117 (7%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAADS  552
             Y Y LGHV   ++ A L GY++ + +L  PV +W  GA P+  MM +  R G       
Sbjct  443  QYCYALGHVAALLVNAKLTGYMSCVTDLSLPVEQWGIGATPLIKMMGMEERNGE------  496

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
              KP +  + V+L+GK + +  Q   K++L D+Y +PGP+QF G   +   + L +E
Sbjct  497  -LKPVIQKSLVNLQGKPFAIFSQERDKWILEDLYCDPGPIQFFGARDETDQIPLTLE  552



>gb|AAC28214.1| contains similarity to phosphofructokinases (Pfam; PFK.hmm, score; 
36.60) [Arabidopsis thaliana]
 emb|CAB77872.1| putative phosphofructokinase beta subunit [Arabidopsis thaliana]
Length=583

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL  PV +W  G   +T++M V R  HG       
Sbjct  470  YCYALGYGAGSLLQSGKTGLISSVGNLAAPVEEWTVGGTALTSLMDVERR-HGKF-----  523

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA+   L +E
Sbjct  524  KPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQFKGPGSDARNHTLMLE  578



>ref|WP_013924907.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parachlamydia 
acanthamoebae]
 emb|CCB86320.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Parachlamydia acanthamoebae UV-7]
Length=564

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 8/117 (7%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAADS  552
             Y Y LGHV   ++ A L GY++ + +L  PV +W  GA P+  MM +  R G       
Sbjct  440  QYCYALGHVAALLVNAKLTGYMSCVTDLSLPVEQWGIGATPLIKMMGMEERNGE------  493

Query  551  FGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
              KP +  + V+L+GK + +  Q   K++L D+Y +PGP+QF G   +   + L +E
Sbjct  494  -LKPVIQKSLVNLQGKPFAIFSQERDKWILEDLYCDPGPIQFFGARDETDQIPLTLE  549



>ref|XP_005652109.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase beta-subunit 
[Coccomyxa subellipsoidea C-169]
 gb|EIE27565.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase beta-subunit 
[Coccomyxa subellipsoidea C-169]
Length=515

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (51%), Gaps = 8/116 (7%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAADSF  549
            Y   LG+V   ++A G  G +AT ++L  P   W  G  P+  MM + RR G        
Sbjct  397  YCSTLGYVAGALVAGGKTGLMATASSLDKPCADWTVGGYPLIDMMCIERRRGKD------  450

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
             KP +  A V+L G  ++  +Q   K+   D +R+PGP+QF GP ADA    L +E
Sbjct  451  -KPVIKKALVELEGPVFKAFQQMRRKWAQGDCFRSPGPIQFSGPNADAANFTLALE  505



>ref|XP_004340159.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Acanthamoeba 
castellanii str. Neff]
 gb|ELR18139.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Acanthamoeba 
castellanii str. Neff]
Length=572

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 63/118 (53%), Gaps = 8/118 (7%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     +L  GL GY+A+++NL  P  +W+ G  P+TA+M + RR G      
Sbjct  450  SNYCYALGRTAGALLDHGLTGYMASVSNLTAPPEQWKSGGLPLTALMNMERRKGK-----  504

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
                P +  A VDL    Y+ L ++  K+   + YRNPGP+QF GP +    + L +E
Sbjct  505  --NVPVIRKALVDLDAAPYKELLRHREKWARGEHYRNPGPIQFYGPASGEVNITLQLE  560



>ref|WP_026475518.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alkaliflexus 
imshenetskii]
Length=549

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             DY Y LG+    +++ G  GY+A++ NL  P ++W  G APIT MM + +R+GH     
Sbjct  434  ADYCYSLGYTASLLISEGKTGYMASVKNLTKPADQWVAGGAPITMMMNMEKRHGH-----  488

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A V L GK ++ L     ++ +  +Y  PGP+Q+ GP
Sbjct  489  --MKPVIQKALVMLDGKPFQKLESCREEWAIGTMYVYPGPIQYFGP  532



>ref|WP_022419924.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Eubacterium 
dolichum CAG:375]
 emb|CDE23747.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Eubacterium 
dolichum CAG:375]
Length=345

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 6/105 (6%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            DY Y LG+  + ++  G NGYL+ ++NL  P N+W  G  PIT MM + R  HG      
Sbjct  232  DYCYSLGYNAFMLIQYGYNGYLSKISNLSKPANEWVAGGMPITKMMNIER-RHGE-----  285

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPG  414
             KP +  A V+L GK ++    +  ++     +  PG +Q+ GP 
Sbjct  286  DKPVIRKALVELEGKPFKFFEAHREEWAENTCFVYPGAIQYYGPA  330



>ref|WP_022351630.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Firmicutes 
bacterium CAG:534]
 emb|CDD45952.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Firmicutes 
bacterium CAG:534]
Length=552

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            DY Y LG+  + ++  G NGYL+ ++NL  P  +W  G  PIT MM + R  HG      
Sbjct  439  DYCYSLGYNAFMLIQYGYNGYLSKVSNLSKPATEWVAGGMPITKMMNMERR-HGE-----  492

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
             KP +  A V+L GK ++   ++  K+ +   Y  PG +Q+ GP
Sbjct  493  DKPVIRKALVELEGKPFKYFEEHRDKWAVETCYVYPGAIQYYGP  536



>ref|XP_004829199.1| phosphofructokinase, putative [Babesia equi]
 gb|AFZ79533.1| phosphofructokinase, putative [Babesia equi strain WA]
Length=1332

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 78/157 (50%), Gaps = 15/157 (10%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAA--  558
             C  AY  GH+    L   L GY  ++  L   +  W+  A P T++M +      P A  
Sbjct  1140  CSLAYAYGHMAAIALENKLTGYCCSIRGLCGSIQDWKLFAIPFTSLMKI-----APDAFE  1194

Query  557   ----DSFGK---PALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKA  399
                 + F K   P +  + VDL+ KA+   +    ++LL D++ NPGP+QFDG     ++
Sbjct  1195  IFSMEKFKKGEMPVIPTSNVDLQSKAFRKFKVARKRWLLDDLFTNPGPIQFDG-FVGTQS  1253

Query  398   LILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVL  288
             ++L  E  +Y   ++ ++++ D ++   K G S++ L
Sbjct  1254  MVLITEFAEYYYMLRSVEKFSDALKNSCKFGVSEEFL  1290


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/104 (28%), Positives = 48/104 (46%), Gaps = 14/104 (13%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVR---RYGHGPAAD  555
            Y Y LG+    +++ G NGY++ + NL   +  W     P   +M V+   RY       
Sbjct  544  YCYALGYNAGVLISNGRNGYMSVIRNLNGQIEDWIPIGVPFLHLMEVKGETRY-------  596

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFD  423
                PA+    ++L G+ +    +    +   DVYR+PGP+Q D
Sbjct  597  ----PAIRKTLLNLDGQLFHTFSKVREIWAYQDVYRSPGPIQTD  636



>ref|WP_039419596.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGL47250.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN72678.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGO04092.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++A G  GY+A + N  +PV++W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIATGKTGYMAAIKNTADPVSEWEAGGVPMTMMMNMERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGP  531



>ref|XP_004507660.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cicer arietinum]
Length=567

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 6/115 (5%)
 Frame = -3

Query  725  YAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSFG  546
            Y Y LG+    +L +G  G ++++ NL NPV +W  G   +T++M V R  HG       
Sbjct  454  YCYALGYGAGALLQSGKTGLISSVANLCNPVEEWTVGGTALTSLMDVERR-HGKF-----  507

Query  545  KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKALILCVE  381
            KP +  A V+L G  ++       ++ L + Y +PGP+QF GPG+DA +  L +E
Sbjct  508  KPVIKKAMVELEGAPFKKFASLRDEWALKNCYTSPGPIQFTGPGSDAISHTLLLE  562



>ref|WP_021851985.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:1058]
 emb|CCX67746.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:1058]
Length=546

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = -3

Query  728  DYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADSF  549
            DY Y LG    H++A G  GY+A + N   P ++W+ G  PIT MM + R       +  
Sbjct  433  DYCYALGTSAAHLIANGKTGYMAIVKNTIKPTSEWKAGGVPITMMMNIER------RNGE  486

Query  548  GKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
             KP +  A V+L GK ++ L++N  ++     +  PGP+Q+ GP
Sbjct  487  MKPVIRKALVELDGKPFKELQKNRDRWAKETCFIYPGPIQYWGP  530



>gb|KJB63313.1| hypothetical protein B456_010G169500 [Gossypium raimondii]
Length=85

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -3

Query  464  LXDVYRNPGPLQFDGPGADAKALILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLK  285
            + ++YR  G    + P +  + +    ED+D++ +IKE Q+YL  V+ ++KPGCS++VLK
Sbjct  1    MDELYREAGTTLLEEPDSSMELMDTHREDEDHIRKIKEFQDYLQMVKIMIKPGCSEEVLK  60

Query  284  AALSAMASVTNILSVMS  234
             AL++M+S+  IL+ MS
Sbjct  61   VALNSMSSLVGILAFMS  77



>ref|WP_026292223.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN77932.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -3

Query  731  CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV-RRYGHGPAAD  555
             +Y Y LG     ++A G  GY+A + N  +PV +W  G  P+T MM + RR G      
Sbjct  433  ANYCYCLGRAASILIATGKTGYMAAIKNTADPVAEWEAGGVPMTMMMNIERRSGK-----  487

Query  554  SFGKPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGP  417
               KP +  A VD+ G+ Y  LR+   ++ L   Y  PGP+QF GP
Sbjct  488  --MKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQFFGP  531



>ref|XP_765143.1| 6-phosphofructokinase [Theileria parva strain Muguga]
 gb|EAN32860.1| 6-phosphofructokinase, putative [Theileria parva]
Length=1692

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 44/160 (28%), Positives = 76/160 (48%), Gaps = 16/160 (10%)
 Frame = -3

Query  731   CDYAYVLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTVRRYGHGPAADS  552
             C  AY  GH+    + + L+G+  ++  +   V  W+  A P T MM +       A DS
Sbjct  1515  CSLAYSYGHLAAICVESKLSGFCCSIRAVCGAVKDWKLFATPFTCMMKI-------APDS  1567

Query  551   FG--------KPALHPATVDLRGKAYELLRQNATKFLLXDVYRNPGPLQFDGPGADAKAL  396
             F          P + P  V L GK ++ L+    K+L+ D++ NPGP+QF+      + +
Sbjct  1568  FKLLINPKSEMPIIPPNNVSLNGKPFKKLKSARKKWLVEDLFNNPGPIQFNS-FVGTQNI  1626

Query  395   ILCVEDQDYMGRIKELQEYLDKVRTIVKPGCSQDVLKAAL  276
             +L +E   Y   I  ++ + + ++ I K G S++ L  A 
Sbjct  1627  MLIIEHSQYYHMITSVERFTEIIKNICKFGVSEEYLHHAF  1666



>ref|NP_001175755.1| Os09g0298100 [Oryza sativa Japonica Group]
 dbj|BAH94483.1| Os09g0298100 [Oryza sativa Japonica Group]
Length=62

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  716  VLGHVCYHILAAGLNGYLATLNNLKNPVNKWRCGAAPITAMMTV  585
            VLGH+C HILAAGLNGY+A   NLK P NKWRC A P+T    V
Sbjct  3    VLGHICMHILAAGLNGYMAFATNLKEPTNKWRCAAVPLTVCFLV  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485