BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016B24

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002515854.1|  molybdopterin biosynthesis protein, putative       345   7e-111   Ricinus communis
ref|XP_006446684.1|  hypothetical protein CICLE_v10014503mg             338   5e-110   Citrus clementina [clementine]
gb|KDO47642.1|  hypothetical protein CISIN_1g0059002mg                  337   8e-110   Citrus sinensis [apfelsine]
gb|KDO47640.1|  hypothetical protein CISIN_1g0059002mg                  338   1e-109   Citrus sinensis [apfelsine]
ref|XP_011090256.1|  PREDICTED: molybdopterin biosynthesis protei...    341   2e-109   Sesamum indicum [beniseed]
ref|XP_010031620.1|  PREDICTED: molybdopterin biosynthesis protei...    340   1e-108   Eucalyptus grandis [rose gum]
ref|XP_006470155.1|  PREDICTED: molybdopterin biosynthesis protei...    338   4e-108   Citrus sinensis [apfelsine]
ref|XP_009765762.1|  PREDICTED: molybdopterin biosynthesis protei...    338   4e-108   Nicotiana sylvestris
ref|XP_006446683.1|  hypothetical protein CICLE_v10014503mg             338   4e-108   Citrus clementina [clementine]
ref|XP_004228477.1|  PREDICTED: molybdopterin biosynthesis protei...    338   5e-108   Solanum lycopersicum
ref|XP_006362730.1|  PREDICTED: molybdopterin biosynthesis protei...    338   6e-108   Solanum tuberosum [potatoes]
ref|XP_006362729.1|  PREDICTED: molybdopterin biosynthesis protei...    337   1e-107   
dbj|BAF00362.1|  molybdopterin biosynthesis CNX1 protein                325   1e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KDP42916.1|  hypothetical protein JCGZ_23858                         337   2e-107   Jatropha curcas
ref|XP_009601464.1|  PREDICTED: molybdopterin biosynthesis protei...    335   4e-107   Nicotiana tomentosiformis
gb|KJB55513.1|  hypothetical protein B456_009G080100                    334   1e-106   Gossypium raimondii
gb|KHG12135.1|  Molybdopterin biosynthesis CNX1 -like protein           333   4e-106   Gossypium arboreum [tree cotton]
ref|XP_007141599.1|  hypothetical protein PHAVU_008G209600g             331   2e-105   Phaseolus vulgaris [French bean]
ref|XP_011043840.1|  PREDICTED: molybdopterin biosynthesis protei...    330   2e-105   Populus euphratica
ref|XP_008451034.1|  PREDICTED: molybdopterin biosynthesis protei...    331   2e-105   Cucumis melo [Oriental melon]
ref|XP_011043834.1|  PREDICTED: molybdopterin biosynthesis protei...    330   3e-105   Populus euphratica
ref|XP_009376133.1|  PREDICTED: molybdopterin biosynthesis protei...    329   8e-105   
ref|XP_007141600.1|  hypothetical protein PHAVU_008G209600g             329   1e-104   Phaseolus vulgaris [French bean]
ref|XP_006379351.1|  hypothetical protein POPTR_0009s15810g             328   1e-104   
ref|XP_002312858.1|  hypothetical protein POPTR_0009s15810g             328   2e-104   
ref|NP_001242529.1|  molybdopterin biosynthesis protein CNX1-like       327   6e-104   Glycine max [soybeans]
gb|KHN38452.1|  Molybdopterin biosynthesis protein CNX1                 327   6e-104   Glycine soja [wild soybean]
dbj|BAJ33990.1|  unnamed protein product                                323   7e-104   Eutrema halophilum
gb|AAA97413.1|  molybdenum cofactor biosynthesis enzyme                 326   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491158.1|  PREDICTED: molybdopterin biosynthesis protei...    317   2e-103   
gb|EYU35987.1|  hypothetical protein MIMGU_mgv1a002507mg                325   3e-103   Erythranthe guttata [common monkey flower]
ref|XP_007015551.1|  Molybdopterin biosynthesis CNX1 protein / mo...    325   4e-103   
ref|XP_004491157.1|  PREDICTED: molybdopterin biosynthesis protei...    318   5e-103   
ref|XP_004291534.1|  PREDICTED: molybdopterin biosynthesis protei...    323   3e-102   Fragaria vesca subsp. vesca
ref|XP_010093278.1|  Molybdopterin biosynthesis protein CNX1            323   3e-102   Morus notabilis
ref|XP_002874027.1|  hypothetical protein ARALYDRAFT_489011             323   3e-102   
ref|XP_006400671.1|  hypothetical protein EUTSA_v10012894mg             323   3e-102   Eutrema salsugineum [saltwater cress]
ref|NP_197599.1|  molybdenum cofactor biosynthesis enzyme CNX1          323   3e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AFW59745.1|  viviparous10                                            313   3e-102   
emb|CDX70956.1|  BnaC03g10400D                                          322   7e-102   
ref|XP_010420950.1|  PREDICTED: molybdopterin biosynthesis protei...    322   9e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009131833.1|  PREDICTED: molybdopterin biosynthesis protei...    322   1e-101   Brassica rapa
ref|XP_007015553.1|  Molybdopterin biosynthesis CNX1 protein / mo...    320   1e-101   
gb|KFK26315.1|  hypothetical protein AALP_AA8G231600                    321   1e-101   Arabis alpina [alpine rockcress]
gb|KGN66381.1|  hypothetical protein Csa_1G600210                       317   2e-101   Cucumis sativus [cucumbers]
emb|CDP15575.1|  unnamed protein product                                321   2e-101   Coffea canephora [robusta coffee]
ref|XP_006286370.1|  hypothetical protein CARUB_v10000376mg             320   3e-101   
ref|XP_008787719.1|  PREDICTED: molybdopterin biosynthesis protei...    320   5e-101   Phoenix dactylifera
ref|XP_007204973.1|  hypothetical protein PRUPE_ppa002426mg             320   6e-101   Prunus persica
ref|XP_010685502.1|  PREDICTED: molybdopterin biosynthesis protei...    318   1e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003617060.1|  Molybdopterin biosynthesis CNX1 protein            318   1e-100   Medicago truncatula
emb|CDX88829.1|  BnaA03g08200D                                          318   2e-100   
ref|XP_010493217.1|  PREDICTED: molybdopterin biosynthesis protei...    318   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010926610.1|  PREDICTED: molybdopterin biosynthesis protei...    318   3e-100   Elaeis guineensis
ref|XP_004159365.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    317   6e-100   
ref|XP_004144145.1|  PREDICTED: molybdopterin biosynthesis protei...    317   6e-100   
ref|XP_010520491.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    317   9e-100   Tarenaya hassleriana [spider flower]
ref|XP_002447271.1|  hypothetical protein SORBIDRAFT_06g031680          316   9e-100   
ref|XP_009383824.1|  PREDICTED: molybdopterin biosynthesis protei...    316   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010454418.1|  PREDICTED: molybdopterin biosynthesis protei...    316   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006653844.1|  PREDICTED: molybdopterin biosynthesis protei...    315   2e-99    
ref|XP_010651619.1|  PREDICTED: molybdopterin biosynthesis protei...    312   3e-99    Vitis vinifera
emb|CAN65528.1|  hypothetical protein VITISV_026358                     310   6e-99    Vitis vinifera
ref|XP_009340227.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    310   8e-99    
ref|XP_004960170.1|  PREDICTED: molybdopterin biosynthesis protei...    313   9e-99    Setaria italica
emb|CAE04830.1|  OSJNBa0084K01.2                                        313   1e-98    Oryza sativa Japonica Group [Japonica rice]
emb|CBI24388.3|  unnamed protein product                                312   4e-98    Vitis vinifera
ref|XP_002276536.1|  PREDICTED: molybdopterin biosynthesis protei...    312   5e-98    Vitis vinifera
ref|XP_004517264.1|  PREDICTED: molybdopterin biosynthesis protei...    296   6e-98    
ref|NP_001168286.1|  viviparous10                                       311   8e-98    Zea mays [maize]
gb|ABB30174.1|  molybdenum cofactor biosynthesis protein                311   9e-98    Zea mays [maize]
ref|XP_003580744.1|  PREDICTED: molybdopterin biosynthesis protei...    302   4e-94    Brachypodium distachyon [annual false brome]
dbj|BAJ88077.1|  predicted protein                                      298   9e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02586.1|  predicted protein                                      298   9e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF73075.1|AF268595_1  molybdenum cofactor biosynthesis protei...    297   2e-92    Hordeum vulgare [barley]
pdb|1UUY|A  Chain A, Structure Of A Molybdopterin-Bound Cnx1g Dom...    280   7e-92    Arabidopsis thaliana [mouse-ear cress]
pdb|1O8Q|A  Chain A, The Active Site Of The Molybdenum Cofactor B...    280   7e-92    Arabidopsis thaliana [mouse-ear cress]
pdb|1O8N|A  Chain A, The Active Site Of The Molybdenum Cofactor B...    279   1e-91    Arabidopsis thaliana [mouse-ear cress]
pdb|1O8O|A  Chain A, The Active Site Of The Molybdenum Cofactor B...    279   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770478.1|  predicted protein                                  290   2e-89    
gb|ABR17730.1|  unknown                                                 288   8e-89    Picea sitchensis
pdb|1UUX|A  Chain A, Structure Of A Molybdopterin-Bound Cnx1g Dom...    272   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847466.1|  hypothetical protein AMTR_s00163p00018060          284   3e-87    Amborella trichopoda
ref|XP_008231326.1|  PREDICTED: molybdopterin biosynthesis protei...    273   3e-83    
ref|XP_010926611.1|  PREDICTED: molybdopterin biosynthesis protei...    273   5e-83    
pdb|1EAV|A  Chain A, Crystal Structures Of Human Gephyrin And Pla...    256   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973522.1|  hypothetical protein SELMODRAFT_149120             270   4e-82    
ref|XP_002975554.1|  hypothetical protein SELMODRAFT_150666             269   7e-82    
gb|EMT03164.1|  Molybdopterin biosynthesis protein CNX1                 257   6e-77    
ref|XP_010031621.1|  PREDICTED: molybdopterin biosynthesis protei...    216   3e-62    
ref|XP_008385638.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    211   4e-61    
gb|KEH28338.1|  molybdenum cofactor biosynthesis protein CNX1           208   3e-59    Medicago truncatula
gb|EPS62424.1|  hypothetical protein M569_12368                         189   6e-57    Genlisea aurea
ref|XP_009350884.1|  PREDICTED: molybdopterin biosynthesis protei...    202   7e-57    
ref|XP_007015554.1|  Molybdopterin biosynthesis CNX1 protein / mo...    201   1e-56    
ref|XP_010240846.1|  PREDICTED: molybdopterin biosynthesis protei...    183   6e-50    Nelumbo nucifera [Indian lotus]
ref|WP_036736197.1|  cytoplasmic protein                                153   2e-42    
ref|WP_013258696.1|  molybdenum cofactor synthesis domain-contain...    152   6e-42    Desulfarculus baarsii
gb|ACD50083.1|  molybdopterin biosynthesis enzyme                       152   8e-42    uncultured crenarchaeote MCG
pdb|1JLJ|A  Chain A, 1.6 Angstrom Crystal Structure Of The Human ...    152   1e-41    Homo sapiens [man]
pdb|1IHC|A  Chain A, X-Ray Structure Of Gephyrin N-Terminal Domain      152   2e-41    Rattus norvegicus [brown rat]
gb|EMS55337.1|  Molybdopterin biosynthesis protein CNX1                 159   4e-41    Triticum urartu
ref|WP_041287293.1|  cytoplasmic protein                                148   1e-40    
gb|AFM26240.1|  molybdopterin adenylyltransferase                       149   1e-40    Desulfomonile tiedjei DSM 6799
ref|WP_006980928.1|  molybdenum cofactor synthesis domain protein       148   2e-40    Chthoniobacter flavus
ref|WP_013707323.1|  molybdenum cofactor synthesis domain-contain...    148   2e-40    Desulfobacca acetoxidans
emb|CAI78652.1|  molybdopterin biosynthesis enzymes                     147   3e-40    uncultured delta proteobacterium
ref|XP_008863022.1|  hypothetical protein, variant 3                    156   4e-40    Aphanomyces invadans
ref|XP_008314898.1|  PREDICTED: gephyrin-like isoform X3                157   4e-40    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008863020.1|  hypothetical protein, variant 1                    156   5e-40    Aphanomyces invadans
ref|XP_008314890.1|  PREDICTED: gephyrin-like isoform X2                157   6e-40    Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_037464714.1|  cytoplasmic protein                                147   6e-40    
ref|XP_004881940.1|  PREDICTED: gephyrin-like                           152   6e-40    
ref|WP_014355808.1|  molybdenum cofactor biosynthesis protein MoaB      146   8e-40    Acetobacterium woodii
gb|EAW80925.1|  gephyrin, isoform CRA_c                                 152   8e-40    Homo sapiens [man]
ref|XP_006800724.1|  PREDICTED: gephyrin-like                           154   1e-39    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005461956.1|  PREDICTED: gephyrin-like isoform X4                155   2e-39    
ref|XP_005461953.1|  PREDICTED: gephyrin-like isoform X1                155   2e-39    
ref|XP_005751787.1|  PREDICTED: gephyrin-like isoform X2                154   2e-39    Pundamilia nyererei
ref|XP_007575455.1|  PREDICTED: gephyrin-like isoform X2                154   2e-39    
ref|XP_005812094.1|  PREDICTED: gephyrin-like                           154   3e-39    
ref|XP_003962333.1|  PREDICTED: gephyrin-like isoform 1                 154   3e-39    
ref|WP_013626116.1|  molybdopterin adenylyltransferase                  145   3e-39    Syntrophobotulus glycolicus
ref|XP_007575454.1|  PREDICTED: gephyrin-like isoform X1                154   3e-39    
ref|WP_027356596.1|  cytoplasmic protein                                145   3e-39    Desulfofundulus thermocisternus
ref|WP_009711043.1|  molybdopterin biosynthesis mog protein             145   4e-39    Thermoactinomycetaceae
ref|XP_005090818.1|  PREDICTED: uncharacterized protein LOC101848...    156   4e-39    
ref|XP_005751786.1|  PREDICTED: gephyrin-like isoform X1                154   4e-39    Pundamilia nyererei
ref|XP_004569994.1|  PREDICTED: gephyrin-like                           154   5e-39    
ref|XP_003962334.1|  PREDICTED: gephyrin-like isoform 2                 154   5e-39    Takifugu rubripes [tiger puffer]
gb|KIE17875.1|  cytoplasmic protein                                     144   5e-39    Smithella sp. SC_K08D17
ref|XP_005942199.1|  PREDICTED: gephyrin-like isoform X2                154   5e-39    Haplochromis burtoni
ref|NP_001125964.1|  gephyrin                                           151   5e-39    Pongo abelii [orang utan]
ref|WP_040663553.1|  cytoplasmic protein                                144   5e-39    Oscillibacter ruminantium
ref|WP_026370918.1|  cytoplasmic protein                                144   5e-39    bacterium JKG1
ref|WP_037380935.1|  MULTISPECIES: cytoplasmic protein                  144   5e-39    
ref|XP_005942198.1|  PREDICTED: gephyrin-like isoform X1                154   6e-39    Haplochromis burtoni
ref|XP_003707233.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin-like      152   6e-39    
ref|WP_014117170.1|  molybdenum cofactor biosynthesis protein           144   6e-39    Oscillibacter valericigenes
ref|XP_010743433.1|  PREDICTED: gephyrin-like isoform X2                153   7e-39    
ref|XP_007545562.1|  PREDICTED: gephyrin isoform X6                     152   8e-39    
ref|WP_037388918.1|  cytoplasmic protein                                144   8e-39    
ref|WP_039740847.1|  cytoplasmic protein                                144   8e-39    Geobacter pickeringii
ref|XP_001627768.1|  predicted protein                                  152   9e-39    Nematostella vectensis
ref|XP_004356987.1|  Gephyrin, putative                                 144   1e-38    Acanthamoeba castellanii str. Neff
ref|XP_009820958.1|  hypothetical protein, variant 1                    151   1e-38    Aphanomyces astaci
ref|XP_010743432.1|  PREDICTED: gephyrin-like isoform X1                153   1e-38    
ref|XP_008301210.1|  PREDICTED: gephyrin-like                           153   2e-38    Stegastes partitus
gb|ABC77449.1|  hypothetical cytosolic protein                          143   2e-38    Syntrophus aciditrophicus SB
ref|WP_041584862.1|  cytoplasmic protein                                143   2e-38    Syntrophus aciditrophicus
ref|XP_009820957.1|  hypothetical protein H257_00123                    151   2e-38    Aphanomyces astaci
ref|XP_007545554.1|  PREDICTED: gephyrin isoform X5                     152   2e-38    Poecilia formosa
ref|XP_007545531.1|  PREDICTED: gephyrin isoform X2                     152   2e-38    Poecilia formosa
ref|XP_010960581.1|  PREDICTED: gephyrin isoform X6                     152   2e-38    Camelus bactrianus [camel]
ref|XP_006207020.1|  PREDICTED: gephyrin isoform X5                     152   2e-38    Vicugna pacos
ref|XP_007545546.1|  PREDICTED: gephyrin isoform X4                     152   2e-38    
ref|XP_010960578.1|  PREDICTED: gephyrin isoform X3                     152   2e-38    Camelus bactrianus [camel]
ref|XP_005072876.1|  PREDICTED: gephyrin                                151   2e-38    
ref|XP_006207018.1|  PREDICTED: gephyrin isoform X3                     152   2e-38    
ref|XP_007545524.1|  PREDICTED: gephyrin isoform X1                     152   3e-38    Poecilia formosa
ref|XP_010960579.1|  PREDICTED: gephyrin isoform X4                     152   3e-38    Camelus bactrianus [camel]
ref|XP_010960582.1|  PREDICTED: gephyrin isoform X7                     152   3e-38    Camelus bactrianus [camel]
ref|XP_010960580.1|  PREDICTED: gephyrin isoform X5                     152   3e-38    Camelus bactrianus [camel]
ref|XP_006207017.1|  PREDICTED: gephyrin isoform X2                     152   3e-38    Vicugna pacos
ref|XP_004624968.1|  PREDICTED: gephyrin                                152   3e-38    
ref|XP_010960577.1|  PREDICTED: gephyrin isoform X2                     152   3e-38    Camelus bactrianus [camel]
ref|NP_074056.2|  gephyrin                                              152   3e-38    Rattus norvegicus [brown rat]
emb|CAC81240.1|  gephyrin                                               152   3e-38    Homo sapiens [man]
ref|XP_010960576.1|  PREDICTED: gephyrin isoform X1                     152   3e-38    Camelus bactrianus [camel]
ref|NP_001026720.1|  gephyrin                                           151   3e-38    
ref|NP_001019389.1|  gephyrin isoform 2                                 151   3e-38    Homo sapiens [man]
ref|XP_005803171.1|  PREDICTED: gephyrin-like isoform X5                151   3e-38    
ref|XP_005803167.1|  PREDICTED: gephyrin-like isoform X1                152   3e-38    
ref|XP_011382505.1|  PREDICTED: gephyrin isoform X3                     152   3e-38    Pteropus vampyrus
ref|XP_005803168.1|  PREDICTED: gephyrin-like isoform X2                152   3e-38    
ref|XP_008395704.1|  PREDICTED: gephyrin isoform X11                    152   3e-38    
ref|XP_005803169.1|  PREDICTED: gephyrin-like isoform X3                152   3e-38    
ref|XP_008395699.1|  PREDICTED: gephyrin isoform X6                     152   3e-38    
ref|XP_010586998.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin           151   3e-38    
ref|XP_005803170.1|  PREDICTED: gephyrin-like isoform X4                152   3e-38    
ref|XP_008171028.1|  PREDICTED: gephyrin isoform X8                     152   3e-38    
ref|XP_005267311.1|  PREDICTED: gephyrin isoform X5                     152   3e-38    Homo sapiens [man]
ref|XP_008137161.1|  PREDICTED: gephyrin isoform X4                     151   3e-38    Eptesicus fuscus
ref|XP_009004421.1|  PREDICTED: gephyrin isoform X8                     152   3e-38    Callithrix jacchus [common marmoset]
ref|XP_005149323.1|  PREDICTED: gephyrin isoform X2                     151   3e-38    Melopsittacus undulatus
ref|XP_008395702.1|  PREDICTED: gephyrin isoform X9                     152   3e-38    
ref|XP_008395700.1|  PREDICTED: gephyrin isoform X7                     152   3e-38    
ref|XP_005306754.1|  PREDICTED: gephyrin isoform X7                     152   3e-38    Chrysemys picta bellii
ref|XP_008395694.1|  PREDICTED: gephyrin isoform X1                     152   3e-38    
ref|XP_008395695.1|  PREDICTED: gephyrin isoform X2                     152   3e-38    
ref|XP_008395703.1|  PREDICTED: gephyrin isoform X10                    152   3e-38    
ref|XP_007525883.1|  PREDICTED: gephyrin isoform X3                     152   3e-38    Erinaceus europaeus [common hedgehog]
ref|XP_008137160.1|  PREDICTED: gephyrin isoform X3                     152   3e-38    
ref|XP_004397630.1|  PREDICTED: gephyrin isoform 3                      152   3e-38    Odobenus rosmarus divergens
ref|XP_010807867.1|  PREDICTED: gephyrin isoform X9                     152   3e-38    
ref|XP_004584525.1|  PREDICTED: gephyrin isoform X3                     152   3e-38    Ochotona princeps [southern American pika]
ref|XP_004477404.1|  PREDICTED: gephyrin                                151   3e-38    
ref|XP_008395697.1|  PREDICTED: gephyrin isoform X4                     152   3e-38    
ref|XP_005561586.1|  PREDICTED: gephyrin isoform X13                    152   4e-38    
ref|XP_006113471.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008976026.1|  PREDICTED: gephyrin isoform X4                     152   4e-38    Pan paniscus [bonobo]
ref|NP_766540.2|  gephyrin isoform 2                                    152   4e-38    Mus musculus [mouse]
dbj|BAC38476.1|  unnamed protein product                                152   4e-38    Mus musculus [mouse]
ref|XP_005343305.1|  PREDICTED: gephyrin isoform X5                     151   4e-38    
ref|XP_008395696.1|  PREDICTED: gephyrin isoform X3                     152   4e-38    
ref|XP_005230781.1|  PREDICTED: gephyrin isoform X1                     152   4e-38    Falco peregrinus [peregrine]
ref|XP_006734710.1|  PREDICTED: gephyrin                                151   4e-38    Leptonychotes weddellii
ref|XP_008395698.1|  PREDICTED: gephyrin isoform X5                     152   4e-38    
ref|XP_005306753.1|  PREDICTED: gephyrin isoform X6                     152   4e-38    Chrysemys picta bellii
ref|XP_002754063.1|  PREDICTED: gephyrin isoform X9                     152   4e-38    Callithrix jacchus [common marmoset]
ref|XP_001369816.1|  PREDICTED: gephyrin isoform X1                     152   4e-38    Monodelphis domestica
dbj|BAG37944.1|  unnamed protein product                                151   4e-38    Homo sapiens [man]
ref|XP_007184373.1|  PREDICTED: gephyrin isoform X5                     152   4e-38    Balaenoptera acutorostrata scammoni
ref|XP_005961617.1|  PREDICTED: gephyrin isoform X2                     152   4e-38    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003435079.1|  PREDICTED: gephyrin isoformX1                      152   4e-38    Canis lupus familiaris [dogs]
ref|XP_005004834.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin           152   4e-38    Cavia porcellus [guinea pig]
ref|XP_005306752.1|  PREDICTED: gephyrin isoform X5                     152   4e-38    
ref|XP_007940487.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Orycteropus afer afer
ref|XP_007184374.1|  PREDICTED: gephyrin isoform X6                     151   4e-38    Balaenoptera acutorostrata scammoni
ref|XP_005149322.1|  PREDICTED: gephyrin isoform X1                     151   4e-38    Melopsittacus undulatus
ref|XP_003586638.1|  PREDICTED: gephyrin isoform X8                     151   4e-38    Bos taurus [bovine]
ref|NP_001230231.1|  gephyrin                                           151   4e-38    Sus scrofa [pigs]
ref|XP_004426312.1|  PREDICTED: gephyrin isoform 1                      151   4e-38    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_065857.1|  gephyrin isoform 1                                    151   4e-38    Homo sapiens [man]
ref|XP_011281583.1|  PREDICTED: gephyrin isoform X4                     151   4e-38    Felis catus [cat]
ref|XP_004837433.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Heterocephalus glaber [naked mole rat]
dbj|BAI68421.1|  gephyrin1                                              151   4e-38    Danio rerio [leopard danio]
ref|XP_005877967.1|  PREDICTED: gephyrin isoform X3                     151   4e-38    Myotis brandtii
ref|XP_011382489.1|  PREDICTED: gephyrin isoform X1                     151   4e-38    Pteropus vampyrus
ref|XP_007985215.1|  PREDICTED: gephyrin isoform X26                    152   4e-38    Chlorocebus sabaeus
ref|XP_008137159.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Eptesicus fuscus
ref|XP_005399155.1|  PREDICTED: gephyrin-like isoform X6                151   4e-38    Chinchilla lanigera
ref|XP_004739021.1|  PREDICTED: gephyrin isoform X5                     151   4e-38    Mustela putorius furo [black ferret]
ref|XP_004681826.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Condylura cristata
ref|NP_666077.2|  gephyrin isoform 1                                    151   4e-38    Mus musculus [mouse]
ref|XP_005561587.1|  PREDICTED: gephyrin isoform X14                    151   4e-38    Macaca fascicularis [crab eating macaque]
ref|XP_006973191.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Peromyscus maniculatus bairdii
ref|XP_006515967.1|  PREDICTED: gephyrin isoform X6                     152   4e-38    Mus musculus [mouse]
ref|XP_004837432.1|  PREDICTED: gephyrin isoform X1                     152   4e-38    
ref|XP_008850363.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Nannospalax galili
ref|XP_005561591.1|  PREDICTED: gephyrin isoform X18                    151   4e-38    
ref|XP_005343303.1|  PREDICTED: gephyrin isoform X3                     151   4e-38    Microtus ochrogaster [prairie voles]
ref|XP_004612402.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Sorex araneus [Eurasian shrew]
dbj|BAA92623.1|  KIAA1385 protein                                       151   4e-38    
ref|XP_005520407.1|  PREDICTED: gephyrin isoform X1                     151   4e-38    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004397629.1|  PREDICTED: gephyrin isoform 2                      151   4e-38    Odobenus rosmarus divergens
ref|XP_009004415.1|  PREDICTED: gephyrin isoform X3                     152   4e-38    Callithrix jacchus [common marmoset]
ref|XP_005306750.1|  PREDICTED: gephyrin isoform X2                     152   4e-38    Chrysemys picta bellii
ref|XP_007449084.1|  PREDICTED: gephyrin isoform X3                     151   4e-38    Lipotes vexillifer [baiji]
ref|XP_010643623.1|  PREDICTED: gephyrin isoform X1                     151   4e-38    Fukomys damarensis [Damara mole rat]
ref|XP_004584524.1|  PREDICTED: gephyrin isoform X2                     151   4e-38    Ochotona princeps [southern American pika]
ref|XP_005399151.1|  PREDICTED: gephyrin-like isoform X2                152   4e-38    
ref|XP_004371016.1|  PREDICTED: gephyrin isoform 1                      151   4e-38    Trichechus manatus latirostris
ref|XP_008171027.1|  PREDICTED: gephyrin isoform X3                     152   5e-38    
ref|XP_007614396.1|  PREDICTED: uncharacterized protein LOC100762...    149   5e-38    
ref|XP_007184369.1|  PREDICTED: gephyrin isoform X1                     152   5e-38    Balaenoptera acutorostrata scammoni
ref|XP_006973190.1|  PREDICTED: gephyrin isoform X1                     151   5e-38    
ref|XP_008395701.1|  PREDICTED: gephyrin isoform X8                     152   5e-38    
ref|XP_009426249.1|  PREDICTED: gephyrin isoform X11                    152   5e-38    
ref|XP_005322862.1|  PREDICTED: gephyrin isoform X4                     151   5e-38    
ref|XP_004797265.1|  PREDICTED: gephyrin isoform X2                     151   5e-38    
ref|XP_006720066.1|  PREDICTED: gephyrin isoform X6                     151   5e-38    
ref|XP_010807863.1|  PREDICTED: gephyrin isoform X4                     151   5e-38    
ref|XP_005623589.1|  PREDICTED: gephyrin isoform X5                     151   5e-38    
ref|XP_006113470.1|  PREDICTED: gephyrin isoform X1                     151   5e-38    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005267307.1|  PREDICTED: gephyrin isoform X1                     151   5e-38    
ref|XP_004699062.1|  PREDICTED: gephyrin                                151   5e-38    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007473123.1|  PREDICTED: gephyrin isoform X5                     151   5e-38    Monodelphis domestica
ref|XP_005306749.1|  PREDICTED: gephyrin isoform X1                     152   5e-38    
ref|XP_006515962.1|  PREDICTED: gephyrin isoform X1                     152   5e-38    Mus musculus [mouse]
ref|XP_007985189.1|  PREDICTED: gephyrin isoform X2                     152   5e-38    Chlorocebus sabaeus
ref|XP_005306751.1|  PREDICTED: gephyrin isoform X4                     151   5e-38    
ref|WP_013823924.1|  molybdenum cofactor synthesis domain-contain...    142   5e-38    
ref|XP_007473122.1|  PREDICTED: gephyrin isoform X4                     151   5e-38    
ref|XP_005877970.1|  PREDICTED: gephyrin isoform X6                     151   5e-38    Myotis brandtii
ref|XP_004739017.1|  PREDICTED: gephyrin isoform X1                     151   5e-38    
ref|XP_005561575.1|  PREDICTED: gephyrin isoform X2                     152   5e-38    
dbj|BAI68423.1|  gephyrin1 isoform                                      151   5e-38    Danio rerio [leopard danio]
ref|WP_027636642.1|  cytoplasmic protein                                142   5e-38    Clostridium butyricum
ref|XP_007449082.1|  PREDICTED: gephyrin isoform X1                     151   6e-38    
ref|NP_001170915.1|  gephyrin                                           151   6e-38    
ref|XP_008976023.1|  PREDICTED: gephyrin isoform X1                     151   6e-38    
dbj|BAI68422.1|  gephyrin1 isoform                                      151   6e-38    
gb|EDM03692.1|  rCG61772, isoform CRA_b                                 150   6e-38    
ref|XP_004550514.1|  PREDICTED: gephyrin-like isoform X3                151   6e-38    
ref|NP_001096372.1|  gephyrin                                           149   6e-38    
ref|XP_008311622.1|  PREDICTED: gephyrin isoform X4                     150   6e-38    
ref|XP_004649707.1|  PREDICTED: gephyrin                                151   7e-38    
ref|XP_006792666.1|  PREDICTED: gephyrin-like isoform X5                151   7e-38    
ref|XP_008274970.1|  PREDICTED: gephyrin                                150   7e-38    
ref|XP_003446336.1|  PREDICTED: gephyrin-like isoformX2                 151   7e-38    
ref|XP_004550512.1|  PREDICTED: gephyrin-like isoform X1                151   7e-38    
ref|XP_003446335.1|  PREDICTED: gephyrin-like isoformX1                 150   7e-38    
ref|XP_008311621.1|  PREDICTED: gephyrin isoform X3                     151   7e-38    
ref|XP_003797434.1|  PREDICTED: gephyrin isoform 1                      150   7e-38    
ref|XP_005991535.1|  PREDICTED: gephyrin isoform X6                     150   8e-38    
ref|XP_004550515.1|  PREDICTED: gephyrin-like isoform X4                150   8e-38    
ref|XP_005921715.1|  PREDICTED: gephyrin-like                           150   8e-38    
ref|XP_008311619.1|  PREDICTED: gephyrin isoform X1                     151   8e-38    
ref|XP_009563318.1|  PREDICTED: gephyrin                                150   8e-38    
ref|XP_010895559.1|  PREDICTED: gephyrin-like                           151   8e-38    
ref|XP_008311620.1|  PREDICTED: gephyrin isoform X2                     150   9e-38    
ref|XP_006632748.1|  PREDICTED: gephyrin-like                           150   9e-38    
ref|XP_003224913.2|  PREDICTED: gephyrin                                151   9e-38    
gb|EDM03691.1|  rCG61772, isoform CRA_a                                 150   9e-38    
dbj|BAI68425.1|  gephyrin2                                              150   1e-37    
ref|XP_008863021.1|  hypothetical protein, variant 2                    149   1e-37    
ref|XP_010880835.1|  PREDICTED: gephyrin isoform X6                     150   1e-37    
ref|NP_001165871.1|  gephyrin b                                         150   1e-37    
ref|XP_003971787.1|  PREDICTED: gephyrin-like isoform 1                 150   1e-37    
ref|WP_041082573.1|  cytoplasmic protein                                141   1e-37    
ref|XP_003971788.1|  PREDICTED: gephyrin-like isoform 2                 150   1e-37    
ref|XP_010736720.1|  PREDICTED: gephyrin                                150   1e-37    
ref|XP_005991534.1|  PREDICTED: gephyrin isoform X5                     150   1e-37    
ref|XP_005991531.1|  PREDICTED: gephyrin isoform X2                     150   1e-37    
ref|XP_005991532.1|  PREDICTED: gephyrin isoform X3                     150   1e-37    
ref|XP_007255545.1|  PREDICTED: gephyrin isoform X6                     150   1e-37    
ref|XP_007255543.1|  PREDICTED: gephyrin isoform X4                     150   1e-37    
ref|XP_007255546.1|  PREDICTED: gephyrin isoform X7                     150   1e-37    
ref|XP_007255542.1|  PREDICTED: gephyrin isoform X3                     150   1e-37    
ref|XP_005991530.1|  PREDICTED: gephyrin isoform X1                     150   1e-37    
ref|XP_010880833.1|  PREDICTED: gephyrin isoform X4                     150   1e-37    
ref|XP_010880834.1|  PREDICTED: gephyrin isoform X5                     150   1e-37    
ref|XP_005322859.1|  PREDICTED: gephyrin isoform X1                     150   1e-37    
ref|XP_007255544.1|  PREDICTED: gephyrin isoform X5                     150   1e-37    
ref|XP_007255541.1|  PREDICTED: gephyrin isoform X2                     150   1e-37    
ref|XP_007255540.1|  PREDICTED: gephyrin isoform X1                     150   1e-37    
ref|XP_005991533.1|  PREDICTED: gephyrin isoform X4                     150   1e-37    
ref|XP_010880832.1|  PREDICTED: gephyrin isoform X3                     150   2e-37    
ref|XP_008863013.1|  hypothetical protein H310_01631                    149   2e-37    
ref|XP_010880831.1|  PREDICTED: gephyrin isoform X2                     150   2e-37    
ref|XP_010880830.1|  PREDICTED: gephyrin isoform X1                     150   2e-37    
ref|XP_009051623.1|  hypothetical protein LOTGIDRAFT_103927             140   2e-37    
ref|WP_003425841.1|  molybdenum cofactor synthesis protein              140   2e-37    
ref|WP_015261698.1|  molybdopterin adenylyltransferase                  140   2e-37    
gb|EFX82014.1|  hypothetical protein DAPPUDRAFT_317081                  148   3e-37    
ref|WP_002580709.1|  molybdenum cofactor biosynthesis protein B         139   3e-37    
ref|NP_001085376.1|  MGC83148 protein                                   149   4e-37    
ref|XP_011276879.1|  putative gephyrin                                  147   4e-37    
ref|WP_013163307.1|  molybdenum cofactor synthesis domain protein       139   4e-37    
ref|WP_040199703.1|  cytoplasmic protein                                139   4e-37    
ref|WP_034122161.1|  cytoplasmic protein                                139   4e-37    
ref|WP_026394442.1|  cytoplasmic protein                                139   5e-37    
ref|WP_014551937.1|  molybdopterin adenylyltransferase MoaB             139   5e-37    
tpg|DAA35544.1|  TPA: hypothetical protein ZEAMMB73_028448              144   5e-37    
ref|WP_022854836.1|  molybdenum cofactor biosynthesis protein MoaB      139   5e-37    
ref|NP_001090459.1|  gephyrin                                           149   5e-37    
ref|WP_026962739.1|  hypothetical protein                               139   6e-37    
ref|WP_022853116.1|  molybdenum cofactor biosynthesis protein MoaB      139   6e-37    
ref|WP_033119864.1|  cytoplasmic protein                                139   7e-37    
ref|WP_015326915.1|  molybdenum cofactor synthesis domain protein       139   7e-37    
ref|NP_001122752.1|  molybdenum cofactor synthesis protein cinnamon     147   8e-37    
ref|WP_028119809.1|  hypothetical protein                               139   8e-37    
gb|KDO33385.1|  hypothetical protein SPRG_02192                         146   8e-37    
ref|XP_008615186.1|  hypothetical protein SDRG_10947                    146   9e-37    
ref|WP_021749836.1|  MULTISPECIES: molybdenum cofactor synthesis ...    138   1e-36    
ref|WP_021738416.1|  molybdenum cofactor synthesis domain protein       138   1e-36    
ref|WP_013908130.1|  molybdenum cofactor synthesis domain-contain...    138   1e-36    
ref|WP_028841249.1|  cytoplasmic protein                                138   1e-36    
ref|WP_038060338.1|  cytoplasmic protein                                138   1e-36    
ref|WP_022036283.1|  hypothetical protein                               138   1e-36    
ref|WP_040620439.1|  cytoplasmic protein                                138   2e-36    
tpg|DAA25101.1|  TPA: gephyrin                                          142   2e-36    
gb|AAI11251.1|  Gephyrin                                                142   2e-36    
ref|XP_011062644.1|  PREDICTED: gephyrin                                145   2e-36    
ref|XP_009632433.1|  PREDICTED: gephyrin                                147   2e-36    
ref|WP_015758403.1|  molybdenum cofactor synthesis domain-contain...    137   2e-36    
ref|WP_035803798.1|  cytoplasmic protein                                137   2e-36    
ref|XP_009293282.1|  PREDICTED: gephyrin-like                           142   2e-36    
ref|WP_041720516.1|  cytoplasmic protein                                137   3e-36    
emb|CAG03546.1|  unnamed protein product                                147   3e-36    
ref|WP_035612536.1|  molybdopterin adenylyltransferase                  137   4e-36    
ref|WP_022939555.1|  hypothetical protein                               137   4e-36    
ref|WP_040366140.1|  cytoplasmic protein                                137   4e-36    
ref|WP_007596046.1|  molybdopterin biosynthesis protein                 140   4e-36    
gb|KFQ75480.1|  Gephyrin                                                144   5e-36    
ref|WP_013910221.1|  molybdenum cofactor synthesis domain-contain...    136   5e-36    
ref|XP_005461955.1|  PREDICTED: gephyrin-like isoform X3                146   5e-36    
ref|XP_002199469.1|  PREDICTED: gephyrin                                146   5e-36    
gb|EGT47189.1|  CBN-MOC-2 protein                                       136   6e-36    
ref|WP_013119650.1|  molybdenum cofactor synthesis domain-contain...    136   6e-36    
ref|XP_003697201.1|  PREDICTED: gephyrin-like                           144   6e-36    
ref|WP_013275110.1|  molybdenum cofactor biosynthesis protein           140   6e-36    
ref|WP_035523037.1|  molybdopterin adenylyltransferase                  137   6e-36    
ref|WP_038351311.1|  cytoplasmic protein                                136   6e-36    
ref|XP_005605587.1|  PREDICTED: gephyrin                                145   7e-36    
ref|WP_007912804.1|  molybdenum cofactor synthesis domain protein       136   7e-36    
ref|WP_013380974.1|  molybdopterin adenylyltransferase                  136   8e-36    
ref|XP_010138832.1|  PREDICTED: gephyrin-like                           140   8e-36    
ref|WP_036938749.1|  cytoplasmic protein                                136   8e-36    
ref|XP_010285902.1|  PREDICTED: gephyrin                                143   8e-36    
ref|WP_008539029.1|  molybdenum cofactor biosynthesis protein B         136   8e-36    
ref|XP_005441200.1|  PREDICTED: gephyrin                                145   1e-35    
ref|WP_034215363.1|  molybdopterin biosynthesis protein                 140   1e-35    
ref|XP_005047272.1|  PREDICTED: gephyrin                                145   1e-35    
ref|WP_022228690.1|  molybdenum cofactor synthesis domain-contain...    135   1e-35    
ref|XP_004208356.1|  PREDICTED: gephyrin-like                           144   1e-35    
ref|WP_012281235.1|  molybdenum cofactor biosynthesis protein           135   1e-35    
ref|XP_008059267.1|  PREDICTED: gephyrin-like                           137   1e-35    
ref|WP_031517960.1|  cytoplasmic protein                                135   1e-35    
ref|WP_018998610.1|  molybdenum cofactor biosynthesis protein B         135   1e-35    
gb|EXX61117.1|  hypothetical protein RirG_174070                        142   2e-35    
gb|KFW75041.1|  Gephyrin                                                144   2e-35    
ref|WP_009662908.1|  molybdopterin biosynthesis protein                 139   2e-35    
ref|WP_038055453.1|  cytoplasmic protein                                135   2e-35    
ref|XP_007640584.1|  PREDICTED: gephyrin isoform X2                     142   2e-35    
gb|KFM10386.1|  Gephyrin                                                143   2e-35    
ref|WP_026176793.1|  cytoplasmic protein                                135   2e-35    
ref|XP_008926005.1|  PREDICTED: gephyrin                                143   2e-35    
ref|XP_005502495.1|  PREDICTED: gephyrin                                144   2e-35    
ref|XP_007113962.1|  PREDICTED: gephyrin-like                           140   2e-35    
gb|KFR07161.1|  Gephyrin                                                143   2e-35    
emb|CCH47337.1|  Molybdenum cofactor synthesis domain protein           137   2e-35    
ref|XP_008637951.1|  PREDICTED: gephyrin                                144   2e-35    
gb|ERZ95706.1|  hypothetical protein GLOINDRAFT_309062                  142   3e-35    
ref|WP_011393622.1|  molybdopterin adenylyltransferase                  134   3e-35    
ref|XP_010006035.1|  PREDICTED: gephyrin                                144   3e-35    
gb|ERE72902.1|  gephyrin-like protein                                   144   3e-35    
gb|EAT16869.1|  molybdopterin-guanine dinucleotide biosynthesis p...    139   3e-35    
gb|KFO24184.1|  Gephyrin                                                144   3e-35    
ref|XP_007985214.1|  PREDICTED: gephyrin isoform X25                    143   3e-35    
ref|WP_013976529.1|  molybdenum cofactor biosynthesis protein B         134   3e-35    
gb|EMC83799.1|  Gephyrin                                                143   3e-35    
ref|XP_006623825.1|  PREDICTED: gephyrin-like isoform X3                140   3e-35    
gb|EOB08497.1|  Gephyrin                                                143   3e-35    
gb|ELK09870.1|  Gephyrin                                                143   3e-35    
ref|XP_009013594.1|  hypothetical protein HELRODRAFT_74817              143   3e-35    
gb|EDL02616.1|  gephyrin                                                143   3e-35    
ref|XP_009078535.1|  PREDICTED: gephyrin-like                           137   3e-35    
gb|ELR59365.1|  Gephyrin                                                143   3e-35    
ref|WP_005945966.1|  MULTISPECIES: molybdenum cofactor biosynthes...    134   4e-35    
ref|XP_011175977.1|  PREDICTED: gephyrin isoform X3                     142   4e-35    
ref|WP_034107018.1|  cytoplasmic protein                                134   4e-35    
ref|XP_009881803.1|  PREDICTED: gephyrin                                143   4e-35    
ref|XP_011175975.1|  PREDICTED: gephyrin isoform X1                     142   4e-35    
ref|XP_009930116.1|  PREDICTED: gephyrin                                143   4e-35    
ref|XP_005417698.1|  PREDICTED: gephyrin                                143   4e-35    
ref|WP_014793239.1|  molybdopterin adenylyltransferase                  134   4e-35    
emb|CDS14290.1|  hypothetical protein LRAMOSA06460                      142   5e-35    
ref|XP_009472118.1|  PREDICTED: gephyrin                                143   5e-35    
ref|WP_023345840.1|  hypothetical protein                               134   5e-35    
ref|XP_011405613.1|  PREDICTED: gephyrin-like                           141   5e-35    
ref|XP_006207016.1|  PREDICTED: gephyrin isoform X1                     143   5e-35    
ref|WP_040770258.1|  molybdopterin adenylyltransferase                  134   5e-35    
ref|XP_010389350.1|  PREDICTED: gephyrin isoform X16                    143   5e-35    
ref|XP_010389409.1|  PREDICTED: gephyrin isoform X23                    142   5e-35    
ref|XP_010389401.1|  PREDICTED: gephyrin isoform X22                    142   5e-35    
ref|XP_007244723.1|  PREDICTED: gephyrin-like isoform X7                142   6e-35    
ref|WP_025773373.1|  cytoplasmic protein                                134   6e-35    
ref|WP_026841991.1|  cytoplasmic protein                                134   6e-35    
ref|WP_038090503.1|  hypothetical protein                               134   6e-35    
gb|ETP21734.1|  hypothetical protein, variant 1                         140   6e-35    
ref|XP_010389322.1|  PREDICTED: gephyrin isoform X13                    143   6e-35    
gb|ETM51547.1|  hypothetical protein, variant 1                         140   6e-35    
gb|ETK91816.1|  hypothetical protein, variant 1                         140   6e-35    
ref|XP_010389386.1|  PREDICTED: gephyrin isoform X20                    142   6e-35    
ref|XP_009319275.1|  PREDICTED: gephyrin                                143   6e-35    
gb|ETP21736.1|  hypothetical protein, variant 3                         140   6e-35    
gb|ETI51955.1|  hypothetical protein, variant 3                         140   6e-35    
gb|ETI51953.1|  hypothetical protein, variant 1                         140   6e-35    
ref|XP_008902164.1|  hypothetical protein, variant 1                    140   6e-35    
gb|ETM51549.1|  hypothetical protein, variant 3                         140   6e-35    
ref|XP_007184377.1|  PREDICTED: gephyrin isoform X9                     142   6e-35    
ref|WP_019849816.1|  molybdenum cofactor biosynthesis protein MoaB      134   6e-35    
gb|ETK91818.1|  hypothetical protein, variant 3                         140   6e-35    
ref|XP_008902162.1|  hypothetical protein, variant 3                    140   6e-35    
ref|XP_006891897.1|  PREDICTED: gephyrin-like                           141   6e-35    
ref|WP_011343735.1|  molybdenum cofactor synthesis domain-contain...    134   7e-35    
ref|XP_007244720.1|  PREDICTED: gephyrin-like isoform X4                143   7e-35    
ref|XP_007244719.1|  PREDICTED: gephyrin-like isoform X3                143   7e-35    
gb|ERE72900.1|  gephyrin-like protein                                   143   7e-35    
ref|XP_007244722.1|  PREDICTED: gephyrin-like isoform X6                142   7e-35    
gb|KFO96184.1|  Gephyrin                                                142   7e-35    
ref|XP_010389417.1|  PREDICTED: gephyrin isoform X24                    142   7e-35    
ref|XP_003402227.1|  PREDICTED: gephyrin-like                           141   7e-35    
ref|XP_010389378.1|  PREDICTED: gephyrin isoform X19                    142   7e-35    
ref|XP_009281820.1|  PREDICTED: gephyrin                                142   7e-35    
ref|XP_006515969.1|  PREDICTED: gephyrin isoform X8                     142   7e-35    
sp|Q03555.3|GEPH_RAT  RecName: Full=Gephyrin; AltName: Full=Putat...    142   7e-35    
ref|XP_001135362.2|  PREDICTED: gephyrin isoform X15                    142   7e-35    
ref|XP_009004417.1|  PREDICTED: gephyrin isoform X5                     142   7e-35    
ref|XP_007886279.1|  PREDICTED: gephyrin isoform X1                     142   7e-35    
ref|XP_005961616.1|  PREDICTED: gephyrin isoform X1                     142   7e-35    
ref|XP_007244717.1|  PREDICTED: gephyrin-like isoform X1                143   7e-35    
ref|XP_007525881.1|  PREDICTED: gephyrin isoform X1                     142   7e-35    
ref|XP_004584523.1|  PREDICTED: gephyrin isoform X1                     142   7e-35    
ref|XP_010709863.1|  PREDICTED: gephyrin isoform X7                     142   7e-35    
ref|XP_007244718.1|  PREDICTED: gephyrin-like isoform X2                142   8e-35    
ref|XP_008137157.1|  PREDICTED: gephyrin isoform X1                     142   8e-35    
ref|XP_007940486.1|  PREDICTED: gephyrin isoform X1                     142   8e-35    
ref|XP_007886280.1|  PREDICTED: gephyrin isoform X2                     142   8e-35    
ref|WP_026964874.1|  hypothetical protein                               133   8e-35    
ref|XP_010389246.1|  PREDICTED: gephyrin isoform X3                     142   8e-35    
ref|XP_004739019.1|  PREDICTED: gephyrin isoform X3                     142   8e-35    
ref|XP_010807866.1|  PREDICTED: gephyrin isoform X7                     142   8e-35    
ref|XP_007184371.1|  PREDICTED: gephyrin isoform X3                     142   8e-35    
ref|XP_005623591.1|  PREDICTED: gephyrin isoform X7                     142   8e-35    
ref|XP_008698909.1|  PREDICTED: gephyrin isoform X3                     142   8e-35    
ref|XP_009004420.1|  PREDICTED: gephyrin isoform X7                     142   8e-35    
ref|XP_011505334.1|  PREDICTED: gephyrin                                141   8e-35    



>ref|XP_002515854.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
 gb|EEF46523.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
Length=668

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSE+LGGARVV+TAVVPDD+ KI+D+L 
Sbjct  468  EFRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSEKLGGARVVSTAVVPDDVSKIKDVLQ  527

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            RW DID MDL+LTLGGTG +PRDVTPEATK ++QKETPGLL+ MMQESLK+TPFAMLSR 
Sbjct  528  RWSDIDGMDLILTLGGTGFTPRDVTPEATKEVIQKETPGLLYAMMQESLKVTPFAMLSRS  587

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNA AECME LLPALKHALKQI+GDKREK+PRH+PHA A   DT
Sbjct  588  AAGIRGSTLIINMPGNPNAAAECMEALLPALKHALKQIKGDKREKHPRHIPHAQAATVDT  647

Query  206  WERSHKLAS-IGEEPTCSCSH  147
            WERS+KLAS +  EP+CSCSH
Sbjct  648  WERSYKLASRVSPEPSCSCSH  668



>ref|XP_006446684.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
 gb|ESR59924.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
Length=489

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E  VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L
Sbjct  288  TEFSVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVL  347

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR
Sbjct  348  RRWSDIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSR  407

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP D
Sbjct  408  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVD  467

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWE S+K++S  G EP+CSCSH
Sbjct  468  TWEHSYKMSSGGGTEPSCSCSH  489



>gb|KDO47642.1| hypothetical protein CISIN_1g0059002mg [Citrus sinensis]
 gb|KDO47643.1| hypothetical protein CISIN_1g0059002mg [Citrus sinensis]
Length=489

 Score =   337 bits (864),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E  VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L
Sbjct  288  TEFSVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVL  347

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR
Sbjct  348  RRWSDIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSR  407

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP D
Sbjct  408  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVD  467

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWE S+K++S  G EP+CSCSH
Sbjct  468  TWEHSYKMSSGGGTEPSCSCSH  489



>gb|KDO47640.1| hypothetical protein CISIN_1g0059002mg, partial [Citrus sinensis]
 gb|KDO47641.1| hypothetical protein CISIN_1g0059002mg, partial [Citrus sinensis]
Length=519

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E  VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L
Sbjct  318  TEFSVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVL  377

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR
Sbjct  378  RRWSDIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSR  437

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP D
Sbjct  438  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVD  497

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWE S+K++S  G EP+CSCSH
Sbjct  498  TWEHSYKMSSGGGTEPSCSCSH  519



>ref|XP_011090256.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Sesamum indicum]
Length=660

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 183/202 (91%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE +VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGARV  TAVVPD+I KI++ L
Sbjct  459  SEFKVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGARVAATAVVPDEIPKIKEAL  518

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW D+D MDL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMMQESLK+TPFAMLSR
Sbjct  519  ERWSDVDKMDLILTLGGTGCTPRDVTPEATKEVIQKETPGLLYVMMQESLKVTPFAMLSR  578

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PHA A P D
Sbjct  579  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHIPHAQAAPTD  638

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWERS+KLAS   +E  CSCSH
Sbjct  639  TWERSYKLASGAAQETGCSCSH  660



>ref|XP_010031620.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Eucalyptus grandis]
 gb|KCW50985.1| hypothetical protein EUGRSUZ_J00614 [Eucalyptus grandis]
Length=669

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVA+GAGPDRSGPRAV+VVNSSSERLGGARV  TAVVPD++ KI+DIL RW
Sbjct  471  RVAILTVSDTVASGAGPDRSGPRAVTVVNSSSERLGGARVAATAVVPDEVAKIKDILQRW  530

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D+D MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  531  ADVDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  590

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGS+LIINMPGNPNAVAECM+ LLPALKHALKQI+GDKREK+PRHVPHA AVPADTWE
Sbjct  591  GIRGSSLIINMPGNPNAVAECMDALLPALKHALKQIKGDKREKHPRHVPHAQAVPADTWE  650

Query  200  RSHKLASIGE-EPTCSCSH  147
             S+K AS GE E  CSCSH
Sbjct  651  HSYKSASGGETERGCSCSH  669



>ref|XP_006470155.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Citrus 
sinensis]
Length=671

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E  VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L
Sbjct  470  TEFSVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVL  529

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR
Sbjct  530  RRWSDIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSR  589

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP D
Sbjct  590  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVD  649

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWE S+K++S  G EP+CSCSH
Sbjct  650  TWEHSYKMSSGGGTEPSCSCSH  671



>ref|XP_009765762.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
sylvestris]
Length=667

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE RVAILTVSDTVAAG GPDRSGPRAVSVVNSSSERLGG  VV TAVVPDD QKI+++L
Sbjct  466  SEFRVAILTVSDTVAAGLGPDRSGPRAVSVVNSSSERLGGTSVVATAVVPDDEQKIKNML  525

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
              W D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR
Sbjct  526  QMWSDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSR  585

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQ+RGDKREK+PRHVPHA A P D
Sbjct  586  AAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVRGDKREKHPRHVPHAQAAPTD  645

Query  209  TWERSHKLASIG-EEPTCSCSH  147
            TWERS+KLAS G EE  CSCSH
Sbjct  646  TWERSYKLASSGVEEHGCSCSH  667



>ref|XP_006446683.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
 gb|ESR59923.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
Length=671

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E  VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L
Sbjct  470  TEFSVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVL  529

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR
Sbjct  530  RRWSDIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSR  589

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP D
Sbjct  590  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVD  649

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWE S+K++S  G EP+CSCSH
Sbjct  650  TWEHSYKMSSGGGTEPSCSCSH  671



>ref|XP_004228477.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Solanum lycopersicum]
Length=670

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE +VAILTVSDTVA G GPDRSGPRAVSVVN+SSERLGG  +V TAVVPDD+QKI+D+L
Sbjct  469  SEFKVAILTVSDTVATGLGPDRSGPRAVSVVNASSERLGGTSIVATAVVPDDVQKIKDML  528

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR
Sbjct  529  QKWSDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSR  588

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRH+PHA A P D
Sbjct  589  AAAGIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHIPHAQAAPTD  648

Query  209  TWERSHKLAS-IGEEPTCSCSH  147
            TWERS+KLAS  GEE  CSCSH
Sbjct  649  TWERSYKLASGGGEEHGCSCSH  670



>ref|XP_006362730.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X2 [Solanum tuberosum]
Length=670

 Score =   338 bits (866),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE +VAILTVSDTVA G GPDRSGPRAVSVVN+SSERLGG  +V TAVVPDD+QKI+D+L
Sbjct  469  SEFKVAILTVSDTVATGLGPDRSGPRAVSVVNASSERLGGTSIVATAVVPDDVQKIKDML  528

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR
Sbjct  529  QKWSDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSR  588

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRH+PHA A P D
Sbjct  589  AAAGIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHIPHAQAAPTD  648

Query  209  TWERSHKLASI-GEEPTCSCSH  147
            TWERS+KL+S  GEE  CSCSH
Sbjct  649  TWERSYKLSSSGGEEHGCSCSH  670



>ref|XP_006362729.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE +VAILTVSDTVA G GPDRSGPRAVSVVN+SSERLGG  +V TAVVPDD+QKI+D+L
Sbjct  484  SEFKVAILTVSDTVATGLGPDRSGPRAVSVVNASSERLGGTSIVATAVVPDDVQKIKDML  543

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR
Sbjct  544  QKWSDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSR  603

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRH+PHA A P D
Sbjct  604  AAAGIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHIPHAQAAPTD  663

Query  209  TWERSHKLASI-GEEPTCSCSH  147
            TWERS+KL+S  GEE  CSCSH
Sbjct  664  TWERSYKLSSSGGEEHGCSCSH  685



>dbj|BAF00362.1| molybdopterin biosynthesis CNX1 protein [Arabidopsis thaliana]
Length=297

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 183/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  93   EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  152

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  153  KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  212

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A +P D
Sbjct  213  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATLPTD  272

Query  209  TWERSHKLA----SIGEEPTCSCSH  147
            TW++S+K A       EE  CSC+H
Sbjct  273  TWDQSYKSAYETGEKKEEAGCSCTH  297



>gb|KDP42916.1| hypothetical protein JCGZ_23858 [Jatropha curcas]
Length=674

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E RVA+LTVSDTVA+GAGPDRSGPRAVSVVNS+SE+LGGARVV+TAVVPDD+ KI+++L
Sbjct  473  AEFRVAVLTVSDTVASGAGPDRSGPRAVSVVNSASEKLGGARVVSTAVVPDDVSKIKELL  532

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID MDL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR
Sbjct  533  QRWSDIDGMDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLYVMMQESLKVTPFAMLSR  592

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECM+ LLPALKHALKQI+GDKREK+PRH+PHA A P D
Sbjct  593  SAAGIRGSTLIINMPGNPNAVAECMDALLPALKHALKQIKGDKREKHPRHIPHARAAPMD  652

Query  209  TWERSHKLASIG-EEPTCSCSH  147
            TWE S+KLAS G  E +CSCSH
Sbjct  653  TWELSYKLASGGVSERSCSCSH  674



>ref|XP_009601464.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
tomentosiformis]
Length=667

 Score =   335 bits (860),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE RVAILTVSDTVAAG GPDRSGPRAVSVVNS SERLGG  +V TAVVPDD QKI+D+L
Sbjct  466  SEFRVAILTVSDTVAAGLGPDRSGPRAVSVVNSLSERLGGTSIVATAVVPDDEQKIKDML  525

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR
Sbjct  526  QKWSDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSR  585

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRHVPHA A P D
Sbjct  586  AAAGIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHVPHAQAAPTD  645

Query  209  TWERSHKLASIG-EEPTCSCSH  147
            TWERS+KLAS G +E  CSCSH
Sbjct  646  TWERSYKLASSGVQEHGCSCSH  667



>gb|KJB55513.1| hypothetical protein B456_009G080100 [Gossypium raimondii]
Length=657

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VA+LTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VV DD+ KI+++L 
Sbjct  457  QFKVAVLTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATGVVSDDVGKIKEVLQ  516

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            RW DID +DL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  517  RWSDIDKLDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLYVMMQESLKVTPFAMLSRS  576

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQ++GDKREK+PRH+PH  A P DT
Sbjct  577  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVKGDKREKHPRHIPHEHATPVDT  636

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS G  EP+C CSH
Sbjct  637  WERSHKLASAGSVEPSCPCSH  657



>gb|KHG12135.1| Molybdopterin biosynthesis CNX1 -like protein [Gossypium arboreum]
Length=657

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VA+LTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VV DD+ KI+++L 
Sbjct  457  QFKVAVLTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATGVVSDDVGKIKEVLQ  516

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            RW DID +DL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  517  RWSDIDKLDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLYVMMQESLKVTPFAMLSRS  576

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQ++GDKREK+PRH+PH  A P DT
Sbjct  577  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVKGDKREKHPRHIPHEHATPVDT  636

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS G  +P+C CSH
Sbjct  637  WERSHKLASAGSVKPSCPCSH  657



>ref|XP_007141599.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13593.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=650

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV +AVVPD++ KI+DIL
Sbjct  451  AEVRVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVASAVVPDNVAKIQDIL  510

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLL+VMMQESLK+TPFAMLSR
Sbjct  511  RRWSDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLYVMMQESLKVTPFAMLSR  570

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECM  LLPALKH LKQIRGDK+EK+PRHVPH +AVPAD
Sbjct  571  SAAGIRGSTLIINMPGNPNAVAECMGALLPALKHGLKQIRGDKKEKHPRHVPHVEAVPAD  630

Query  209  TWERSHKLASIGEEPTCSC  153
             WE+S++LA+ G++ +CSC
Sbjct  631  VWEQSYRLAT-GDDVSCSC  648



>ref|XP_011043840.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Populus euphratica]
Length=641

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 182/201 (91%), Gaps = 2/201 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTVA+GAGPDRSGPRAVSV+NSSSE+LG ARVV+TAVVPDD+ KI+ ++ 
Sbjct  442  EFKVAILTVSDTVASGAGPDRSGPRAVSVINSSSEKLG-ARVVSTAVVPDDVSKIKAVVQ  500

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  501  KWSDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRS  560

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+PHA+A P DT
Sbjct  561  AAGIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHIPHAEAEPVDT  620

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS    EP CSCSH
Sbjct  621  WERSHKLASGNHAEPGCSCSH  641



>ref|XP_008451034.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Cucumis melo]
Length=661

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -1

Query  743  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  564
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  +V TAVV DD+ KI+D+L++
Sbjct  462  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVNIVATAVVSDDVSKIQDVLVK  521

Query  563  WCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  384
            WCDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  522  WCDIDEVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  581

Query  383  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  204
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQI+GDKREK+PRHVPHA+A PA+ W
Sbjct  582  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQIQGDKREKHPRHVPHAEATPANIW  641

Query  203  ERSHKLASIG-EEPTCSCSH  147
            ++S+KLAS G  E  CSCSH
Sbjct  642  DQSYKLASEGISETGCSCSH  661



>ref|XP_011043834.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Populus euphratica]
Length=653

 Score =   330 bits (846),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 182/201 (91%), Gaps = 2/201 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTVA+GAGPDRSGPRAVSV+NSSSE+LG ARVV+TAVVPDD+ KI+ ++ 
Sbjct  454  EFKVAILTVSDTVASGAGPDRSGPRAVSVINSSSEKLG-ARVVSTAVVPDDVSKIKAVVQ  512

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  513  KWSDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRS  572

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+PHA+A P DT
Sbjct  573  AAGIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHIPHAEAEPVDT  632

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS    EP CSCSH
Sbjct  633  WERSHKLASGNHAEPGCSCSH  653



>ref|XP_009376133.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Pyrus 
x bretschneideri]
Length=647

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 176/197 (89%), Gaps = 1/197 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SERLGGARVV+TAVVPDD+ KI+D+L RW
Sbjct  449  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSERLGGARVVSTAVVPDDVSKIKDVLHRW  508

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DI+ MDL+LTLGGTG +PRDVTPEATK L++KETPGLLHVMMQESLK+TP AMLSR AA
Sbjct  509  SDIEQMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLHVMMQESLKVTPTAMLSRSAA  568

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGS+LIINMPGNPNAVAECME LLPALKH LKQIRGDKREK+PRHVPHA     D WE
Sbjct  569  GIRGSSLIINMPGNPNAVAECMEALLPALKHGLKQIRGDKREKHPRHVPHAQGATTDVWE  628

Query  200  RSHKLASI-GEEPTCSC  153
            +S+KLAS  G EP CSC
Sbjct  629  QSYKLASASGTEPGCSC  645



>ref|XP_007141600.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13594.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=669

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV +AVVPD++ KI+DIL
Sbjct  451  AEVRVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVASAVVPDNVAKIQDIL  510

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLL+VMMQESLK+TPFAMLSR
Sbjct  511  RRWSDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLYVMMQESLKVTPFAMLSR  570

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECM  LLPALKH LKQIRGDK+EK+PRHVPH +AVPAD
Sbjct  571  SAAGIRGSTLIINMPGNPNAVAECMGALLPALKHGLKQIRGDKKEKHPRHVPHVEAVPAD  630

Query  209  TWERSHKLASIGEEPTCSC  153
             WE+S++LA+ G++ +CSC
Sbjct  631  VWEQSYRLAT-GDDVSCSC  648



>ref|XP_006379351.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|ERP57148.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=641

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LG ARVV+TAVVPDD+ KI+ ++ 
Sbjct  442  EFKVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLG-ARVVSTAVVPDDVSKIKAVVQ  500

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  501  KWSDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRS  560

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+ HA+A P DT
Sbjct  561  AAGIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHITHAEAEPVDT  620

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS    EP CSCSH
Sbjct  621  WERSHKLASGNHTEPGCSCSH  641



>ref|XP_002312858.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|EEE86813.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=653

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LG ARVV+TAVVPDD+ KI+ ++ 
Sbjct  454  EFKVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLG-ARVVSTAVVPDDVSKIKAVVQ  512

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  513  KWSDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRS  572

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+ HA+A P DT
Sbjct  573  AAGIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHITHAEAEPVDT  632

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS    EP CSCSH
Sbjct  633  WERSHKLASGNHTEPGCSCSH  653



>ref|NP_001242529.1| molybdopterin biosynthesis protein CNX1-like [Glycine max]
 gb|AEO14873.1| rfls1 protein [Glycine max]
Length=652

 Score =   327 bits (838),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV TAVVPDD+ KI+DIL
Sbjct  451  AEVKVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATAVVPDDVAKIQDIL  510

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLLHVMMQESLK+T  AMLSR
Sbjct  511  RRWSDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLHVMMQESLKVTKSAMLSR  570

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDK+EK+PRHVPHA+AVPAD
Sbjct  571  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKKEKHPRHVPHAEAVPAD  630

Query  209  TWERSHKLAS-IGEEPTCSC  153
             WE+S+ LA+  G + +CSC
Sbjct  631  VWEQSYMLATGAGSDVSCSC  650



>gb|KHN38452.1| Molybdopterin biosynthesis protein CNX1 [Glycine soja]
Length=652

 Score =   327 bits (838),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV TAVVPDD+ KI+DIL
Sbjct  451  AEVKVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATAVVPDDVAKIQDIL  510

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLLHVMMQESLK+T  AMLSR
Sbjct  511  RRWSDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLHVMMQESLKVTKSAMLSR  570

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDK+EK+PRHVPHA+AVPAD
Sbjct  571  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKKEKHPRHVPHAEAVPAD  630

Query  209  TWERSHKLAS-IGEEPTCSC  153
             WE+S+ LA+  G + +CSC
Sbjct  631  VWEQSYMLATGAGSDVSCSC  650



>dbj|BAJ33990.1| unnamed protein product [Thellungiella halophila]
Length=531

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 182/204 (89%), Gaps = 4/204 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV  AVVPD++++I+DIL 
Sbjct  328  EYKVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVAIAVVPDEVERIKDILQ  387

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D +DL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  388  KWSDVDEIDLILTLGGTGFTPRDVTPEATKEVIERETPGLLFVMMQESLKITPFAMLSRS  447

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P D
Sbjct  448  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATAPTD  507

Query  209  TWERSHKLASIGE---EPTCSCSH  147
            TW+RS+K A  GE   E  CSC+H
Sbjct  508  TWDRSYKSAYEGEETREAGCSCTH  531



>gb|AAA97413.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
 emb|CAB38312.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
Length=670

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 184/205 (90%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  466  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A +P D
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATLPTD  645

Query  209  TWERSHKLA----SIGEEPTCSCSH  147
            TW++S+KLA       EE  CSC+H
Sbjct  646  TWDQSYKLAYETGEKKEEAGCSCTH  670



>ref|XP_004491158.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X2 [Cicer arietinum]
Length=396

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 177/199 (89%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            ++ RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV T+VVPD++ KI+DIL
Sbjct  197  ADVRVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATSVVPDNVTKIQDIL  256

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR
Sbjct  257  RRWSDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSR  316

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDKREK+PRH PHA+AVP D
Sbjct  317  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKREKHPRHTPHAEAVPTD  376

Query  209  TWERSHKLASIGEEPTCSC  153
             WE+S+ +++ G E +CSC
Sbjct  377  VWEQSY-MSATGGEVSCSC  394



>gb|EYU35987.1| hypothetical protein MIMGU_mgv1a002507mg [Erythranthe guttata]
Length=665

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 183/205 (89%), Gaps = 4/205 (2%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SESRVAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA V+ TAVVPD+I KI+++L
Sbjct  461  SESRVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGATVIATAVVPDEIPKIKELL  520

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D MDL++TLGGTG +PRDVTPEATK ++ KETPGLL+VMM+ESLK+TPFAMLSR
Sbjct  521  EKWSDVDKMDLIITLGGTGFTPRDVTPEATKQVIHKETPGLLYVMMRESLKVTPFAMLSR  580

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV---  219
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQ++GDKREK+P HVPHA AV   
Sbjct  581  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVKGDKREKHPNHVPHAQAVGPT  640

Query  218  PADTWERSHKLAS-IGEEPTCSCSH  147
              DTWERS+KLA+ + +E  CSCSH
Sbjct  641  GTDTWERSYKLAADVAQETGCSCSH  665



>ref|XP_007015551.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 ref|XP_007015552.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33170.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33171.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
Length=676

 Score =   325 bits (834),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 180/201 (90%), Gaps = 1/201 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VA+LTVSDTVA+G GPDRSGPRAVSVVNSSSE+LGGA+VV  AVV DD+ KI+D+L 
Sbjct  476  QFKVAVLTVSDTVASGVGPDRSGPRAVSVVNSSSEKLGGAKVVAAAVVSDDVGKIKDVLQ  535

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            RW DID MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  536  RWSDIDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRS  595

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH  A P DT
Sbjct  596  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHEQATPVDT  655

Query  206  WERSHKLASIGE-EPTCSCSH  147
            WERSHKLAS G  EP CSCSH
Sbjct  656  WERSHKLASAGGIEPPCSCSH  676



>ref|XP_004491157.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X1 [Cicer arietinum]
Length=444

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 177/199 (89%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            ++ RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV T+VVPD++ KI+DIL
Sbjct  245  ADVRVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATSVVPDNVTKIQDIL  304

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR
Sbjct  305  RRWSDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSR  364

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDKREK+PRH PHA+AVP D
Sbjct  365  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKREKHPRHTPHAEAVPTD  424

Query  209  TWERSHKLASIGEEPTCSC  153
             WE+S+ +++ G E +CSC
Sbjct  425  VWEQSY-MSATGGEVSCSC  442



>ref|XP_004291534.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Fragaria 
vesca subsp. vesca]
Length=666

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVA+LTVSDTVA+GAGPDRSGPRAVSVV S SERLGGA+VV+TAVVPDD+ KI+D+L RW
Sbjct  467  RVAVLTVSDTVASGAGPDRSGPRAVSVVTSCSERLGGAKVVSTAVVPDDVSKIKDVLQRW  526

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D ++MDL+LTLGGTG +PRDVTPEATK L++KETPGLL VMMQESLK+TPFAMLSR AA
Sbjct  527  SDSENMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLFVMMQESLKVTPFAMLSRAAA  586

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQI+GDKREK+PRHVPHA A   DTWE
Sbjct  587  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQIKGDKREKHPRHVPHAQAASMDTWE  646

Query  200  RSHKLAS-IGEEPT-CSCSH  147
            +S+KLAS  G++ + CSC H
Sbjct  647  QSYKLASGSGKDSSGCSCCH  666



>ref|XP_010093278.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
 gb|EXB53803.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
Length=674

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 177/201 (88%), Gaps = 2/201 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            SE ++AILTVSDTVA+GAGPDRSGPRAVSVVNSS+ RLGGARVV TA VPD++ KI+D+L
Sbjct  473  SEFKLAILTVSDTVASGAGPDRSGPRAVSVVNSSAGRLGGARVVLTAAVPDEVSKIKDVL  532

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            L+WCDID +DL+LTLGGTG SPRDVTPEATK +++KET GLL+VMMQESLK+TPFAMLSR
Sbjct  533  LKWCDIDRVDLILTLGGTGFSPRDVTPEATKEVIEKETSGLLYVMMQESLKVTPFAMLSR  592

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAV ECME LLPALKHALKQI+GDKREK+PRHVPHA+A P D
Sbjct  593  SAAGIRGSTLIINMPGNPNAVGECMEALLPALKHALKQIKGDKREKHPRHVPHAEAAPQD  652

Query  209  TWERSHKLA--SIGEEPTCSC  153
             WERS+K A  S      CSC
Sbjct  653  EWERSYKSASGSGSRRGACSC  673



>ref|XP_002874027.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50286.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 183/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  467  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  526

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL V+MQESLKITPFAMLSR 
Sbjct  527  KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVVMQESLKITPFAMLSRS  586

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P D
Sbjct  587  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATRPTD  646

Query  209  TWERSHKLASI----GEEPTCSCSH  147
            TW++S+KLA       EE  CSC+H
Sbjct  647  TWDQSYKLAYATGEKKEEAGCSCTH  671



>ref|XP_006400671.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
 gb|ESQ42124.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
Length=669

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 182/204 (89%), Gaps = 4/204 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV  AVVPD++++I+DIL 
Sbjct  466  EYKVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVAIAVVPDEVERIKDILQ  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D +DL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDVDEIDLILTLGGTGFTPRDVTPEATKEVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P D
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATAPTD  645

Query  209  TWERSHKLASIGE---EPTCSCSH  147
            TW+RS+K A  GE   E  CSC+H
Sbjct  646  TWDRSYKSAYEGEETREAGCSCTH  669



>ref|NP_197599.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
 sp|Q39054.2|CNX1_ARATH RecName: Full=Molybdopterin biosynthesis protein CNX1; AltName: 
Full=Molybdenum cofactor biosynthesis enzyme CNX1; Includes: 
RecName: Full=Molybdopterin molybdenumtransferase; Short=MPT 
Mo-transferase; AltName: Full=Domain E; Includes: RecName: 
Full=Molybdopterin adenylyltransferase; Short=MPT adenylyltransferase; 
AltName: Full=Domain G [Arabidopsis thaliana]
 gb|AED92917.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
Length=670

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 183/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  466  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A +P D
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATLPTD  645

Query  209  TWERSHKLA----SIGEEPTCSCSH  147
            TW++S+K A       EE  CSC+H
Sbjct  646  TWDQSYKSAYETGEKKEEAGCSCTH  670



>gb|AFW59745.1| viviparous10 [Zea mays]
Length=339

 Score =   313 bits (801),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL
Sbjct  140  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGIL  199

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR
Sbjct  200  VQWSDIDHVNLILTLGGTGFTPRDVTPEATKMVIQKEAPGLTFVMLQESLKITPFAMLSR  259

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH PHA A P D
Sbjct  260  ATAGIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVD  319

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  320  QWERSFRAASSGSG-GCSC  337



>emb|CDX70956.1| BnaC03g10400D [Brassica napus]
Length=672

 Score =   322 bits (825),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 184/207 (89%), Gaps = 7/207 (3%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  466  DYKVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVATAVVPDEVERIKDILQ  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D +DL+LTLGGTG +PRD+TPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDVDEIDLILTLGGTGFTPRDITPEATKQVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVP---  216
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+HVPHA+A P   
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHVPHAEASPAPA  645

Query  215  ADTWERSHKLASIGEEPT----CSCSH  147
            ADTW++S+K A  G E T    CSC+H
Sbjct  646  ADTWDKSYKAAYEGAEETKDAGCSCTH  672



>ref|XP_010420950.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Camelina 
sativa]
Length=670

 Score =   322 bits (825),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 182/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  466  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG SPRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDDDGMDLILTLGGTGFSPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  PAD
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATTPAD  645

Query  209  TWERSHKLASIGEEPT----CSCSH  147
            TW++S+K A   EE      CSC+H
Sbjct  646  TWDQSYKSAYATEEKKEDAGCSCTH  670



>ref|XP_009131833.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brassica 
rapa]
Length=672

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 184/207 (89%), Gaps = 7/207 (3%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  466  DYKVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVATAVVPDEVERIKDILQ  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D +DL+LTLGGTG +PRD+TPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDVDEIDLILTLGGTGFTPRDITPEATKQVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVP---  216
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A P   
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEASPAPA  645

Query  215  ADTWERSHKLASIGEEPT----CSCSH  147
            ADTW++S+K A  G E T    CSC+H
Sbjct  646  ADTWDKSYKAAYEGAEETKDAGCSCTH  672



>ref|XP_007015553.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
 gb|EOY33172.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
Length=630

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 180/202 (89%), Gaps = 2/202 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VA+LTVSDTVA+G GPDRSGPRAVSVVNSSSE+LGGA+VV  AVV DD+ KI+D+L 
Sbjct  429  QFKVAVLTVSDTVASGVGPDRSGPRAVSVVNSSSEKLGGAKVVAAAVVSDDVGKIKDVLQ  488

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLK-ITPFAMLSR  390
            RW DID MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK +TPFAMLSR
Sbjct  489  RWSDIDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVVTPFAMLSR  548

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH  A P D
Sbjct  549  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHEQATPVD  608

Query  209  TWERSHKLASIGE-EPTCSCSH  147
            TWERSHKLAS G  EP CSCSH
Sbjct  609  TWERSHKLASAGGIEPPCSCSH  630



>gb|KFK26315.1| hypothetical protein AALP_AA8G231600 [Arabis alpina]
Length=670

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 181/204 (89%), Gaps = 4/204 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRA+SVV SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  467  EYKVAILTVSDTVSAGAGPDRSGPRAISVVESSSEKLGGAKVVATAVVPDEVERIKDILK  526

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D +DL+LTLGGTGC+PRDVTPEATK +++K TPGLL VMMQESLKITPFAMLSR 
Sbjct  527  KWSDVDEIDLILTLGGTGCTPRDVTPEATKEVIEKTTPGLLFVMMQESLKITPFAMLSRS  586

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P D
Sbjct  587  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATAPTD  646

Query  209  TWERSHKLASIG---EEPTCSCSH  147
            TW+RS+K A  G   +E   SC+H
Sbjct  647  TWDRSYKSAYEGGERKEAGYSCTH  670



>gb|KGN66381.1| hypothetical protein Csa_1G600210 [Cucumis sativus]
Length=524

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  743  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  564
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  VV TAVV DD+ KI+D+L++
Sbjct  325  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVSVVATAVVSDDVSKIQDVLVK  384

Query  563  WCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  384
            WCDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  385  WCDIDKVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  444

Query  383  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  204
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQ++GDKREK+PRHVPHA+A P + W
Sbjct  445  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQMKGDKREKHPRHVPHAEATPTNIW  504

Query  203  ERSHKLASIG-EEPTCSCSH  147
            ++S+KLAS G  E  CSCSH
Sbjct  505  DQSYKLASEGISETGCSCSH  524



>emb|CDP15575.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E RVAILTVSDTVA+G GPDRSGPRA+SVVNS+SE+LGGARV  TAVV DD+ +I+D LL
Sbjct  464  EIRVAILTVSDTVASGKGPDRSGPRAISVVNSASEKLGGARVAATAVVSDDVLQIKDTLL  523

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             W D++ MDL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  524  SWSDVEKMDLILTLGGTGFTPRDVTPEATKVVIEKETPGLLYVMMQESLKVTPFAMLSRS  583

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRG+TLIINMPGNPNAVAECME LLP LKHALKQ+RGDKREK+P HVPHA+A P+DT
Sbjct  584  AAGIRGTTLIINMPGNPNAVAECMEALLPVLKHALKQVRGDKREKHPLHVPHAEAAPSDT  643

Query  206  WERSHKLASIG-EEPTCSCSH  147
            WERS K AS   +   CSCSH
Sbjct  644  WERSFKSASNNVQHSGCSCSH  664



>ref|XP_006286370.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
 gb|EOA19268.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
Length=684

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 181/205 (88%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD+++KI+DIL 
Sbjct  480  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVEKIKDILQ  539

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  540  KWSDDDGMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  599

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  PAD
Sbjct  600  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATTPAD  659

Query  209  TWERSHKLASIGEEPT----CSCSH  147
            TW+ S+K A   EE      CSC+H
Sbjct  660  TWDESYKSAYATEEKKEEAGCSCTH  684



>ref|XP_008787719.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Phoenix dactylifera]
Length=671

 Score =   320 bits (820),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VAILTVSDTVA+G GPDRSGPRA+SVVNSSSE LGGA VV TAVVPD++ KI+D+L +W
Sbjct  476  KVAILTVSDTVASGGGPDRSGPRAISVVNSSSESLGGAHVVATAVVPDEVDKIKDVLQKW  535

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DID +DL+LTLGGTG SPRDVTPEATK  ++KE+PGL+ VM+QE LK+TPFAMLSR AA
Sbjct  536  SDIDKVDLILTLGGTGFSPRDVTPEATKASIEKESPGLVLVMLQEGLKVTPFAMLSRAAA  595

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PHA+A P D WE
Sbjct  596  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHIPHAEAQPVDQWE  655

Query  200  RSHKLASIGEEPTCSCSH  147
            RS K A+ G E  CSCSH
Sbjct  656  RSFKAATAGSE--CSCSH  671



>ref|XP_007204973.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
 gb|EMJ06172.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
Length=674

 Score =   320 bits (819),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 174/200 (87%), Gaps = 1/200 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E RVAILTVSDTVA+GAGPDRSGPR VSVVNS SERLGGARVV+TAVVPDD+ +I+D L
Sbjct  473  AEFRVAILTVSDTVASGAGPDRSGPRGVSVVNSCSERLGGARVVSTAVVPDDVSQIKDAL  532

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW D+D MDL+LTLGGTG +PRDVTPEATK L++KETPGL+HVMMQ SLK+TP AMLSR
Sbjct  533  SRWSDVDKMDLILTLGGTGFTPRDVTPEATKQLIEKETPGLVHVMMQASLKVTPTAMLSR  592

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME LLPALKH LKQI+G KREK+PRHVPHA +   D
Sbjct  593  SAAGIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQIKGGKREKHPRHVPHAQSASMD  652

Query  209  TWERSHKLAS-IGEEPTCSC  153
             WE+SH+LAS  G E  CSC
Sbjct  653  VWEQSHRLASATGREHGCSC  672



>ref|XP_010685502.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 176/200 (88%), Gaps = 2/200 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VAILT+SDTVA GAGPDRSGPRA+SV+NSSSERLGGA+VV+TAVVPDD+Q I+D+L RW
Sbjct  450  KVAILTISDTVATGAGPDRSGPRAISVINSSSERLGGAKVVSTAVVPDDVQSIKDVLWRW  509

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D+D +DL++TLGGTG SPRDVTPEATK +++KETPGLL+VMMQESLK+T  AMLSR AA
Sbjct  510  SDVDKVDLIITLGGTGFSPRDVTPEATKEVIEKETPGLLYVMMQESLKVTQTAMLSRSAA  569

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQI+GDKREK+PRHV HA A   DTWE
Sbjct  570  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQIKGDKREKHPRHVSHAQAATVDTWE  629

Query  200  RSHKLAS--IGEEPTCSCSH  147
            +S+K A+    +E  CSCSH
Sbjct  630  QSYKKATTNTAKELGCSCSH  649



>ref|XP_003617060.1| Molybdopterin biosynthesis CNX1 protein [Medicago truncatula]
 gb|AET00019.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=653

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVAAGAGPDRSGPRAVSV+NSSSERLGGA+VV T+VVPD++ KI+DIL RW
Sbjct  454  RVAILTVSDTVAAGAGPDRSGPRAVSVINSSSERLGGAKVVATSVVPDNVAKIQDILRRW  513

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AA
Sbjct  514  SDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAA  573

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAEC E LLPALKH LKQ+RGDKREK+PRH+PHA+AVP D WE
Sbjct  574  GIRGSTLIINMPGNPNAVAECTEALLPALKHGLKQLRGDKREKHPRHIPHAEAVPTDVWE  633

Query  200  RSHKLAS--IGEEPTCSC  153
            RS+  A+   G E +CSC
Sbjct  634  RSYMSATGAGGSEVSCSC  651



>emb|CDX88829.1| BnaA03g08200D [Brassica napus]
Length=670

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 180/202 (89%), Gaps = 5/202 (2%)
 Frame = -1

Query  737  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRWC  558
            VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV +AVVPD++++I+DIL +W 
Sbjct  469  VAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVASAVVPDEVERIKDILQKWS  528

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D+D +DL+LTLGGTG +PRDVTPEATK ++Q+ETPGLL VMMQESLKITPFAMLSR AAG
Sbjct  529  DVDEIDLILTLGGTGFTPRDVTPEATKQVIQRETPGLLFVMMQESLKITPFAMLSRSAAG  588

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PADTWE  201
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P H+PHA+A  PADTW+
Sbjct  589  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPNHIPHAEATAPADTWD  648

Query  200  RSHKLASIGEEPT----CSCSH  147
            +S+K A  G   T    CSC+H
Sbjct  649  KSYKSAYEGAGETKDAGCSCTH  670



>ref|XP_010493217.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=671

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 181/206 (88%), Gaps = 6/206 (3%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSERLGGA+VV TAVVPD++++I+DIL 
Sbjct  466  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSERLGGAKVVATAVVPDEVERIKDILE  525

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  526  KWSDDDGMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  585

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV--PA  213
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A    A
Sbjct  586  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATTPAA  645

Query  212  DTWERSHKLASIGEEPT----CSCSH  147
            DTW++S+K A   EE      CSC+H
Sbjct  646  DTWDQSYKSAYATEEKKEEAGCSCTH  671



>ref|XP_010926610.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Elaeis guineensis]
Length=671

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 176/201 (88%), Gaps = 2/201 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            S+ +VAILTVSDTVA+GAGPDRSGPRA+SVVNSSSE LGGA VV TAVVPD++ KI+D+L
Sbjct  473  SKVKVAILTVSDTVASGAGPDRSGPRAISVVNSSSESLGGAHVVATAVVPDEVDKIQDVL  532

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D +DL+LTLGGTG SPRDVTPEATK  ++KETPGL+ VM+QESLK+TPFAMLSR
Sbjct  533  QKWSDVDKVDLILTLGGTGFSPRDVTPEATKASIEKETPGLVLVMLQESLKVTPFAMLSR  592

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             AAGIRGSTLIINMPGNPNAVAECME L+PALKHALKQI+GDKREK+PRHVPHA+A   D
Sbjct  593  AAAGIRGSTLIINMPGNPNAVAECMEALMPALKHALKQIKGDKREKHPRHVPHAEAQSVD  652

Query  209  TWERSHKLASIGEEPTCSCSH  147
             WERS K A+ G    CSCSH
Sbjct  653  QWERSFKAATAGS--GCSCSH  671



>ref|XP_004159365.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1-like [Cucumis sativus]
Length=662

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  743  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  564
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  VV TAVV DD+ KI+D+L++
Sbjct  463  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVSVVATAVVSDDVSKIQDVLVK  522

Query  563  WCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  384
            WCDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  523  WCDIDKVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  582

Query  383  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  204
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQ++GDKREK+PRHVPHA+A P + W
Sbjct  583  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQMKGDKREKHPRHVPHAEATPTNIW  642

Query  203  ERSHKLASIG-EEPTCSCSH  147
            ++S+KLAS G  E  CSCSH
Sbjct  643  DQSYKLASEGISETGCSCSH  662



>ref|XP_004144145.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Cucumis 
sativus]
Length=662

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  743  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  564
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  VV TAVV DD+ KI+D+L++
Sbjct  463  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVSVVATAVVSDDVSKIQDVLVK  522

Query  563  WCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  384
            WCDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  523  WCDIDKVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  582

Query  383  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  204
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQ++GDKREK+PRHVPHA+A P + W
Sbjct  583  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQMKGDKREKHPRHVPHAEATPTNIW  642

Query  203  ERSHKLASIG-EEPTCSCSH  147
            ++S+KLAS G  E  CSCSH
Sbjct  643  DQSYKLASEGISETGCSCSH  662



>ref|XP_010520491.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Tarenaya hassleriana]
Length=672

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 176/205 (86%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E R AILTVSDTV++GAGPDRSGPR VSVVNSSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  468  EYRAAILTVSDTVSSGAGPDRSGPRGVSVVNSSSEKLGGAQVVATAVVPDEVERIKDILK  527

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            RW D+D +DL+LTLGGTG +PRDVTPEATK +++KETPGLL VMMQESLK+T FAMLSR 
Sbjct  528  RWSDVDRVDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLFVMMQESLKVTQFAMLSRA  587

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            AAGIRGSTLIINMPGNPNAVAECME +LPALKHALKQI+GDKREK+PRHVPHA+    DT
Sbjct  588  AAGIRGSTLIINMPGNPNAVAECMEAILPALKHALKQIKGDKREKHPRHVPHAETATTDT  647

Query  206  WERSHKLASIGEEPT-----CSCSH  147
            W+RS + A  G EP      C C+H
Sbjct  648  WDRSFRSAYGGGEPETKERGCGCTH  672



>ref|XP_002447271.1| hypothetical protein SORBIDRAFT_06g031680 [Sorghum bicolor]
 gb|EES11599.1| hypothetical protein SORBIDRAFT_06g031680 [Sorghum bicolor]
Length=660

 Score =   316 bits (810),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVS+VNSSSE+LGGA VV T+VVPD++ KI+ IL
Sbjct  460  AEVKVAILTVSDTVSSGAGPDRSGPRAVSIVNSSSEKLGGATVVATSVVPDEVDKIKGIL  519

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR
Sbjct  520  IQWSDIDHVNLILTLGGTGFTPRDVTPEATKSVIQKEAPGLTFVMLQESLKITPFAMLSR  579

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH PHA A P D
Sbjct  580  ATAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVD  639

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  640  QWERSFRAASAGSGRGCSC  658



>ref|XP_009383824.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VAILTVSDTV++G+GPDRSGPRAVSVVNS SE+LGGA VV TAVVPD++ KI++ LL+W
Sbjct  461  KVAILTVSDTVSSGSGPDRSGPRAVSVVNSLSEKLGGAHVVATAVVPDEVDKIKNTLLKW  520

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DID +DL+LTLGGTGC+PRDVTPEATK ++QKETPGL  VM+QESLK+TPFAMLSR AA
Sbjct  521  SDIDKVDLILTLGGTGCTPRDVTPEATKAVIQKETPGLSFVMLQESLKVTPFAMLSRAAA  580

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME L+P LKH LKQI+GDKREK+PRH PHA+A P D WE
Sbjct  581  GIRGSTLIINMPGNPNAVAECMEALVPGLKHGLKQIKGDKREKHPRHAPHAEAPPTDQWE  640

Query  200  RSHKLASIGEEPTCSCSH  147
            RS+K AS   +  CSCSH
Sbjct  641  RSYKAASATAQ--CSCSH  656



>ref|XP_010454418.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=666

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 5/205 (2%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  462  EYKVAILTVSDTVSAGAGPDRSGPRAVSVVESSSEKLGGAKVVATAVVPDEVERIKDILQ  521

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  522  KWSDDDGMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  581

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPAD  210
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+ +PHA+A  PAD
Sbjct  582  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKLIPHAEATTPAD  641

Query  209  TWERSHKLASI----GEEPTCSCSH  147
            TW++S+K A       EE  CSC+H
Sbjct  642  TWDQSYKSAYATEDKKEEAGCSCTH  666



>ref|XP_006653844.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Oryza 
brachyantha]
Length=671

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRA+SVVNSSSE+LGGA VV TAVVPDD++KI++IL
Sbjct  473  AEVKVAILTVSDTVSSGAGPDRSGPRAISVVNSSSEKLGGATVVATAVVPDDVEKIKNIL  532

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DIDH++L+LTLGGTG +PRDVTPEATK +++KE PGL ++M+QESLK+TPFAMLSR
Sbjct  533  VKWSDIDHINLILTLGGTGFTPRDVTPEATKSVIEKEAPGLTYIMLQESLKVTPFAMLSR  592

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGS LIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPHA+A P D
Sbjct  593  ATAGIRGSALIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHAEAAPVD  652

Query  209  TWERSHKLASIGEEPTCSC  153
             W+RS + AS G    CSC
Sbjct  653  QWDRSFRAASTGM--GCSC  669



>ref|XP_010651619.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Vitis vinifera]
Length=568

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL +W
Sbjct  370  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  429

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  430  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  489

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  490  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAAAVDTWE  549

Query  200  RSHKLAS-IGEEPTCSCSH  147
            RS+K+AS    EPTCSCSH
Sbjct  550  RSYKMASGNASEPTCSCSH  568



>emb|CAN65528.1| hypothetical protein VITISV_026358 [Vitis vinifera]
Length=518

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL +W
Sbjct  320  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  379

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  380  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  439

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTL INMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  440  GIRGSTLXINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAEAVDTWE  499

Query  200  RSHKLAS-IGEEPTCSCSH  147
            RSHK+AS    EPTCSCSH
Sbjct  500  RSHKMASGNASEPTCSCSH  518



>ref|XP_009340227.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Pyrus x bretschneideri]
Length=543

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SERLGGARVV+TAVVPDD+ KI+ +L RW
Sbjct  345  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSERLGGARVVSTAVVPDDVSKIKGVLHRW  404

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DID MDL+LTLGGTG +PR VTPEATK L++KETPGLLHVMM+ESLK+TP AMLSR AA
Sbjct  405  SDIDQMDLILTLGGTGFTPRGVTPEATKELIEKETPGLLHVMMRESLKVTPTAMLSRSAA  464

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGS+LIINM GNPNAVAECM  LLPALKH LKQIRGD+RE +P HVPH     AD WE
Sbjct  465  GIRGSSLIINMHGNPNAVAECMGALLPALKHGLKQIRGDERENHPXHVPHTQGATADVWE  524

Query  200  RSHKLASI-GEEPTCSC  153
            +S+KLAS  G EP CSC
Sbjct  525  QSYKLASASGSEPGCSC  541



>ref|XP_004960170.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Setaria 
italica]
Length=661

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL
Sbjct  461  TEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGIL  520

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL+ VM+QESLKITPFAMLSR
Sbjct  521  VQWSDIDCVNLILTLGGTGFTPRDVTPEATKSIIEKEAPGLIFVMLQESLKITPFAMLSR  580

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH PHA A P D
Sbjct  581  AMAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVD  640

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  641  QWERSFRAASAGSGGGCSC  659



>emb|CAE04830.1| OSJNBa0084K01.2 [Oryza sativa Japonica Group]
 emb|CAE54543.1| OSJNBa0015K02.22 [Oryza sativa Japonica Group]
 emb|CAH67068.1| H0112G12.13 [Oryza sativa Indica Group]
 gb|EEC78184.1| hypothetical protein OsI_17781 [Oryza sativa Indica Group]
Length=661

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV+ GAGPDRSGPRA+SVVNSSSE+LGGA VV TAVVPDD++KI++IL
Sbjct  463  TEVKVAILTVSDTVSLGAGPDRSGPRAISVVNSSSEKLGGATVVATAVVPDDVEKIKNIL  522

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DID + L+LTLGGTG +PRDVTPEATK +++KE PGL +VM+QESLK+TPFAMLSR
Sbjct  523  VKWSDIDRVSLILTLGGTGFTPRDVTPEATKSVIEKEAPGLTYVMLQESLKVTPFAMLSR  582

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPHA+A P D
Sbjct  583  ATAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHAEAAPVD  642

Query  209  TWERSHKLASIGEEPTCSC  153
             W+RS + AS G    CSC
Sbjct  643  QWDRSFRAASSGR--GCSC  659



>emb|CBI24388.3| unnamed protein product [Vitis vinifera]
Length=652

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL +W
Sbjct  454  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  513

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  514  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  573

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  574  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAAAVDTWE  633

Query  200  RSHKLAS-IGEEPTCSCSH  147
            RS+K+AS    EPTCSCSH
Sbjct  634  RSYKMASGNASEPTCSCSH  652



>ref|XP_002276536.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
 ref|XP_010651618.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
Length=658

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL +W
Sbjct  460  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  519

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  520  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  579

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  580  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAAAVDTWE  639

Query  200  RSHKLAS-IGEEPTCSCSH  147
            RS+K+AS    EPTCSCSH
Sbjct  640  RSYKMASGNASEPTCSCSH  658



>ref|XP_004517264.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Cicer 
arietinum]
Length=185

 Score =   296 bits (758),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 163/183 (89%), Gaps = 1/183 (1%)
 Frame = -1

Query  701  GAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRWCDIDHMDLVLTLG  522
            GAGPDRSGPRAVSV+NSSSERLGGARVV T+VVPD++ KI+DIL RW D + MDL++TLG
Sbjct  2    GAGPDRSGPRAVSVINSSSERLGGARVVATSVVPDNVTKIQDILRRWSDNEQMDLIITLG  61

Query  521  GTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGIRGSTLIINMPG  342
            GTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AAGIRGSTLIINMPG
Sbjct  62   GTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAAGIRGSTLIINMPG  121

Query  341  NPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWERSHKLASIGEEPT  162
            NPNAVAECME LLPALKH LKQ+RGDKREK+PRH PHA+AVP D WE+S+ +++ G E +
Sbjct  122  NPNAVAECMEALLPALKHGLKQLRGDKREKHPRHTPHAEAVPTDVWEQSY-MSATGGEVS  180

Query  161  CSC  153
            CSC
Sbjct  181  CSC  183



>ref|NP_001168286.1| viviparous10 [Zea mays]
 gb|ACN27697.1| unknown [Zea mays]
 gb|AFW59744.1| viviparous10 [Zea mays]
Length=657

 Score =   311 bits (797),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL
Sbjct  458  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGIL  517

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR
Sbjct  518  VQWSDIDHVNLILTLGGTGFTPRDVTPEATKMVIQKEAPGLTFVMLQESLKITPFAMLSR  577

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH PHA A P D
Sbjct  578  ATAGIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVD  637

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  638  QWERSFRAASSGSG-GCSC  655



>gb|ABB30174.1| molybdenum cofactor biosynthesis protein [Zea mays]
Length=657

 Score =   311 bits (797),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL
Sbjct  458  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGIL  517

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR
Sbjct  518  VQWSDIDHVNLILTLGGTGFTPRDVTPEATKMVIQKEAPGLTFVMLQESLKITPFAMLSR  577

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
              AGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH PHA A P D
Sbjct  578  ATAGIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVD  637

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  638  QWERSFRAASSGSG-GCSC  655



>ref|XP_003580744.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brachypodium 
distachyon]
Length=664

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 176/199 (88%), Gaps = 2/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ +I+D+L
Sbjct  466  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDQIKDVL  525

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W D+D ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR
Sbjct  526  VKWSDVDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSR  585

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             A+GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHADA P D
Sbjct  586  AASGIRGSTLIINMPGNPNAVAECMEALLPALKHAIKQLKGDKREKNPRHVPHADAAPVD  645

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS K AS G    CSC
Sbjct  646  QWERSFKAASSGG--GCSC  662



>dbj|BAJ88077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score =   298 bits (763),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL
Sbjct  459  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEIL  518

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR
Sbjct  519  VKWSDIDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSR  578

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             A GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHA+A P D
Sbjct  579  AACGIRGSTLIINMPGNPNAVAECMEALLPALKHAMKQLKGDKREKNPRHVPHAEAAPVD  638

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  639  QWERSFRAASSGG--GCSC  655



>dbj|BAK02586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   298 bits (763),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL
Sbjct  461  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEIL  520

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            ++W DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR
Sbjct  521  VKWSDIDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSR  580

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
             A GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHA+A P D
Sbjct  581  AACGIRGSTLIINMPGNPNAVAECMEALLPALKHAMKQLKGDKREKNPRHVPHAEAAPVD  640

Query  209  TWERSHKLASIGEEPTCSC  153
             WERS + AS G    CSC
Sbjct  641  QWERSFRAASSGG--GCSC  657



>gb|AAF73075.1|AF268595_1 molybdenum cofactor biosynthesis protein Cnx1 [Hordeum vulgare]
Length=659

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL+
Sbjct  462  EVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEILV  521

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR 
Sbjct  522  KWSDIDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSRA  581

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADT  207
            A GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHA+A P D 
Sbjct  582  ACGIRGSTLIINMPGNPNAVAECMEALLPALKHAMKQLKGDKREKNPRHVPHAEAAPVDQ  641

Query  206  WERSHKLASIGEEPTCSC  153
            WERS + AS G    CSC
Sbjct  642  WERSFRAASSGG--GCSC  657



>pdb|1UUY|A Chain A, Structure Of A Molybdopterin-Bound Cnx1g Domain Links 
Molybdenum And Copper Metabolism
Length=167

 Score =   280 bits (716),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  5    EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  64

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAML+R 
Sbjct  65   KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLARS  124

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  258
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  125  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>pdb|1O8Q|A Chain A, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|B Chain B, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|C Chain C, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|D Chain D, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|E Chain E, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|F Chain F, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|G Chain G, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|H Chain H, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
Length=167

 Score =   280 bits (716),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  5    EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  64

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQE+LKITPFAMLSR 
Sbjct  65   KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQEALKITPFAMLSRS  124

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  258
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  125  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>pdb|1O8N|A Chain A, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8N|B Chain B, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8N|C Chain C, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
Length=167

 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  5    EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  64

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGG G +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  65   KWSDVDEMDLILTLGGAGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  124

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  258
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  125  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>pdb|1O8O|A Chain A, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8O|B Chain B, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8O|C Chain C, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
Length=167

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  5    EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  64

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGG G +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  65   KWSDVDEMDLILTLGGDGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  124

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  258
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  125  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>ref|XP_001770478.1| predicted protein [Physcomitrella patens]
 gb|EDQ64647.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 172/210 (82%), Gaps = 11/210 (5%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            S+ RVAILTVSDTVA GAGPDRSGPRAV V+ S SERLGGA VV ++VVPDD++ I+++L
Sbjct  466  SQVRVAILTVSDTVATGAGPDRSGPRAVEVITSVSERLGGASVVASSVVPDDVEAIQEVL  525

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             RW DID ++L+LT GGTG +PRDVTPEAT+PL+Q+ETPGL  VM+ ESLK+TP AMLSR
Sbjct  526  KRWSDIDKVNLILTTGGTGFTPRDVTPEATRPLIQRETPGLTQVMLLESLKVTPTAMLSR  585

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPA-  213
             AAGIRGSTLIINMPGNPNAVAEC+E L+PAL HALKQ+RGDKREK+P HVPHA A PA 
Sbjct  586  AAAGIRGSTLIINMPGNPNAVAECIEALMPALPHALKQLRGDKREKHPNHVPHAAARPAN  645

Query  212  -DTWERSHKLASIGEEPT--------CSCS  150
             D W +S+ LASI  +PT        C+CS
Sbjct  646  SDVWTKSY-LASIETQPTEGPLVDKPCNCS  674



>gb|ABR17730.1| unknown [Picea sitchensis]
Length=677

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VAILTVSDTVA+GAGPDRSGPRAVSV+NS SE+LGGARVV T VV D +  IR  L RW
Sbjct  481  KVAILTVSDTVASGAGPDRSGPRAVSVINSMSEKLGGARVVATEVVHDTVDHIRGALQRW  540

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D D +DL+LT GGTG +PRDV PEATKPLL KE PGL+  M+QESLK+T  A+LSR AA
Sbjct  541  SDHDKVDLILTTGGTGFAPRDVNPEATKPLLDKEAPGLVQFMLQESLKVTKTAVLSRAAA  600

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAEC+E L+PAL HAL+Q+RGDK+EK+PRHVPH D+ PAD WE
Sbjct  601  GIRGSTLIINMPGNPNAVAECLEALMPALPHALRQLRGDKKEKHPRHVPHGDSKPADVWE  660

Query  200  RSHKLASIGEEPTCSCSH  147
             S+ +AS  E   CSC+H
Sbjct  661  ASYMMAS-KESRDCSCTH  677



>pdb|1UUX|A Chain A, Structure Of A Molybdopterin-Bound Cnx1g Domain Links 
Molybdenum And Copper Metabolism
Length=163

 Score =   272 bits (695),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  5    EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  64

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR 
Sbjct  65   KWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRS  124

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQI  273
            AAGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI
Sbjct  125  AAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQI  162



>ref|XP_006847466.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
 gb|ERN09047.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
Length=675

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +V ILTVSDTVAAGAGPD SGPRAVSV+NS SE+LGGA+VV TAV PD++ +I+++L  W
Sbjct  479  KVGILTVSDTVAAGAGPDGSGPRAVSVINSLSEKLGGAKVVATAVAPDEVNEIQNVLKNW  538

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D+  ++L+LT GGTG SPRD+TPEATK L+++E PGLL VM+QESLK+TPFAMLSR  A
Sbjct  539  SDVKKVNLILTTGGTGFSPRDITPEATKSLIEREAPGLLQVMLQESLKVTPFAMLSRAMA  598

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
            GIRGSTLIINMPGNPNAVAEC++ L+PAL HAL+Q++GDKREK+P HVPH+ A P+DTWE
Sbjct  599  GIRGSTLIINMPGNPNAVAECIDALMPALPHALRQLKGDKREKHPLHVPHSQAEPSDTWE  658

Query  200  RSHKLASIGEEPTCSC  153
            RS + AS   +  C C
Sbjct  659  RSFRSASTASK-QCDC  673



>ref|XP_008231326.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Prunus mume]
Length=640

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 154/197 (78%), Gaps = 20/197 (10%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            ++AILTVSDTVA+GAGPDRSGPR VSVVNS SERLGGA VV+TAVVPDD+ +I+D L RW
Sbjct  461  KIAILTVSDTVASGAGPDRSGPRGVSVVNSCSERLGGATVVSTAVVPDDVSQIKDALSRW  520

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DID MDL+LTLGGTG +PRDVTPEATK L++KETPGL+HVMMQ SLK            
Sbjct  521  SDIDKMDLILTLGGTGFTPRDVTPEATKQLIEKETPGLVHVMMQASLK------------  568

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  201
                   IINMPGNPNAVAECME LLPALKH LKQI+G KREK+PRHVPHA +   D WE
Sbjct  569  -------IINMPGNPNAVAECMEALLPALKHGLKQIKGGKREKHPRHVPHAQSASMDVWE  621

Query  200  RSHKLAS-IGEEPTCSC  153
            +SH+LAS  G E  CSC
Sbjct  622  QSHRLASATGREHGCSC  638



>ref|XP_010926611.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Elaeis guineensis]
Length=652

 Score =   273 bits (697),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 158/201 (79%), Gaps = 21/201 (10%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            S+ +VAILTVSDTVA+GAGPDRSGPRA+SVVNSSSE LGGA VV TAVVPD++ KI+D+L
Sbjct  473  SKVKVAILTVSDTVASGAGPDRSGPRAISVVNSSSESLGGAHVVATAVVPDEVDKIQDVL  532

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
             +W D+D +DL+LTLGGTG SPRDVTPEATK  ++KETPGL+ VM+QESLK         
Sbjct  533  QKWSDVDKVDLILTLGGTGFSPRDVTPEATKASIEKETPGLVLVMLQESLK---------  583

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPAD  210
                      IINMPGNPNAVAECME L+PALKHALKQI+GDKREK+PRHVPHA+A   D
Sbjct  584  ----------IINMPGNPNAVAECMEALMPALKHALKQIKGDKREKHPRHVPHAEAQSVD  633

Query  209  TWERSHKLASIGEEPTCSCSH  147
             WERS K A+ G    CSCSH
Sbjct  634  QWERSFKAATAGS--GCSCSH  652



>pdb|1EAV|A Chain A, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|B Chain B, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|C Chain C, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|D Chain D, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|E Chain E, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|F Chain F, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|G Chain G, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|H Chain H, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
Length=162

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            E +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL 
Sbjct  5    EYKVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQ  64

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            +W D+D  DL+LTLGGTG +PRDVTPEATK ++++ETPGLL V  QESLKITPFA LSR 
Sbjct  65   KWSDVDEXDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVXXQESLKITPFAXLSRS  124

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQI  273
            AAGIRGSTLIIN PGNPNAVAEC E LLPALKHALKQI
Sbjct  125  AAGIRGSTLIINXPGNPNAVAECXEALLPALKHALKQI  162



>ref|XP_002973522.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
 gb|EFJ25182.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
Length=641

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VAILTVSDTV++G GPDRSGPRAV V++S S+ LGGA+VV TA+VPD I +I+ +L  W
Sbjct  442  KVAILTVSDTVSSGNGPDRSGPRAVQVIDSLSKSLGGAKVVATAIVPDSIPRIQQVLEDW  501

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D   +DL+LT GGTGC+P+DVTPEAT+ +LQKE PGL  VM+ ESLK+TP AMLSR  A
Sbjct  502  SDNQRIDLILTTGGTGCTPKDVTPEATRAVLQKEAPGLATVMLLESLKVTPTAMLSRGVA  561

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV---PAD  210
            GIRGSTLIINMPGNPNAVAECM+ LLPAL HAL+Q+RGDKREK+PRH PH       P D
Sbjct  562  GIRGSTLIINMPGNPNAVAECMQALLPALPHALRQVRGDKREKHPRHSPHHQDTALDPKD  621

Query  209  TWERSHKLASIGEEPTCSCSH  147
             W RS  +A+ G E  CSCSH
Sbjct  622  VWTRSF-VAAQGGEMGCSCSH  641



>ref|XP_002975554.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
 gb|EFJ23183.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
Length=641

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VAILTVSDTV++G GPDRSGPRAV V++S S+ LGGA+VV TA+VPD I +I+ +L  W
Sbjct  442  KVAILTVSDTVSSGNGPDRSGPRAVQVIDSLSKSLGGAKVVATAIVPDSIPRIQQVLEDW  501

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D   +DL+LT GGTGC+P+DVTPEAT+ +LQKE PGL  VM+ ESLK+TP AMLSR  A
Sbjct  502  SDNQRIDLILTTGGTGCTPKDVTPEATRAVLQKEAPGLATVMLLESLKVTPTAMLSRGVA  561

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV---PAD  210
            GIRGSTLIINMPGNPNAVAECM+ LLPAL HAL+Q+RGDKREK+PRH PH       P D
Sbjct  562  GIRGSTLIINMPGNPNAVAECMQALLPALPHALRQVRGDKREKHPRHSPHHHDTALDPKD  621

Query  209  TWERSHKLASIGEEPTCSCSH  147
             W RS  +A+ G E  CSCSH
Sbjct  622  VWTRSF-VAAQGGEMGCSCSH  641



>gb|EMT03164.1| Molybdopterin biosynthesis protein CNX1 [Aegilops tauschii]
Length=696

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 165/235 (70%), Gaps = 38/235 (16%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++G GPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL
Sbjct  462  AEVKVAILTVSDTVSSGGGPDRSGPRAVSVVNSSSEKLGGAFVVATAVVPDEVDKIKEIL  521

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQES---LKITPFAM  399
            ++W DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QES   LK+    +
Sbjct  522  VKWSDIDRVNLILTLGGTGFTPRDVTPEATKSVIEKEVPGLAFVMIQESLKCLKLDRIQI  581

Query  398  LSRPAAGI------RGSTL---------------------------IINMPGNPNAVAEC  318
            L     G+       G T+                           IINMPGNPNAVAEC
Sbjct  582  LLFCTDGVCTFLFGTGDTICDAIPSGVWDKRIDTCFETLTRVLFFQIINMPGNPNAVAEC  641

Query  317  MEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWERSHKLASIGEEPTCSC  153
            ME LLPALKHA+KQ++GDKREKNPRH+PHA+A P D WERS + AS G    CSC
Sbjct  642  MEALLPALKHAMKQLKGDKREKNPRHIPHAEAAPVDQWERSFRAASSGG--GCSC  694



>ref|XP_010031621.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Eucalyptus grandis]
Length=610

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVA+GAGPDRSGPRAV+VVNSSSERLGGARV  TAVVPD++ KI+DIL RW
Sbjct  471  RVAILTVSDTVASGAGPDRSGPRAVTVVNSSSERLGGARVAATAVVPDEVAKIKDILQRW  530

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D+D MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  531  ADVDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  590

Query  380  GIRGSTL  360
            GIRGS+L
Sbjct  591  GIRGSSL  597



>ref|XP_008385638.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Malus domestica]
Length=484

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SE LGGARVV+TAVV DD+ KI+D+L RW
Sbjct  333  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSETLGGARVVSTAVVADDVSKIKDVLHRW  392

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DI+ MDL+LTLGGTG +PRDVTPEATK L++KETPGLLHVMMQESLK+TP AMLSR AA
Sbjct  393  SDIEQMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLHVMMQESLKVTPTAMLSRSAA  452

Query  380  GIRGSTLI  357
            GIRGS+L+
Sbjct  453  GIRGSSLV  460



>gb|KEH28338.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=582

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVAAGAGPDRSGPRAVSV+NSSSERLGGA+VV T+VVPD++ KI+DIL RW
Sbjct  454  RVAILTVSDTVAAGAGPDRSGPRAVSVINSSSERLGGAKVVATSVVPDNVAKIQDILRRW  513

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AA
Sbjct  514  SDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAA  573

Query  380  GIRGSTL  360
            GIRGSTL
Sbjct  574  GIRGSTL  580



>gb|EPS62424.1| hypothetical protein M569_12368, partial [Genlisea aurea]
Length=114

 Score =   189 bits (479),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -1

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D+D +DL+LTLGGTG +PRDVTPEATK +++KETPGLLH+MM+ESLK+TPFA+LSR AAG
Sbjct  1    DVDKVDLILTLGGTGFAPRDVTPEATKEVIRKETPGLLHIMMRESLKVTPFAVLSRAAAG  60

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHA  228
            IRG+TLI+NMPGNPNAVAEC+E L+P LKHAL+QI+GDKREK+PRHVPHA
Sbjct  61   IRGTTLIVNMPGNPNAVAECVEALVPCLKHALRQIKGDKREKHPRHVPHA  110



>ref|XP_009350884.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like, partial 
[Pyrus x bretschneideri]
Length=588

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SERLGGARVV+TAVVPDD+ KI+D+L RW
Sbjct  470  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSERLGGARVVSTAVVPDDVSKIKDVLHRW  529

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  384
             DI+ MDL+LTLGGTG +PRDVTPEATK L++KETPGLLHVMMQESLK+TP AMLSR A
Sbjct  530  SDIEQMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLHVMMQESLKVTPTAMLSRSA  588



>ref|XP_007015554.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
 gb|EOY33173.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
Length=607

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            + +VA+LTVSDTVA+G GPDRSGPRAVSVVNSSSE+LGGA+VV  AVV DD+ KI+D+L 
Sbjct  471  QFKVAVLTVSDTVASGVGPDRSGPRAVSVVNSSSEKLGGAKVVAAAVVSDDVGKIKDVLQ  530

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
            RW DID MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR 
Sbjct  531  RWSDIDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRS  590

Query  386  AAGIRGSTLII  354
            AAGIRGSTL+I
Sbjct  591  AAGIRGSTLVI  601



>ref|XP_010240846.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nelumbo nucifera]
Length=587

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E RVA+LTVSDTVA+GAGPDRSGPRAVSVVNSSSERLGGARVV TAVVPD++ KI+D+L
Sbjct  476  AEVRVAVLTVSDTVASGAGPDRSGPRAVSVVNSSSERLGGARVVATAVVPDEVGKIKDVL  535

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKI  414
             +W DID +DL+LTLGGTG +PRDVTPEATK +++KETPGLL VMMQESLK+
Sbjct  536  QKWSDIDKIDLILTLGGTGFTPRDVTPEATKSVIEKETPGLLFVMMQESLKV  587



>ref|WP_036736197.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFD40901.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI34771.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI34987.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI37292.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
Length=163

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = -1

Query  737  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRWC  558
            V ILT SD  + G   D+SG   + ++NS      G +VVT  VV DD  +I++ L   C
Sbjct  4    VGILTASDKASGGKRQDQSGMVIIEIINSL-----GWKVVTYLVVADDTDQIKNALFSMC  58

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D   ++LVLT GGTG  PRD TPEATK ++++E PG+  +M  ES+K TP AMLSR  AG
Sbjct  59   DTQRLNLVLTSGGTGFGPRDNTPEATKAVIEREVPGIPEIMRWESMKKTPRAMLSRAVAG  118

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            IR  TLIIN+PG+P AV EC+E +LPAL H L+ + G   E
Sbjct  119  IRNQTLIINLPGSPKAVRECLEVILPALTHGLEILNGQTGE  159



>ref|WP_013258696.1| molybdenum cofactor synthesis domain-containing protein [Desulfarculus 
baarsii]
 gb|ADK85255.1| molybdenum cofactor synthesis domain protein [Desulfarculus baarsii 
DSM 2075]
Length=163

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 5/159 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            + AILTVSD  A G   D SGPR V ++  +     G +V+ TAVVPD++ KI   L  +
Sbjct  4    KAAILTVSDGAAEGRREDVSGPRLVQMLEEA-----GVQVIETAVVPDEMDKISAQLRLY  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D   + LVLT GGTG S RDVTPEAT+ +L++  PGL   M  E LKITP A+LSR   
Sbjct  59   ADYLKVSLVLTTGGTGLSRRDVTPEATRRVLERTVPGLAEAMRAEGLKITPHAVLSRGVC  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  264
            GIRG+TLIIN+PG PNA  E ++ +LPAL H L ++RGD
Sbjct  119  GIRGATLIINLPGGPNAAVEGLKIILPALPHGLNKLRGD  157



>gb|ACD50083.1| molybdopterin biosynthesis enzyme [uncultured crenarchaeote MCG]
Length=169

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 5/159 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSD    G   D SGP   + + +      G RV  T +VPD+ ++IR  LL W
Sbjct  4    RVAILTVSDRSFLGERVDESGPALAACLAAE-----GWRVTGTQLVPDEQEQIRAALLAW  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
               +  D++LT GGTG +PRDVTPEAT+ L++K+ PGL  VM    L+I+P AMLSR  A
Sbjct  59   ITKNAADVILTTGGTGFAPRDVTPEATQSLIEKDAPGLAEVMRASGLRISPHAMLSRARA  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  264
            GIRG TLI+N+PG+P    E ++ +LPAL HA++ +RGD
Sbjct  119  GIRGRTLIVNLPGSPTGAVESLQAILPALGHAVQLLRGD  157



>pdb|1JLJ|A Chain A, 1.6 Angstrom Crystal Structure Of The Human Neuroreceptor 
Anchoring And Molybdenum Cofactor Biosynthesis Protein 
Gephyrin
 pdb|1JLJ|B Chain B, 1.6 Angstrom Crystal Structure Of The Human Neuroreceptor 
Anchoring And Molybdenum Cofactor Biosynthesis Protein 
Gephyrin
 pdb|1JLJ|C Chain C, 1.6 Angstrom Crystal Structure Of The Human Neuroreceptor 
Anchoring And Molybdenum Cofactor Biosynthesis Protein 
Gephyrin
Length=189

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>pdb|1IHC|A Chain A, X-Ray Structure Of Gephyrin N-Terminal Domain
Length=188

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>gb|EMS55337.1| Molybdopterin biosynthesis protein CNX1 [Triticum urartu]
Length=661

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -1

Query  749  SESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDIL  570
            +E +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL
Sbjct  375  AEVKVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEIL  434

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKI  414
            ++W DID ++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLK+
Sbjct  435  VKWSDIDRVNLILTLGGTGFTPRDVTPEATKSVIQKEAPGLAFVMIQESLKL  486



>ref|WP_041287293.1| cytoplasmic protein [Desulfomonile tiedjei]
Length=162

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            R  ILTVSD  + G   D SGP    ++ S      G +   TAVVPD+ + I+++L+ W
Sbjct  2    RAGILTVSDRSSQGLREDTSGPELEQILRSR-----GFQTEWTAVVPDEEKSIQEMLVTW  56

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D    DL+LT GGTG SPRDVTPEAT  +  +  PG+   M  ESLK TP AM+SR  A
Sbjct  57   ADQYQADLILTTGGTGLSPRDVTPEATSAICHRLVPGMAEAMRAESLKKTPHAMISRAVA  116

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            G+RG TLIIN+PG+P    E +E +LPAL+HA+ +++GD  E
Sbjct  117  GVRGRTLIINLPGSPRGARENLEVVLPALEHAISKLQGDPSE  158



>gb|AFM26240.1| molybdopterin adenylyltransferase [Desulfomonile tiedjei DSM 
6799]
Length=171

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            R  ILTVSD  + G   D SGP    ++ S      G +   TAVVPD+ + I+++L+ W
Sbjct  11   RAGILTVSDRSSQGLREDTSGPELEQILRSR-----GFQTEWTAVVPDEEKSIQEMLVTW  65

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D    DL+LT GGTG SPRDVTPEAT  +  +  PG+   M  ESLK TP AM+SR  A
Sbjct  66   ADQYQADLILTTGGTGLSPRDVTPEATSAICHRLVPGMAEAMRAESLKKTPHAMISRAVA  125

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            G+RG TLIIN+PG+P    E +E +LPAL+HA+ +++GD  E
Sbjct  126  GVRGRTLIINLPGSPRGARENLEVVLPALEHAISKLQGDPSE  167



>ref|WP_006980928.1| molybdenum cofactor synthesis domain protein [Chthoniobacter 
flavus]
 gb|EDY18945.1| molybdenum cofactor synthesis domain protein [Chthoniobacter 
flavus Ellin428]
Length=157

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +VA +T+SD  +AG   DRSGP    ++N S    G        V+PD+  +I + L R 
Sbjct  2    KVARITLSDRASAGVYEDRSGPEIERILNES---FGSGIEWQRVVIPDERVQIEEALRRM  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD++H DLV+T GGTG +PRDVTPEAT+ +L++E PG   VM  +S    P A+LSR  A
Sbjct  59   CDVEHCDLVVTTGGTGPAPRDVTPEATRAVLEREMPGFGEVMRMQSFARVPTAILSRSTA  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  264
            G RG TLIIN+PGNP A+ EC+  L+PA++  ++ + G+
Sbjct  119  GTRGQTLIINLPGNPKAIGECLPMLIPAIRECIRHLHGE  157



>ref|WP_013707323.1| molybdenum cofactor synthesis domain-containing protein [Desulfobacca 
acetoxidans]
 gb|AEB10214.1| molybdenum cofactor synthesis domain protein [Desulfobacca acetoxidans 
DSM 11109]
Length=163

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV ILT SD  A G   D S   A  ++  +       RV   A+VPD  + I D+L+ W
Sbjct  3    RVGILTCSDKGARGEREDLSAQEARKLLPVNV-----FRVENYAIVPDTREAITDLLVAW  57

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD D +DL+LT GGTG SPRDVTPEAT+ ++++E PG+   M   SL  TP AMLSR  A
Sbjct  58   CDQDRLDLILTTGGTGLSPRDVTPEATRGVIEREVPGMAEAMRAASLLKTPHAMLSRGVA  117

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            GIRG TLI+N+PG+P  V E +E +LPAL HAL++I+G   E
Sbjct  118  GIRGQTLIVNLPGSPKGVRENLEVVLPALPHALEKIKGSPAE  159



>emb|CAI78652.1| molybdopterin biosynthesis enzymes [uncultured delta proteobacterium]
Length=165

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            R  I+TVSD  + G   D SGP    ++ + S       +  T +VPD+ Q I+  ++  
Sbjct  4    RAGIITVSDRSSQGLRQDASGPALAKMLAAES-----IEICQTTIVPDEKQDIKKAIINL  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D +++DL+LT GGTG SPRDVTP+AT  +++K+ PG+  VM +ES +ITP AM+SR   
Sbjct  59   ADKENIDLILTTGGTGVSPRDVTPDATMEVIEKQIPGMAEVMRRESSRITPHAMISRAIT  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            GIRGS+LIIN+PG+P    E +  ++PALKHA+++I+GD  E
Sbjct  119  GIRGSSLIINLPGSPKGATENLAAIMPALKHAIEKIKGDTSE  160



>ref|XP_008863022.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETW09211.1| hypothetical protein, variant 3 [Aphanomyces invadans]
Length=629

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 110/159 (69%), Gaps = 6/159 (4%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  567
            R  +LTVSD+V+ G   DRSGP    V+ ++   + G    +V  AVV D++ +I++++ 
Sbjct  461  RACVLTVSDSVSRGDSTDRSGP----VMQTTLTEMPGLAVEIVQAAVVADEVDEIQNVVR  516

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD+ H+DL++T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL +TP A+L+RP
Sbjct  517  TWCDVAHVDLIVTSGGTGFSPRDVTPEAVKVLLDRDAPGLVHKMLQASLDVTPMAILARP  576

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
             AG+RG TL++ +PG PNAV E +  L P L HAL  ++
Sbjct  577  VAGMRGHTLVLTLPGKPNAVVETLTALAPVLPHALHLLQ  615



>ref|XP_008314898.1| PREDICTED: gephyrin-like isoform X3 [Cynoglossus semilaevis]
Length=750

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPDDI++I++ LL
Sbjct  14   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDDIEEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG SPRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDEQELNLILTTGGTGFSPRDVTPEATRDVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008863020.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETW09209.1| hypothetical protein, variant 1 [Aphanomyces invadans]
Length=669

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 110/159 (69%), Gaps = 6/159 (4%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  567
            R  +LTVSD+V+ G   DRSGP    V+ ++   + G    +V  AVV D++ +I++++ 
Sbjct  501  RACVLTVSDSVSRGDSTDRSGP----VMQTTLTEMPGLAVEIVQAAVVADEVDEIQNVVR  556

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD+ H+DL++T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL +TP A+L+RP
Sbjct  557  TWCDVAHVDLIVTSGGTGFSPRDVTPEAVKVLLDRDAPGLVHKMLQASLDVTPMAILARP  616

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
             AG+RG TL++ +PG PNAV E +  L P L HAL  ++
Sbjct  617  VAGMRGHTLVLTLPGKPNAVVETLTALAPVLPHALHLLQ  655



>ref|XP_008314890.1| PREDICTED: gephyrin-like isoform X2 [Cynoglossus semilaevis]
Length=784

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPDDI++I++ LL
Sbjct  14   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDDIEEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG SPRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDEQELNLILTTGGTGFSPRDVTPEATRDVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_037464714.1| cytoplasmic protein [Smithella sp. F21]
 gb|KFN38953.1| cytoplasmic protein [Smithella sp. F21]
Length=163

 Score =   147 bits (370),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 112/161 (70%), Gaps = 9/161 (6%)
 Frame = -1

Query  731  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRWC  558
            I+TVSD  + G   D SGP    V+   +E L GA  ++  T ++PD+I +I++ ++++ 
Sbjct  5    IITVSDKGSQGKREDLSGP----VI---AEMLAGAAIQIKQTLIIPDEIDRIKEAIIQFA  57

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D++ +DL+LT GGTG SPRD+TP+AT  +L KE PG+   M   S+KITP AM+SR  AG
Sbjct  58   DVEKLDLILTTGGTGVSPRDLTPDATLKVLDKEVPGMAEAMRIASMKITPHAMISRAVAG  117

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            IRG +LIIN+PG+P    E +  +LPAL+HA+++++GD R+
Sbjct  118  IRGRSLIINLPGSPKGAKENLSAVLPALQHAIEKMKGDDRD  158



>ref|XP_004881940.1| PREDICTED: gephyrin-like [Heterocephalus glaber]
Length=381

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_014355808.1| molybdenum cofactor biosynthesis protein MoaB [Acetobacterium 
woodii]
 gb|AFA48205.1| molybdenum cofactor biosynthesis protein MoaB [Acetobacterium 
woodii DSM 1030]
Length=167

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 106/156 (68%), Gaps = 4/156 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            R  I+T+SD  + G   D+SGP   +++++++      +VV T ++PDD++ I+  L+ W
Sbjct  3    RTGIMTLSDKGSKGQREDKSGPMIQTMLSTTNLY----QVVKTIILPDDLETIKKNLITW  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D DH+DL+LT GGTG S RD TPEAT  + ++ TPG+   M   SL+ITP AMLSR AA
Sbjct  59   VDDDHLDLILTTGGTGFSQRDWTPEATIAVCERMTPGIPEAMRYHSLQITPKAMLSRSAA  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQI  273
            GIR  TLIIN+PG+P AV E +E +LPAL H L+ +
Sbjct  119  GIRKQTLIINLPGSPKAVKENLEAILPALDHGLEML  154



>gb|EAW80925.1| gephyrin, isoform CRA_c [Homo sapiens]
Length=398

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006800724.1| PREDICTED: gephyrin-like [Neolamprologus brichardi]
Length=651

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_005461956.1| PREDICTED: gephyrin-like isoform X4 [Oreochromis niloticus]
Length=784

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_005461953.1| PREDICTED: gephyrin-like isoform X1 [Oreochromis niloticus]
 ref|XP_005461954.1| PREDICTED: gephyrin-like isoform X2 [Oreochromis niloticus]
Length=818

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_005751787.1| PREDICTED: gephyrin-like isoform X2 [Pundamilia nyererei]
Length=738

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_007575455.1| PREDICTED: gephyrin-like isoform X2 [Poecilia formosa]
Length=736

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I++I++ LL
Sbjct  14   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIEEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005812094.1| PREDICTED: gephyrin-like [Xiphophorus maculatus]
Length=736

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I++I++ LL
Sbjct  14   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIEEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_003962333.1| PREDICTED: gephyrin-like isoform 1 [Takifugu rubripes]
Length=744

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ LL
Sbjct  14   QTRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIVAYKIVPDEIDEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDDLELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_013626116.1| molybdopterin adenylyltransferase [Syntrophobotulus glycolicus]
 gb|ADY57344.1| molybdopterin adenylyltransferase [Syntrophobotulus glycolicus 
DSM 8271]
Length=166

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 109/159 (69%), Gaps = 5/159 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV ILTVSD  A+G   D+SGP    ++ +      G      +++PD+ +KI   L+ +
Sbjct  3    RVGILTVSDRGASGEREDQSGPLIKEIMQNR-----GWETAACSIIPDERKKIAQKLIEY  57

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D  ++D+V T GGTG +PRDVTPEAT  ++++  PGL+  ++ ESLKITP AMLSR  +
Sbjct  58   ADDLNIDVVFTTGGTGFAPRDVTPEATLDVVERLAPGLVQAILFESLKITPRAMLSRAVS  117

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  264
            GIRG T+I+N+PG+P AV EC++ +LPAL+H ++ +RG+
Sbjct  118  GIRGGTIIVNLPGSPKAVRECLDVVLPALEHGVQILRGE  156



>ref|XP_007575454.1| PREDICTED: gephyrin-like isoform X1 [Poecilia formosa]
Length=766

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I++I++ LL
Sbjct  14   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIEEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_027356596.1| cytoplasmic protein [Desulfotomaculum thermocisternum]
Length=163

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV ILT SD  + G   DRS      V+      +GG  VV+  +VPDD+  +++ L++ 
Sbjct  3    RVGILTASDKGSRGEREDRS----AGVIREMVAGIGG-EVVSYYIVPDDLDVLKETLIKM  57

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D + +DL+LT GGTG +PRD TPEAT+ ++Q+E PG+  VM  ESLK TP AMLSR AA
Sbjct  58   VDQEKLDLILTTGGTGFAPRDNTPEATRAVIQREVPGIPEVMRLESLKKTPRAMLSRAAA  117

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  267
            GIR  TLIIN+PG+  AV EC+E +LPAL H L+ + G
Sbjct  118  GIRHQTLIINLPGSARAVRECLEVILPALSHGLEILTG  155



>ref|WP_009711043.1| molybdopterin biosynthesis mog protein [Desmospora sp. 8437]
 gb|EGK09125.1| molybdopterin biosynthesis mog protein [Desmospora sp. 8437]
Length=170

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV I+T SD  A G   DRSG     ++           V    VVPD+  +I+++L+R 
Sbjct  3    RVGIVTASDKGARGEREDRSGEEIRRLLREPD-----FEVSAWEVVPDEQGRIKEVLIRM  57

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D + +DLVLT GGTG +PRDVTPEAT+ ++ +E PG+   M   SL+ TPF MLSR  A
Sbjct  58   ADTERLDLVLTTGGTGLAPRDVTPEATRDVIGREVPGIPEAMRLASLRKTPFGMLSRGVA  117

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  264
            G+RG TLIIN+PG+P AV EC+E +LP L HAL+ + G+
Sbjct  118  GLRGKTLIINLPGSPKAVRECLEAVLPVLPHALETMTGE  156



>ref|XP_005090818.1| PREDICTED: uncharacterized protein LOC101848404 isoform X1 [Aplysia 
californica]
Length=1637

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            +V ILTVSD+   G   DRSG     VV S   +L   RV+T  ++PD+ ++I++ LL W
Sbjct  11   KVGILTVSDSCFNGTATDRSGENLKQVVES--RKLFNGRVITKDILPDEQEQIKNKLLHW  68

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D   +DL+LT GGTG +PRDVTPEATK +++KE PG++  M++ SL+ITP AMLSRP  
Sbjct  69   SDHLKLDLILTTGGTGFAPRDVTPEATKSVIEKEAPGMIVAMLKGSLEITPLAMLSRPVC  128

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDK  261
            G RG TLIIN+PG+    +EC++ +   + HA+  +RG K
Sbjct  129  GTRGCTLIINLPGSTKGSSECLQLVSAGIPHAVDLLRGHK  168



>ref|XP_005751786.1| PREDICTED: gephyrin-like isoform X1 [Pundamilia nyererei]
Length=784

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_004569994.1| PREDICTED: gephyrin-like [Maylandia zebra]
Length=777

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREAMVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_003962334.1| PREDICTED: gephyrin-like isoform 2 [Takifugu rubripes]
Length=778

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ LL
Sbjct  14   QTRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIVAYKIVPDEIDEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDDLELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>gb|KIE17875.1| cytoplasmic protein [Smithella sp. SC_K08D17]
Length=163

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = -1

Query  731  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRWC  558
            I+TVSD  + G   D SGP       + +E L G    +  T ++PD+  +I++ L+ + 
Sbjct  6    IITVSDKGSQGKREDLSGP-------AIAEMLAGIAIEIKQTIIIPDEKDQIQEALINFA  58

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D+  +DL+LT GGTG SPRD+TP+AT  ++ KE PG+   M Q+SL ITP AM+SR  AG
Sbjct  59   DVQKLDLILTTGGTGVSPRDLTPDATLAVIDKEVPGMAEAMRQKSLLITPHAMISRAVAG  118

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            IRG  LIIN+PG+P +V E +  +LPALKHA+++I+GD  E
Sbjct  119  IRGRCLIINLPGSPRSVKENLAVILPALKHAIEKIKGDDSE  159



>ref|XP_005942199.1| PREDICTED: gephyrin-like isoform X2 [Haplochromis burtoni]
Length=785

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|NP_001125964.1| gephyrin [Pongo abelii]
 emb|CAH91640.1| hypothetical protein [Pongo abelii]
Length=468

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGPQECFQFILPALPHAIDLLR  170



>ref|WP_040663553.1| cytoplasmic protein [Oscillibacter ruminantium]
Length=166

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 5/159 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            + A+LTVSD  + G  PD  GP   +++  +     G  V+ TA+VPD+  +I   L  W
Sbjct  4    KAAVLTVSDRSSRGERPDEGGPLISALLQDA-----GYEVLRTAIVPDEQAEIARFLREW  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             DI  + L+LT GGTG +PRDVTPEAT  + Q+ TPG+   M   SL ITP AMLSR AA
Sbjct  59   ADIGEVQLILTTGGTGFAPRDVTPEATCSVCQRMTPGIPEAMRAASLAITPRAMLSRAAA  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  264
            GIRG TLI+N+PG+P A  E +E +LP L H L+ + G+
Sbjct  119  GIRGGTLIVNLPGSPKAAKENLEAVLPTLGHGLQMLSGE  157



>ref|WP_026370918.1| cytoplasmic protein [bacterium JKG1]
Length=171

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 104/165 (63%), Gaps = 4/165 (2%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RVAILTVSD  AAG   D SG    +++ +  +    A+V    VVPD+   I   L  W
Sbjct  4    RVAILTVSDRSAAGQRADASGDVIRALITTRLD----AQVTAYRVVPDEQPAIVAALCEW  59

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D   +DL+LT GGTG +PRDVTPEAT+ ++++E PG+   M    L++TPFAMLSR  A
Sbjct  60   ADSGAIDLILTTGGTGLAPRDVTPEATRAVIEREVPGIPEAMRAAGLRVTPFAMLSRMVA  119

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNP  246
            G RG  LIIN+PG+P  V E +E LLPAL H L ++ GD R+  P
Sbjct  120  GTRGRCLIINLPGSPKGVRENLEVLLPALGHGLDKLLGDPRDCAP  164



>ref|WP_037380935.1| MULTISPECIES: cytoplasmic protein [Smithella]
 gb|KFZ44231.1| cytoplasmic protein [Smithella sp. D17]
Length=162

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = -1

Query  731  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRWC  558
            I+TVSD  + G   D SGP       + +E L G    +  T ++PD+  +I++ L+ + 
Sbjct  5    IITVSDKGSQGKREDLSGP-------AIAEMLAGIAIEIKQTIIIPDEKDQIQEALINFA  57

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D+  +DL+LT GGTG SPRD+TP+AT  ++ KE PG+   M Q+SL ITP AM+SR  AG
Sbjct  58   DVQKLDLILTTGGTGVSPRDLTPDATLAVIDKEVPGMAEAMRQKSLLITPHAMISRAVAG  117

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            IRG  LIIN+PG+P +V E +  +LPALKHA+++I+GD  E
Sbjct  118  IRGRCLIINLPGSPRSVKENLAVILPALKHAIEKIKGDDSE  158



>ref|XP_005942198.1| PREDICTED: gephyrin-like isoform X1 [Haplochromis burtoni]
Length=819

 Score =   154 bits (390),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  50   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLL  107

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  108  EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  167

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADA  222
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    
Sbjct  168  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSP  227

Query  221  VPADTWERSH  192
            + A+T+  +H
Sbjct  228  LQANTYANTH  237



>ref|XP_003707233.1| PREDICTED: LOW QUALITY PROTEIN: gephyrin-like [Megachile rotundata]
Length=633

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 105/166 (63%), Gaps = 4/166 (2%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG---ARVVTTAVVPDDIQKIRDIL  570
            R  +LTVSD+       D+SGP     ++++   +G     +V    +VPDD   I++ L
Sbjct  5    RFGLLTVSDSCYKYKKEDKSGPEVELCISNNGTEIGKILRGQVFHKDIVPDDEYAIKEKL  64

Query  569  LRWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  390
            + W D   +D++ T+GGTG S RDVTPEATK ++QKE PGL+  M+  SLKITP AMLSR
Sbjct  65   ISWSDSRQVDVIFTIGGTGFSKRDVTPEATKEIIQKEAPGLVIAMLTSSLKITPMAMLSR  124

Query  389  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREK  252
             A GIR  TLIIN+PG+P A  EC+  + PA+ HA+  IR D  EK
Sbjct  125  AACGIRDKTLIINLPGSPKAAKECLSVIAPAISHAVDLIR-DNTEK  169



>ref|WP_014117170.1| molybdenum cofactor biosynthesis protein [Oscillibacter valericigenes]
 dbj|BAK98486.1| molybdenum cofactor biosynthesis protein [Oscillibacter valericigenes 
Sjm18-20]
Length=166

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 101/158 (64%), Gaps = 5/158 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            + A+LTVSD    G  PD  GP   +++  +     G  ++ TA+VPD+ ++I  +L  W
Sbjct  4    KAAVLTVSDRSFRGQRPDEGGPLVSALLQGA-----GYEILRTAMVPDEQEEIARVLREW  58

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D   + LVLT GGTG SPRDVTPEAT  + Q+ TPG+   M   SL ITP AMLSR AA
Sbjct  59   ADAGDVQLVLTTGGTGFSPRDVTPEATLAVCQRLTPGIPEAMRAASLSITPRAMLSRAAA  118

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  267
            GIRG TLI+N+PG+P A  E +E +LPAL H L+ + G
Sbjct  119  GIRGGTLIVNLPGSPRAAKENLEAVLPALGHGLQMLSG  156



>ref|XP_010743433.1| PREDICTED: gephyrin-like isoform X2 [Larimichthys crocea]
Length=744

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I+D LL
Sbjct  14   QTRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKDTLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDELELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545562.1| PREDICTED: gephyrin isoform X6 [Poecilia formosa]
Length=686

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_037388918.1| cytoplasmic protein [Smithella sp. SCADC]
 gb|KFO66623.1| cytoplasmic protein [Smithella sp. SCADC]
Length=163

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = -1

Query  731  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRWC  558
            I+TVSD  + G   D SGP       + +E L G    +  T ++PD+  +I++ ++ + 
Sbjct  6    IITVSDKGSQGKREDLSGP-------AIAEMLAGIAIEIKQTIIIPDEKDQIQEAIINFA  58

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D+  +DL+LT GGTG SPRD+TP+AT  ++ KE PG+   M Q+SL ITP AM+SR  AG
Sbjct  59   DVQKLDLILTTGGTGVSPRDLTPDATLAVIDKEVPGMAEAMRQKSLLITPHAMISRAVAG  118

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            IRG  LIIN+PG+P +V E +  +LPALKHA+++I+GD  E
Sbjct  119  IRGRCLIINLPGSPKSVKENLAVILPALKHAIEKIKGDDSE  159



>ref|WP_039740847.1| cytoplasmic protein [Geobacter pickeringii]
 gb|AJE02727.1| cytoplasmic protein [Geobacter pickeringii]
Length=168

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 105/165 (64%), Gaps = 5/165 (3%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            + AILT+SD  + G   D SGP  VS +   +ER  GA  V TA++PD+   I + L  W
Sbjct  2    KTAILTLSDKGSRGERTDASGPALVSWL---AER--GAETVRTAIIPDEAALIEETLRNW  56

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D    DL+LT GGTG SPRDVTP+AT  +L +  PG   VM   SL+ TP AM+SR  A
Sbjct  57   ADSGEFDLILTTGGTGVSPRDVTPDATVKILDRLIPGFGEVMRMRSLQKTPHAMISRAVA  116

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNP  246
            GIR +TLIIN+PG+P    E +E + PA+ HA+++I+GD R+  P
Sbjct  117  GIRKATLIINLPGSPRGAVENLEAVWPAVPHAVEKIQGDTRDCAP  161



>ref|XP_001627768.1| predicted protein [Nematostella vectensis]
 gb|EDO35668.1| predicted protein [Nematostella vectensis]
Length=624

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 100/154 (65%), Gaps = 2/154 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD  + G   DRSGP    +V     RL   + V    VPDDI++I+ +LLRW
Sbjct  8    RVGVLTVSDRCSRGKAEDRSGPNLTRLV-LEEPRLS-IKEVAHECVPDDIEEIKKVLLRW  65

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
             D DH++L+LT GGTG SPRDVTPEAT  ++ +  PGL H MM+ESLK+TP AMLSRP  
Sbjct  66   SDEDHLNLILTTGGTGFSPRDVTPEATSQVIDRLAPGLAHRMMEESLKVTPLAMLSRPVC  125

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALK  279
            G R  TLIIN PG+     EC   +  AL HA++
Sbjct  126  GTRKRTLIINFPGSVKGSQECFHFISRALPHAIE  159



>ref|XP_004356987.1| Gephyrin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR24968.1| Gephyrin, putative [Acanthamoeba castellanii str. Neff]
Length=181

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = -1

Query  737  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRWC  558
            V +LTVSD V+ G   D SGP A+S++    + L  A+VV TAVV D++  I+ +L  W 
Sbjct  12   VGVLTVSDRVSRGEAEDLSGPLAISIIE---QHLKHAKVVATAVVADEVDDIQRVLKEWS  68

Query  557  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  378
            D   + L+LT GGTG +PRD+TPEATK +L +E PG++  M+  SL++TP AMLSRPAAG
Sbjct  69   DGRKLQLILTTGGTGFAPRDITPEATKAILDREAPGMVVAMVSASLQVTPHAMLSRPAAG  128

Query  377  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNP  246
            +R  TLI+N+PG+  AV E ++ LLP L HA+  +R D R   P
Sbjct  129  MRKQTLIVNLPGSSKAVKENIDVLLPVLPHAIGLLRQDPRAAQP  172



>ref|XP_009820958.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV88558.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=563

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  567
            R  +LTVSD+V+ G   DRSGP    V+ S+   + G    +V  A+V D+  +I+ ++ 
Sbjct  395  RACVLTVSDSVSQGLAIDRSGP----VMQSTLLAIPGLDVEIVQAAIVADEHDEIQHVVR  450

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD  H+D V+T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL++TP A+L+RP
Sbjct  451  SWCDDLHVDFVVTSGGTGFSPRDVTPEAVKTLLHRDAPGLVHKMLQASLEVTPMAILARP  510

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
             AGIRG TL++ +PG PNAV E +  + P L HAL  ++
Sbjct  511  VAGIRGHTLVVTLPGKPNAVVETLNAIAPVLPHALHLLQ  549



>ref|XP_010743432.1| PREDICTED: gephyrin-like isoform X1 [Larimichthys crocea]
Length=778

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I+D LL
Sbjct  14   QTRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKDTLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDELELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008301210.1| PREDICTED: gephyrin-like [Stegastes partitus]
Length=779

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -1

Query  746  ESRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILL  567
            ++RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL
Sbjct  14   QTRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVISAYKIVPDEIDEIKETLL  71

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP
Sbjct  72   EWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRP  131

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
              GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  132  VCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>gb|ABC77449.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
Length=175

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -1

Query  734  AILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRWCD  555
             ++TVSD  + G   D SG   V ++   S       +  TA++PD+  +IR  L+   D
Sbjct  17   GVVTVSDKGSRGEREDLSGKEVVRMLEELS-----ILISETAIIPDEKDQIRQTLIDLAD  71

Query  554  IDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGI  375
               +DL++T GGTG +PRDVTP+AT  ++++  PG+   M QESLK TP AM+SR  AGI
Sbjct  72   NKKLDLIVTTGGTGVTPRDVTPDATLEVIERVLPGMAEAMRQESLKKTPHAMISRAVAGI  131

Query  374  RGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            RG TLIIN+PG+P  V E +  +LPALKHAL++IRGD+ E
Sbjct  132  RGQTLIINLPGSPRGVRENLAVILPALKHALEKIRGDETE  171



>ref|WP_041584862.1| cytoplasmic protein [Syntrophus aciditrophicus]
Length=164

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -1

Query  734  AILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRWCD  555
             ++TVSD  + G   D SG   V ++   S       +  TA++PD+  +IR  L+   D
Sbjct  6    GVVTVSDKGSRGEREDLSGKEVVRMLEELS-----ILISETAIIPDEKDQIRQTLIDLAD  60

Query  554  IDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGI  375
               +DL++T GGTG +PRDVTP+AT  ++++  PG+   M QESLK TP AM+SR  AGI
Sbjct  61   NKKLDLIVTTGGTGVTPRDVTPDATLEVIERVLPGMAEAMRQESLKKTPHAMISRAVAGI  120

Query  374  RGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  255
            RG TLIIN+PG+P  V E +  +LPALKHAL++IRGD+ E
Sbjct  121  RGQTLIINLPGSPRGVRENLAVILPALKHALEKIRGDETE  160



>ref|XP_009820957.1| hypothetical protein H257_00123 [Aphanomyces astaci]
 gb|ETV88557.1| hypothetical protein H257_00123 [Aphanomyces astaci]
Length=631

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  567
            R  +LTVSD+V+ G   DRSGP    V+ S+   + G    +V  A+V D+  +I+ ++ 
Sbjct  463  RACVLTVSDSVSQGLAIDRSGP----VMQSTLLAIPGLDVEIVQAAIVADEHDEIQHVVR  518

Query  566  RWCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  387
             WCD  H+D V+T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL++TP A+L+RP
Sbjct  519  SWCDDLHVDFVVTSGGTGFSPRDVTPEAVKTLLHRDAPGLVHKMLQASLEVTPMAILARP  578

Query  386  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
             AGIRG TL++ +PG PNAV E +  + P L HAL  ++
Sbjct  579  VAGIRGHTLVVTLPGKPNAVVETLNAIAPVLPHALHLLQ  617



>ref|XP_007545554.1| PREDICTED: gephyrin isoform X5 [Poecilia formosa]
Length=736

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545531.1| PREDICTED: gephyrin isoform X2 [Poecilia formosa]
Length=781

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960581.1| PREDICTED: gephyrin isoform X6 [Camelus bactrianus]
 ref|XP_010974935.1| PREDICTED: gephyrin isoform X7 [Camelus dromedarius]
Length=755

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006207020.1| PREDICTED: gephyrin isoform X5 [Vicugna pacos]
 ref|XP_010960583.1| PREDICTED: gephyrin isoform X8 [Camelus bactrianus]
 ref|XP_010974936.1| PREDICTED: gephyrin isoform X8 [Camelus dromedarius]
Length=736

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545546.1| PREDICTED: gephyrin isoform X4 [Poecilia formosa]
Length=737

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960578.1| PREDICTED: gephyrin isoform X3 [Camelus bactrianus]
 ref|XP_010974932.1| PREDICTED: gephyrin isoform X4 [Camelus dromedarius]
Length=794

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005072876.1| PREDICTED: gephyrin [Mesocricetus auratus]
Length=704

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006207018.1| PREDICTED: gephyrin isoform X3 [Vicugna pacos]
Length=769

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545524.1| PREDICTED: gephyrin isoform X1 [Poecilia formosa]
Length=794

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960579.1| PREDICTED: gephyrin isoform X4 [Camelus bactrianus]
 ref|XP_010974933.1| PREDICTED: gephyrin isoform X5 [Camelus dromedarius]
Length=779

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960582.1| PREDICTED: gephyrin isoform X7 [Camelus bactrianus]
 ref|XP_010974929.1| PREDICTED: gephyrin isoform X1 [Camelus dromedarius]
Length=837

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960580.1| PREDICTED: gephyrin isoform X5 [Camelus bactrianus]
 ref|XP_010974934.1| PREDICTED: gephyrin isoform X6 [Camelus dromedarius]
Length=772

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006207017.1| PREDICTED: gephyrin isoform X2 [Vicugna pacos]
Length=772

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004624968.1| PREDICTED: gephyrin [Octodon degus]
Length=756

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960577.1| PREDICTED: gephyrin isoform X2 [Camelus bactrianus]
 ref|XP_010974931.1| PREDICTED: gephyrin isoform X3 [Camelus dromedarius]
Length=813

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_074056.2| gephyrin [Rattus norvegicus]
 ref|XP_006515970.1| PREDICTED: gephyrin isoform X9 [Mus musculus]
 emb|CAA47009.2| Gephyrin [Rattus norvegicus]
Length=736

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>emb|CAC81240.1| gephyrin [Homo sapiens]
Length=736

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960576.1| PREDICTED: gephyrin isoform X1 [Camelus bactrianus]
 ref|XP_010974930.1| PREDICTED: gephyrin isoform X2 [Camelus dromedarius]
Length=815

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_001026720.1| gephyrin [Gallus gallus]
 sp|Q9PW38.1|GEPH_CHICK RecName: Full=Gephyrin; Includes: RecName: Full=Molybdopterin 
adenylyltransferase; Short=MPT adenylyltransferase; AltName: 
Full=Domain G; Includes: RecName: Full=Molybdopterin molybdenumtransferase; 
Short=MPT Mo-transferase; AltName: Full=Domain 
E [Gallus gallus]
 gb|AAD49748.1|AF174130_1 gephyrin [Gallus gallus]
Length=736

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_001019389.1| gephyrin isoform 2 [Homo sapiens]
 ref|NP_001244744.1| gephyrin [Macaca mulatta]
 ref|XP_001369878.1| PREDICTED: gephyrin isoform X3 [Monodelphis domestica]
 ref|XP_002754065.1| PREDICTED: gephyrin isoform X13 [Callithrix jacchus]
 ref|XP_001135627.2| PREDICTED: gephyrin isoform X21 [Pan troglodytes]
 ref|XP_003435080.1| PREDICTED: gephyrin isoformX2 [Canis lupus familiaris]
 ref|XP_003586639.1| PREDICTED: gephyrin isoform X10 [Bos taurus]
 ref|XP_003824107.1| PREDICTED: gephyrin isoform X8 [Pan paniscus]
 ref|XP_003924493.1| PREDICTED: gephyrin isoform X10 [Saimiri boliviensis boliviensis]
 ref|XP_004010776.1| PREDICTED: gephyrin isoform 2 [Ovis aries]
 ref|XP_004087211.1| PREDICTED: gephyrin isoform 2 [Nomascus leucogenys]
 ref|XP_004262187.1| PREDICTED: gephyrin isoform 2 [Orcinus orca]
 ref|XP_004371017.1| PREDICTED: gephyrin isoform 2 [Trichechus manatus latirostris]
 ref|XP_004397631.1| PREDICTED: gephyrin isoform 4 [Odobenus rosmarus divergens]
 ref|XP_004426313.1| PREDICTED: gephyrin isoform 2 [Ceratotherium simum simum]
 ref|XP_004584526.1| PREDICTED: gephyrin isoform X4 [Ochotona princeps]
 ref|XP_004612405.1| PREDICTED: gephyrin isoform X5 [Sorex araneus]
 ref|XP_004681829.1| PREDICTED: gephyrin isoform X5 [Condylura cristata]
 ref|XP_004739023.1| PREDICTED: gephyrin isoform X7 [Mustela putorius furo]
 ref|XP_004797269.1| PREDICTED: gephyrin isoform X6 [Mustela putorius furo]
 ref|XP_004837435.1| PREDICTED: gephyrin isoform X4 [Heterocephalus glaber]
 ref|XP_005343306.1| PREDICTED: gephyrin isoform X6 [Microtus ochrogaster]
 ref|XP_005399157.1| PREDICTED: gephyrin-like isoform X8 [Chinchilla lanigera]
 ref|XP_005561590.1| PREDICTED: gephyrin isoform X17 [Macaca fascicularis]
 ref|XP_005877968.1| PREDICTED: gephyrin isoform X4 [Myotis brandtii]
 ref|XP_006091049.1| PREDICTED: gephyrin isoform X9 [Myotis lucifugus]
 ref|XP_006973193.1| PREDICTED: gephyrin isoform X4 [Peromyscus maniculatus bairdii]
 ref|XP_007184378.1| PREDICTED: gephyrin isoform X10 [Balaenoptera acutorostrata scammoni]
 ref|XP_007525884.1| PREDICTED: gephyrin isoform X4 [Erinaceus europaeus]
 ref|XP_007985212.1| PREDICTED: gephyrin isoform X23 [Chlorocebus sabaeus]
 ref|XP_008850364.1| PREDICTED: gephyrin isoform X3 [Nannospalax galili]
 ref|XP_010643624.1| PREDICTED: gephyrin isoform X2 [Fukomys damarensis]
 ref|XP_011281585.1| PREDICTED: gephyrin isoform X6 [Felis catus]
 ref|XP_011382515.1| PREDICTED: gephyrin isoform X4 [Pteropus vampyrus]
 sp|Q9NQX3.1|GEPH_HUMAN RecName: Full=Gephyrin; Includes: RecName: Full=Molybdopterin 
adenylyltransferase; Short=MPT adenylyltransferase; AltName: 
Full=Domain G; Includes: RecName: Full=Molybdopterin molybdenumtransferase; 
Short=MPT Mo-transferase; AltName: Full=Domain 
E [Homo sapiens]
 gb|AAF81785.1|AF272663_1 gephyrin [Homo sapiens]
 dbj|BAG11318.1| gephyrin [synthetic construct]
Length=736

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803171.1| PREDICTED: gephyrin-like isoform X5 [Xiphophorus maculatus]
Length=736

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803167.1| PREDICTED: gephyrin-like isoform X1 [Xiphophorus maculatus]
Length=795

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_011382505.1| PREDICTED: gephyrin isoform X3 [Pteropus vampyrus]
Length=741

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803168.1| PREDICTED: gephyrin-like isoform X2 [Xiphophorus maculatus]
Length=794

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395704.1| PREDICTED: gephyrin isoform X11 [Poecilia reticulata]
Length=803

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005803169.1| PREDICTED: gephyrin-like isoform X3 [Xiphophorus maculatus]
Length=781

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395699.1| PREDICTED: gephyrin isoform X6 [Poecilia reticulata]
Length=848

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_010586998.1| PREDICTED: LOW QUALITY PROTEIN: gephyrin [Loxodonta africana]
Length=729

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803170.1| PREDICTED: gephyrin-like isoform X4 [Xiphophorus maculatus]
Length=776

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008171028.1| PREDICTED: gephyrin isoform X8 [Chrysemys picta bellii]
Length=755

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005267311.1| PREDICTED: gephyrin isoform X5 [Homo sapiens]
 ref|XP_005561589.1| PREDICTED: gephyrin isoform X16 [Macaca fascicularis]
 ref|XP_007473125.1| PREDICTED: gephyrin isoform X7 [Monodelphis domestica]
 ref|XP_007985209.1| PREDICTED: gephyrin isoform X21 [Chlorocebus sabaeus]
 ref|XP_009004423.1| PREDICTED: gephyrin isoform X11 [Callithrix jacchus]
 ref|XP_008976029.1| PREDICTED: gephyrin isoform X7 [Pan paniscus]
 ref|XP_009426255.1| PREDICTED: gephyrin isoform X19 [Pan troglodytes]
 ref|XP_010333477.1| PREDICTED: gephyrin isoform X8 [Saimiri boliviensis boliviensis]
Length=755

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008137161.1| PREDICTED: gephyrin isoform X4 [Eptesicus fuscus]
Length=736

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_009004421.1| PREDICTED: gephyrin isoform X8 [Callithrix jacchus]
Length=779

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005149323.1| PREDICTED: gephyrin isoform X2 [Melopsittacus undulatus]
 ref|XP_005230782.1| PREDICTED: gephyrin isoform X2 [Falco peregrinus]
 ref|XP_005306755.1| PREDICTED: gephyrin isoform X9 [Chrysemys picta bellii]
 ref|XP_005520408.1| PREDICTED: gephyrin isoform X2 [Pseudopodoces humilis]
 ref|XP_005961618.1| PREDICTED: gephyrin isoform X3 [Pantholops hodgsonii]
 ref|XP_006266489.1| PREDICTED: gephyrin isoform X2 [Alligator mississippiensis]
 ref|XP_007940488.1| PREDICTED: gephyrin isoform X3 [Orycteropus afer afer]
Length=736

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395702.1| PREDICTED: gephyrin isoform X9 [Poecilia reticulata]
Length=834

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_008395700.1| PREDICTED: gephyrin isoform X7 [Poecilia reticulata]
Length=848

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005306754.1| PREDICTED: gephyrin isoform X7 [Chrysemys picta bellii]
Length=769

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395694.1| PREDICTED: gephyrin isoform X1 [Poecilia reticulata]
Length=867

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_008395695.1| PREDICTED: gephyrin isoform X2 [Poecilia reticulata]
Length=866

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_008395703.1| PREDICTED: gephyrin isoform X10 [Poecilia reticulata]
Length=809

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_007525883.1| PREDICTED: gephyrin isoform X3 [Erinaceus europaeus]
Length=769

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008137160.1| PREDICTED: gephyrin isoform X3 [Eptesicus fuscus]
Length=769

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004397630.1| PREDICTED: gephyrin isoform 3 [Odobenus rosmarus divergens]
 ref|XP_004612403.1| PREDICTED: gephyrin isoform X3 [Sorex araneus]
 ref|XP_004681827.1| PREDICTED: gephyrin isoform X3 [Condylura cristata]
 ref|XP_004837434.1| PREDICTED: gephyrin isoform X3 [Heterocephalus glaber]
 ref|XP_005267310.1| PREDICTED: gephyrin isoform X4 [Homo sapiens]
 ref|XP_005343304.1| PREDICTED: gephyrin isoform X4 [Microtus ochrogaster]
 ref|XP_005322863.1| PREDICTED: gephyrin isoform X5 [Ictidomys tridecemlineatus]
 ref|XP_005399156.1| PREDICTED: gephyrin-like isoform X7 [Chinchilla lanigera]
 ref|XP_005561588.1| PREDICTED: gephyrin isoform X15 [Macaca fascicularis]
 ref|XP_006091048.1| PREDICTED: gephyrin isoform X8 [Myotis lucifugus]
 ref|XP_007985207.1| PREDICTED: gephyrin isoform X19 [Chlorocebus sabaeus]
 ref|XP_008850362.1| PREDICTED: gephyrin isoform X1 [Nannospalax galili]
 ref|XP_008976027.1| PREDICTED: gephyrin isoform X6 [Pan paniscus]
 ref|XP_009426253.1| PREDICTED: gephyrin isoform X17 [Pan troglodytes]
 ref|XP_010643625.1| PREDICTED: gephyrin isoform X3 [Fukomys damarensis]
Length=769

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010807867.1| PREDICTED: gephyrin isoform X9 [Bos taurus]
Length=760

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004584525.1| PREDICTED: gephyrin isoform X3 [Ochotona princeps]
Length=769

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004477404.1| PREDICTED: gephyrin [Dasypus novemcinctus]
Length=741

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395697.1| PREDICTED: gephyrin isoform X4 [Poecilia reticulata]
Length=861

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005561586.1| PREDICTED: gephyrin isoform X13 [Macaca fascicularis]
 ref|XP_007985205.1| PREDICTED: gephyrin isoform X17 [Chlorocebus sabaeus]
Length=771

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006113471.1| PREDICTED: gephyrin isoform X2 [Pelodiscus sinensis]
Length=736

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008976026.1| PREDICTED: gephyrin isoform X4 [Pan paniscus]
 ref|XP_010333475.1| PREDICTED: gephyrin isoform X6 [Saimiri boliviensis boliviensis]
Length=776

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_766540.2| gephyrin isoform 2 [Mus musculus]
 sp|Q8BUV3.2|GEPH_MOUSE RecName: Full=Gephyrin; Includes: RecName: Full=Molybdopterin 
adenylyltransferase; Short=MPT adenylyltransferase; AltName: 
Full=Domain G; Includes: RecName: Full=Molybdopterin molybdenumtransferase; 
Short=MPT Mo-transferase; AltName: Full=Domain 
E [Mus musculus]
Length=769

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>dbj|BAC38476.1| unnamed protein product [Mus musculus]
Length=769

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005343305.1| PREDICTED: gephyrin isoform X5 [Microtus ochrogaster]
 ref|XP_006973192.1| PREDICTED: gephyrin isoform X3 [Peromyscus maniculatus bairdii]
Length=750

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395696.1| PREDICTED: gephyrin isoform X3 [Poecilia reticulata]
Length=862

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005230781.1| PREDICTED: gephyrin isoform X1 [Falco peregrinus]
Length=772

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006734710.1| PREDICTED: gephyrin [Leptonychotes weddellii]
Length=750

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395698.1| PREDICTED: gephyrin isoform X5 [Poecilia reticulata]
Length=853

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+ W
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005306753.1| PREDICTED: gephyrin isoform X6 [Chrysemys picta bellii]
 ref|XP_006266488.1| PREDICTED: gephyrin isoform X1 [Alligator mississippiensis]
Length=772

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_002754063.1| PREDICTED: gephyrin isoform X9 [Callithrix jacchus]
Length=769

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_001369816.1| PREDICTED: gephyrin isoform X1 [Monodelphis domestica]
Length=772

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>dbj|BAG37944.1| unnamed protein product [Homo sapiens]
Length=769

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007184373.1| PREDICTED: gephyrin isoform X5 [Balaenoptera acutorostrata scammoni]
 ref|XP_007473124.1| PREDICTED: gephyrin isoform X6 [Monodelphis domestica]
Length=779

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005961617.1| PREDICTED: gephyrin isoform X2 [Pantholops hodgsonii]
Length=772

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_003435079.1| PREDICTED: gephyrin isoformX1 [Canis lupus familiaris]
 ref|XP_006915196.1| PREDICTED: gephyrin [Pteropus alecto]
 ref|XP_011382497.1| PREDICTED: gephyrin isoform X2 [Pteropus vampyrus]
Length=772

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005004834.1| PREDICTED: LOW QUALITY PROTEIN: gephyrin [Cavia porcellus]
Length=784

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005306752.1| PREDICTED: gephyrin isoform X5 [Chrysemys picta bellii]
Length=796

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007940487.1| PREDICTED: gephyrin isoform X2 [Orycteropus afer afer]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007184374.1| PREDICTED: gephyrin isoform X6 [Balaenoptera acutorostrata scammoni]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005149322.1| PREDICTED: gephyrin isoform X1 [Melopsittacus undulatus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_003586638.1| PREDICTED: gephyrin isoform X8 [Bos taurus]
 ref|XP_004010775.1| PREDICTED: gephyrin isoform 1 [Ovis aries]
 ref|XP_004262186.1| PREDICTED: gephyrin isoform 1 [Orcinus orca]
 ref|XP_010845042.1| PREDICTED: gephyrin isoform X2 [Bison bison bison]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_001230231.1| gephyrin [Sus scrofa]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKEGSQECFQFILPALPHAIDLLR  170



>ref|XP_004426312.1| PREDICTED: gephyrin isoform 1 [Ceratotherium simum simum]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_065857.1| gephyrin isoform 1 [Homo sapiens]
 ref|XP_001135711.1| PREDICTED: gephyrin isoform X16 [Pan troglodytes]
 ref|XP_003263634.1| PREDICTED: gephyrin isoform 1 [Nomascus leucogenys]
 ref|XP_003824106.1| PREDICTED: gephyrin isoform X5 [Pan paniscus]
 ref|XP_003924492.1| PREDICTED: gephyrin isoform X7 [Saimiri boliviensis boliviensis]
 ref|XP_007985206.1| PREDICTED: gephyrin isoform X18 [Chlorocebus sabaeus]
 emb|CAC10537.1| gephyrin [Homo sapiens]
 gb|AAH30016.1| Gephyrin [Homo sapiens]
 gb|EAW80926.1| gephyrin, isoform CRA_d [Homo sapiens]
 gb|ABM83389.1| gephyrin [synthetic construct]
 gb|ABM86601.1| gephyrin [synthetic construct]
Length=769

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_011281583.1| PREDICTED: gephyrin isoform X4 [Felis catus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004837433.1| PREDICTED: gephyrin isoform X2 [Heterocephalus glaber]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>dbj|BAI68421.1| gephyrin1 [Danio rerio]
Length=735

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++IL+ W
Sbjct  16   RVGILTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGIISAYKIVPDEIDEIKEILVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005877967.1| PREDICTED: gephyrin isoform X3 [Myotis brandtii]
 ref|XP_006091047.1| PREDICTED: gephyrin isoform X7 [Myotis lucifugus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_011382489.1| PREDICTED: gephyrin isoform X1 [Pteropus vampyrus]
Length=777

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007985215.1| PREDICTED: gephyrin isoform X26 [Chlorocebus sabaeus]
Length=783

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008137159.1| PREDICTED: gephyrin isoform X2 [Eptesicus fuscus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005399155.1| PREDICTED: gephyrin-like isoform X6 [Chinchilla lanigera]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004739021.1| PREDICTED: gephyrin isoform X5 [Mustela putorius furo]
 ref|XP_004797267.1| PREDICTED: gephyrin isoform X4 [Mustela putorius furo]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004681826.1| PREDICTED: gephyrin isoform X2 [Condylura cristata]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_666077.2| gephyrin isoform 1 [Mus musculus]
 gb|AAI27059.1| Gphn protein [Mus musculus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005561587.1| PREDICTED: gephyrin isoform X14 [Macaca fascicularis]
 gb|EHH27971.1| hypothetical protein EGK_18299 [Macaca mulatta]
Length=769

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006973191.1| PREDICTED: gephyrin isoform X2 [Peromyscus maniculatus bairdii]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006515967.1| PREDICTED: gephyrin isoform X6 [Mus musculus]
Length=790

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004837432.1| PREDICTED: gephyrin isoform X1 [Heterocephalus glaber]
Length=791

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008850363.1| PREDICTED: gephyrin isoform X2 [Nannospalax galili]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005561591.1| PREDICTED: gephyrin isoform X18 [Macaca fascicularis]
Length=783

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005343303.1| PREDICTED: gephyrin isoform X3 [Microtus ochrogaster]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004612402.1| PREDICTED: gephyrin isoform X2 [Sorex araneus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>dbj|BAA92623.1| KIAA1385 protein [Homo sapiens]
Length=768

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  48   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  105

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  106  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  165

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  166  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  202



>ref|XP_005520407.1| PREDICTED: gephyrin isoform X1 [Pseudopodoces humilis]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004397629.1| PREDICTED: gephyrin isoform 2 [Odobenus rosmarus divergens]
 ref|XP_007525882.1| PREDICTED: gephyrin isoform X2 [Erinaceus europaeus]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_009004415.1| PREDICTED: gephyrin isoform X3 [Callithrix jacchus]
Length=812

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005306750.1| PREDICTED: gephyrin isoform X2 [Chrysemys picta bellii]
Length=817

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007449084.1| PREDICTED: gephyrin isoform X3 [Lipotes vexillifer]
Length=736

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLVDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010643623.1| PREDICTED: gephyrin isoform X1 [Fukomys damarensis]
Length=772

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  740  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRW  561
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+ W
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  560  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  381
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  380  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  270
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630