BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016B19

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          295   8e-94   Nicotiana tomentosiformis
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    294   2e-93   Solanum tuberosum [potatoes]
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    293   2e-93   Solanum tuberosum [potatoes]
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          293   4e-93   Nicotiana sylvestris
ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          290   1e-91   Solanum lycopersicum
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              277   7e-87   Sesamum indicum [beniseed]
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                276   8e-87   Erythranthe guttata [common monkey flower]
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   276   3e-86   Sesamum indicum [beniseed]
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    271   2e-85   
emb|CAN80825.1|  hypothetical protein VITISV_015452                     271   1e-84   Vitis vinifera
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                270   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    263   5e-82   Nicotiana sylvestris
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    262   2e-81   Nicotiana sylvestris
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          260   1e-80   Nicotiana tomentosiformis
emb|CDP02616.1|  unnamed protein product                                260   3e-80   Coffea canephora [robusta coffee]
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          259   6e-80   Nelumbo nucifera [Indian lotus]
gb|ACE60602.1|  putative galactomannan galactosyl transferase           258   1e-79   Coffea arabica [arabica coffee]
gb|EPS69883.1|  hypothetical protein M569_04879                         254   3e-78   Genlisea aurea
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    249   2e-76   Cucumis sativus [cucumbers]
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              247   2e-75   Morus notabilis
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    248   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    245   2e-74   Cucumis melo [Oriental melon]
gb|ADL36661.1|  CAMTA domain class transcription factor                 243   8e-74   Malus domestica [apple tree]
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             243   8e-74   Prunus persica
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    244   2e-73   Pyrus x bretschneideri [bai li]
gb|ADL36663.1|  CAMTA domain class transcription factor                 241   3e-73   Malus domestica [apple tree]
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    241   6e-73   
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    241   8e-73   Prunus mume [ume]
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    242   8e-73   
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    240   1e-72   Fragaria vesca subsp. vesca
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            239   4e-72   Gossypium arboreum [tree cotton]
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    238   6e-72   Glycine max [soybeans]
gb|KJB18050.1|  hypothetical protein B456_003G031400                    238   6e-72   Gossypium raimondii
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            238   1e-71   Gossypium arboreum [tree cotton]
gb|KJB46680.1|  hypothetical protein B456_008G0841002                   236   1e-71   Gossypium raimondii
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     236   2e-71   Solanum tuberosum [potatoes]
gb|KJB46678.1|  hypothetical protein B456_008G0841002                   236   4e-71   Gossypium raimondii
emb|CDP02619.1|  unnamed protein product                                236   8e-71   Coffea canephora [robusta coffee]
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             235   1e-70   Phaseolus vulgaris [French bean]
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    235   2e-70   
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             233   6e-70   Citrus clementina [clementine]
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              233   6e-70   
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     233   8e-70   Citrus sinensis [apfelsine]
ref|XP_003611556.1|  Galactomannan galactosyltransferase                231   2e-69   Medicago truncatula
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    230   9e-69   Glycine max [soybeans]
emb|CAI79403.1|  galactomannan galactosyltransferase                    229   2e-68   Senna occidentalis [antbush]
gb|KJB43940.1|  hypothetical protein B456_007G224800                    228   5e-68   Gossypium raimondii
gb|KDP32091.1|  hypothetical protein JCGZ_12552                         228   6e-68   Jatropha curcas
ref|XP_002310890.2|  alpha galactosyltransferase family protein         227   2e-67   
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   225   4e-67   Citrus sinensis [apfelsine]
ref|XP_006857127.1|  hypothetical protein AMTR_s00065p00144450          226   5e-67   Amborella trichopoda
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    226   5e-67   
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          225   8e-67   Populus euphratica
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          225   9e-67   Populus euphratica
ref|XP_002320005.2|  alpha galactosyltransferase family protein         225   9e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    224   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002525290.1|  transferase, putative                              223   3e-66   Ricinus communis
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              223   3e-66   Sesamum indicum [beniseed]
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   221   8e-66   Glycine soja [wild soybean]
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          219   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              218   2e-64   Morus notabilis
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              218   3e-64   Solanum lycopersicum
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             218   3e-64   Eutrema salsugineum [saltwater cress]
emb|CAI11452.1|  alpha-6-galactosyltransferase                          218   4e-64   Solanum tuberosum [potatoes]
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     217   1e-63   
emb|CDY49440.1|  BnaA09g42270D                                          216   1e-63   Brassica napus [oilseed rape]
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          216   1e-63   Brassica rapa
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    216   2e-63   
emb|CDX76887.1|  BnaC08g34730D                                          216   2e-63   
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          216   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              215   5e-63   Nicotiana tomentosiformis
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          215   8e-63   Camelina sativa [gold-of-pleasure]
ref|NP_565544.1|  putative glycosyltransferase 7                        214   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          214   9e-63   Camelina sativa [gold-of-pleasure]
emb|CDP02617.1|  unnamed protein product                                214   1e-62   Coffea canephora [robusta coffee]
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             214   1e-62   Capsella rubella
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      213   3e-62   Zea mays [maize]
gb|ACH58908.1|  galactosyl transferase                                  211   1e-61   Coffea canephora [robusta coffee]
emb|CAI11453.1|  alpha-6-galactosyltransferase                          211   2e-61   Nicotiana benthamiana
gb|KHN20359.1|  Galactomannan galactosyltransferase 1                   205   3e-61   Glycine soja [wild soybean]
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              209   1e-60   Nicotiana sylvestris
emb|CAD98924.1|  galactomannan galactosyltransferase                    207   3e-60   Lotus japonicus
ref|XP_002513422.1|  transferase, putative                              207   3e-60   
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              207   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   207   5e-60   Camelina sativa [gold-of-pleasure]
gb|KDP25125.1|  hypothetical protein JCGZ_22660                         206   7e-60   Jatropha curcas
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    206   2e-59   Phoenix dactylifera
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    204   4e-59   Glycine max [soybeans]
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             204   4e-59   
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          204   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          204   8e-59   Eucalyptus grandis [rose gum]
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    204   9e-59   Fragaria vesca subsp. vesca
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    203   1e-58   Camelina sativa [gold-of-pleasure]
ref|NP_680773.1|  glycosyltransferase 6                                 202   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              203   2e-58   
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    203   3e-58   Elaeis guineensis
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          202   3e-58   
emb|CAI11454.1|  alpha-6-galactosyltransferase                          202   5e-58   Medicago truncatula
ref|NP_001281283.1|  putative glycosyltransferase 7                     202   6e-58   Malus domestica [apple tree]
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          201   7e-58   Prunus mume [ume]
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      202   8e-58   
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             200   1e-57   
emb|CDY29577.1|  BnaA03g54220D                                          200   2e-57   Brassica napus [oilseed rape]
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   200   2e-57   Brassica rapa
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              200   2e-57   
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    200   3e-57   Arabis alpina [alpine rockcress]
gb|EAY87343.1|  hypothetical protein OsI_08746                          197   1e-56   Oryza sativa Indica Group [Indian rice]
emb|CDX72649.1|  BnaC07g46710D                                          198   1e-56   
emb|CAB52246.1|  alpha galactosyltransferase                            197   2e-56   Trigonella foenum-graecum [fenugreek]
ref|NP_001047970.1|  Os02g0723200                                       197   2e-56   
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    197   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    196   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          196   7e-56   Sorghum bicolor [broomcorn]
ref|NP_001068066.1|  Os11g0546500                                       197   7e-56   
gb|EAY81250.1|  hypothetical protein OsI_36429                          196   1e-55   Oryza sativa Indica Group [Indian rice]
gb|ACF33173.1|  putative galactomannan galactosyl transferase           196   1e-55   Coffea canephora [robusta coffee]
emb|CDP02618.1|  unnamed protein product                                194   4e-55   Coffea canephora [robusta coffee]
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like     191   4e-55   Oryza brachyantha
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              192   1e-54   Pyrus x bretschneideri [bai li]
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    192   2e-54   Cyamopsis tetragonoloba [cluster bean]
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          192   2e-54   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK05879.1|  predicted protein                                      185   7e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             180   2e-50   
tpg|DAA64594.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    174   2e-50   Pinus taeda
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              181   3e-50   Prunus mume [ume]
ref|XP_003608540.1|  Galactomannan galactosyltransferase                180   8e-50   Medicago truncatula
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    179   1e-49   Setaria italica
gb|AFW64907.1|  glycosyltransferase 6                                   180   2e-49   
ref|NP_001152534.1|  glycosyltransferase 6                              178   7e-49   
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910          178   7e-49   Sorghum bicolor [broomcorn]
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    176   8e-49   
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    177   8e-49   Brachypodium distachyon [annual false brome]
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...    176   4e-48   
gb|ADE76992.1|  unknown                                                 174   2e-47   Picea sitchensis
gb|EMS46901.1|  Galactomannan galactosyltransferase 1                   169   8e-47   Triticum urartu
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...    172   1e-46   Zea mays [maize]
ref|XP_004980585.1|  PREDICTED: galactomannan galactosyltransfera...    166   1e-45   Setaria italica
gb|ABK25085.1|  unknown                                                 169   1e-45   Picea sitchensis
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    167   2e-45   Pinus radiata
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    165   5e-45   Pinus taeda
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              169   5e-45   
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...    167   5e-45   Zea mays [maize]
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...    167   7e-45   Setaria italica
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...    164   2e-44   Setaria italica
dbj|BAJ96459.1|  predicted protein                                      165   6e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    162   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT11268.1|  Putative glycosyltransferase 7                          156   2e-42   
ref|XP_002450906.1|  hypothetical protein SORBIDRAFT_05g020930          158   1e-41   
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          154   3e-40   Phoenix dactylifera
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    155   4e-40   Elaeis guineensis
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...    153   9e-40   Setaria italica
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...    142   7e-36   Elaeis guineensis
emb|CBI25835.3|  unnamed protein product                                127   2e-31   Vitis vinifera
dbj|BAK06777.1|  predicted protein                                      102   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                         102   4e-25   
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5          112   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY89653.1|  hypothetical protein OsI_11184                          100   4e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like     100   4e-25   Oryza brachyantha
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed              100   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58373.1|  Putative glycosyltransferase 2                          101   5e-25   Triticum urartu
ref|NP_001049853.1|  Os03g0300000                                       100   5e-25   
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    111   6e-25   Setaria italica
ref|XP_001761988.1|  predicted protein                                  110   1e-24   
ref|XP_001759108.1|  predicted protein                                98.2    2e-24   
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2        98.2    4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5          109   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5          108   1e-23   Elaeis guineensis
ref|XP_001765298.1|  predicted protein                                  107   1e-23   
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5          108   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001781241.1|  predicted protein                                  102   2e-23   
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540          101   2e-23   Sorghum bicolor [broomcorn]
ref|NP_001049886.1|  Os03g0305800                                       108   2e-23   
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5          107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg             107   3e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5          107   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5          107   4e-23   Elaeis guineensis
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5          106   4e-23   Sesamum indicum [beniseed]
ref|NP_001047014.1|  Os02g0529600                                       107   4e-23   
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    106   5e-23   
gb|ACN27080.1|  unknown                                                 103   7e-23   Zea mays [maize]
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like     106   7e-23   Setaria italica
ref|XP_008453679.1|  PREDICTED: putative glycosyltransferase 3          102   8e-23   Cucumis melo [Oriental melon]
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like   94.0    8e-23   Setaria italica
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5          105   9e-23   Phoenix dactylifera
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...    105   1e-22   
gb|EMT32015.1|  Xyloglucan 6-xylosyltransferase                         101   1e-22   
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...    105   1e-22   
ref|XP_008453680.1|  PREDICTED: putative glycosyltransferase 3          102   1e-22   Cucumis melo [Oriental melon]
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                         104   2e-22   Glycine soja [wild soybean]
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5          105   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350          104   2e-22   
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5          105   2e-22   Eucalyptus grandis [rose gum]
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                    104   2e-22   Arabis alpina [alpine rockcress]
gb|KHN48702.1|  Putative glycosyltransferase 3                          102   2e-22   Glycine soja [wild soybean]
emb|CDX85826.1|  BnaC06g23080D                                          102   2e-22   
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...  97.4    2e-22   
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                    104   2e-22   Morus notabilis
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...    104   2e-22   
ref|XP_010497538.1|  PREDICTED: putative glycosyltransferase 5          100   3e-22   
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5          104   3e-22   Elaeis guineensis
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like   92.4    3e-22   Setaria italica
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                    103   3e-22   
gb|KEH31956.1|  xyloglucan xylosyltransferase                           104   3e-22   Medicago truncatula
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4          104   3e-22   
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...    103   3e-22   Selaginella moellendorffii
ref|XP_001767288.1|  predicted protein                                97.1    3e-22   
dbj|BAK00169.1|  predicted protein                                      103   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like     104   3e-22   Oryza brachyantha
ref|XP_010040898.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       100   3e-22   Eucalyptus grandis [rose gum]
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Populus euphratica
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570          104   3e-22   Sorghum bicolor [broomcorn]
gb|AFW71661.1|  putative glycosyltransferase                            104   4e-22   
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like     103   4e-22   Glycine max [soybeans]
gb|KJB28609.1|  hypothetical protein B456_005G060400                    103   4e-22   Gossypium raimondii
ref|NP_001105849.1|  putative glycosyltransferase                       104   4e-22   
gb|KCW44805.1|  hypothetical protein EUGRSUZ_L01630                     100   4e-22   Eucalyptus grandis [rose gum]
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4          104   4e-22   
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog              102   4e-22   Nicotiana alata [flowering tobacco]
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5          103   4e-22   Nicotiana sylvestris
emb|CDX96540.1|  BnaA07g31510D                                          101   4e-22   
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg             103   4e-22   Citrus clementina [clementine]
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    103   4e-22   
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like     103   4e-22   Citrus sinensis [apfelsine]
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5          103   5e-22   Prunus mume [ume]
gb|KJB50959.1|  hypothetical protein B456_008G195000                    103   5e-22   Gossypium raimondii
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative          103   5e-22   Ricinus communis
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg             103   5e-22   Prunus persica
gb|EMT32465.1|  Putative glycosyltransferase 3                          103   5e-22   
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like     103   5e-22   Cicer arietinum [garbanzo]
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5          103   5e-22   Pyrus x bretschneideri [bai li]
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5          103   6e-22   Malus domestica [apple tree]
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g             103   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5          103   6e-22   Pyrus x bretschneideri [bai li]
dbj|BAK03947.1|  predicted protein                                      103   7e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530          103   7e-22   Sorghum bicolor [broomcorn]
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like     103   8e-22   Cicer arietinum [garbanzo]
gb|AFK30382.1|  galactosyltransferase A                                 103   8e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    102   8e-22   
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g             103   8e-22   Phaseolus vulgaris [French bean]
gb|KDP27794.1|  hypothetical protein JCGZ_18874                         103   8e-22   Jatropha curcas
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5          103   8e-22   Tarenaya hassleriana [spider flower]
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3        90.5    9e-22   Zea mays [maize]
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg                102   9e-22   Erythranthe guttata [common monkey flower]
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3        90.5    9e-22   Zea mays [maize]
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like     100   1e-21   Solanum tuberosum [potatoes]
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_001767750.1|  predicted protein                                  102   1e-21   
gb|EAY82266.1|  hypothetical protein OsI_37474                          102   1e-21   Oryza sativa Indica Group [Indian rice]
emb|CDY26738.1|  BnaA06g12840D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     99.8    1e-21   Solanum lycopersicum
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like     102   1e-21   Glycine max [soybeans]
gb|KEH24376.1|  xyloglucan xylosyltransferase                           102   1e-21   Medicago truncatula
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg             102   1e-21   Capsella rubella
gb|KDP31286.1|  hypothetical protein JCGZ_11662                         102   1e-21   Jatropha curcas
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g             102   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5          102   1e-21   
ref|XP_001771886.1|  predicted protein                                93.6    1e-21   
ref|XP_007035584.1|  CAMTA domain class transcription factor            102   1e-21   
gb|KJB19373.1|  hypothetical protein B456_003G098400                    102   1e-21   Gossypium raimondii
gb|KHN18571.1|  Putative glycosyltransferase 3                          100   1e-21   Glycine soja [wild soybean]
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       102   2e-21   Nicotiana tomentosiformis
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    102   2e-21   Nicotiana sylvestris
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like     102   2e-21   Cicer arietinum [garbanzo]
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1             102   2e-21   
ref|NP_173304.2|  putative glycosyltransferase 4                        102   2e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43079.1|  hypothetical protein                                   102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2             102   2e-21   
ref|NP_001066160.1|  Os12g0149300                                       102   2e-21   
ref|XP_010108713.1|  Putative glycosyltransferase 3                     102   2e-21   Morus notabilis
ref|XP_004154960.1|  PREDICTED: putative glycosyltransferase 5-like     102   2e-21   
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1       102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5-like     102   2e-21   Cucumis sativus [cucumbers]
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                       102   2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93965.1|  BnaC04g21240D                                          102   2e-21   
emb|CBX24469.1|  hypothetical_protein                                   101   2e-21   Oryza glaberrima
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 3-like     102   2e-21   Cucumis sativus [cucumbers]
gb|ACF82576.1|  unknown                                                 100   2e-21   Zea mays [maize]
ref|XP_004154959.1|  PREDICTED: putative glycosyltransferase 3-like     102   2e-21   
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847             102   2e-21   Arabidopsis lyrata subsp. lyrata
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                   101   2e-21   
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       102   2e-21   
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                       101   2e-21   
gb|EPS66800.1|  hypothetical protein M569_07974                         101   2e-21   
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g             101   3e-21   
dbj|BAK06850.1|  predicted protein                                      101   3e-21   
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2          101   3e-21   
ref|XP_006841140.1|  hypothetical protein AMTR_s00086p00128700          101   3e-21   
gb|KHN20409.1|  Putative glycosyltransferase 2                        98.2    3e-21   
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    101   3e-21   
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative          101   3e-21   
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                           101   3e-21   
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...    101   3e-21   
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3          101   3e-21   
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4          102   3e-21   
emb|CDY70418.1|  BnaA04g27220D                                          101   3e-21   
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg                102   3e-21   
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       101   3e-21   
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5          101   3e-21   
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg             101   4e-21   
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like     101   4e-21   
gb|KJB22531.1|  hypothetical protein B456_004G052700                    101   4e-21   
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein            101   4e-21   
emb|CDO98874.1|  unnamed protein product                                101   4e-21   
gb|AFK30383.1|  galactosyltransferase B1                                101   4e-21   
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5          101   4e-21   
gb|KJB84424.1|  hypothetical protein B456_N024600                       101   4e-21   
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2          100   4e-21   
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    101   4e-21   
gb|ACE95677.1|  putative xylosyl transferase                            101   4e-21   
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like     100   4e-21   
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5          100   5e-21   
emb|CAN80739.1|  hypothetical protein VITISV_027037                     100   5e-21   
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...    100   5e-21   
emb|CBX25402.1|  hypothetical_protein                                   100   5e-21   
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...    100   5e-21   
emb|CDP21247.1|  unnamed protein product                                100   5e-21   
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like     100   5e-21   
emb|CAI11456.1|  putative glycosyltransferase                           100   5e-21   
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg             100   5e-21   
gb|ADE59448.1|  galactosyltransferase                                   101   5e-21   
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                    100   5e-21   
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like     100   5e-21   
gb|EAY89696.1|  hypothetical protein OsI_11232                          100   6e-21   
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase        100   6e-21   
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                       100   6e-21   
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   6e-21   
ref|NP_001173389.1|  Os03g0306100                                       100   6e-21   
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...    100   6e-21   
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg             100   6e-21   
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...    100   6e-21   
gb|ABF95527.1|  Glycosyltransferase 3, putative                         100   6e-21   
gb|KEH33442.1|  xyloglucan xylosyltransferase                           100   6e-21   
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg             100   6e-21   
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                    103   6e-21   
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   6e-21   
emb|CDX69995.1|  BnaA10g23440D                                          100   6e-21   
ref|XP_002315554.2|  glycosyltransferase 2 family protein               100   6e-21   
ref|NP_001150077.1|  glycosyltransferase 5                              100   6e-21   
ref|XP_006389383.1|  glycosyltransferase 2 family protein               100   6e-21   
gb|ACN29046.1|  unknown                                                 100   7e-21   
gb|AFW88652.1|  glycosyltransferase 5                                   100   7e-21   
emb|CDX99024.1|  BnaC09g48110D                                          100   7e-21   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   7e-21   
ref|NP_001151451.1|  glycosyltransferase 5                              100   7e-21   
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3          100   7e-21   
dbj|BAK08324.1|  predicted protein                                      100   7e-21   
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2          100   8e-21   
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5          100   8e-21   
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000          100   8e-21   
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg             100   8e-21   
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3          100   8e-21   
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg             100   8e-21   
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...    100   8e-21   
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5          100   8e-21   
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3          100   8e-21   
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                       102   9e-21   
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase         100   9e-21   
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    100   9e-21   
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg             100   1e-20   
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5          100   1e-20   
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817             101   1e-20   
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       100   1e-20   
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    100   1e-20   
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg             100   1e-20   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   1e-20   
ref|NP_567241.1|  UDP-xylosyltransferase 2                              100   1e-20   
gb|AAC78266.1|  putative glycosyltransferase                            100   1e-20   
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       100   1e-20   
ref|XP_008663454.1|  PREDICTED: putative glycosyltransferase 2        98.2    1e-20   
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  99.8    1e-20   
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   1e-20   
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg              99.8    1e-20   
gb|KHN14624.1|  Putative glycosyltransferase 2                        98.6    1e-20   
gb|KHN26556.1|  Putative glycosyltransferase 2                        98.6    1e-20   
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5        99.4    2e-20   
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3        99.4    2e-20   
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3        99.4    2e-20   
ref|XP_001772519.1|  predicted protein                                99.0    2e-20   
emb|CBI26079.3|  unnamed protein product                              99.0    2e-20   
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg           99.0    2e-20   
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3        99.0    2e-20   
gb|AFW59084.1|  hypothetical protein ZEAMMB73_119802                    100   2e-20   
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3        99.8    2e-20   
gb|EMT25995.1|  hypothetical protein F775_42861                       97.1    2e-20   
ref|XP_001755467.1|  predicted protein                                98.6    3e-20   
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...  99.0    3e-20   
emb|CDY19235.1|  BnaC05g14360D                                        99.0    3e-20   
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  98.2    3e-20   
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg              99.0    3e-20   
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5        98.6    3e-20   
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  98.6    3e-20   
gb|EMT05890.1|  Putative glycosyltransferase 3                          100   3e-20   
gb|EPS71488.1|  hypothetical protein M569_03267                       98.6    3e-20   
ref|XP_006651308.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  97.8    3e-20   
emb|CAN77730.1|  hypothetical protein VITISV_027412                   98.2    4e-20   
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     98.2    4e-20   
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                     98.2    5e-20   
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg           97.8    5e-20   
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                    100   5e-20   
gb|ACF06190.1|  xylosyl transferase                                   94.0    5e-20   
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316           98.2    5e-20   
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5        98.2    6e-20   
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  97.8    7e-20   
ref|XP_010089891.1|  Putative glycosyltransferase 5                   97.8    7e-20   
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5        97.4    7e-20   
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2        97.4    8e-20   
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110        97.4    8e-20   
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like   97.4    8e-20   
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5        97.8    8e-20   
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...  97.4    8e-20   
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  97.4    9e-20   
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2        97.1    1e-19   
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...  97.4    1e-19   
ref|XP_001777149.1|  predicted protein                                97.1    1e-19   
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     97.1    1e-19   
emb|CDX90935.1|  BnaA03g26150D                                        97.1    1e-19   
emb|CDY50378.1|  BnaCnng19100D                                        97.4    1e-19   
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2        97.1    1e-19   
gb|ABK24302.1|  unknown                                               97.1    1e-19   
gb|AFU82535.1|  alpha-1,6-xylosyltransferase                          94.7    1e-19   
emb|CDY18017.1|  BnaC03g30890D                                        95.9    1e-19   
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g           97.1    1e-19   
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like   97.1    1e-19   
ref|XP_001776727.1|  predicted protein                                97.1    1e-19   
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3        96.7    1e-19   
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                         97.1    1e-19   
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5        96.7    1e-19   
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2        96.7    1e-19   
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  96.7    2e-19   
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg           96.7    2e-19   
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090        96.7    2e-19   
gb|KJB41948.1|  hypothetical protein B456_007G128800                  96.7    2e-19   
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2        96.7    2e-19   
gb|ABC87290.1|  putative galactosyl transferase                       92.8    2e-19   
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                         95.9    2e-19   
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg              96.7    2e-19   
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                         96.3    2e-19   
emb|CAI11458.1|  putative glycosyltransferase                         96.3    2e-19   
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5        96.3    2e-19   
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                  96.3    2e-19   
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5        96.3    2e-19   
ref|XP_004290777.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     95.9    3e-19   
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2        96.3    3e-19   
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2        95.9    3e-19   
emb|CDY22055.1|  BnaA09g00840D                                        95.9    3e-19   
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  95.9    3e-19   
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2        95.9    3e-19   
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2        95.9    4e-19   
emb|CAI11457.1|  putative glycosyltransferase                         95.5    6e-19   
ref|XP_002314448.2|  glycosyltransferase 2 family protein             94.7    6e-19   
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  94.7    6e-19   
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase       94.4    7e-19   
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like   95.1    9e-19   
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...  94.4    1e-18   
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg           94.7    1e-18   
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like   94.4    1e-18   
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like   94.7    1e-18   
ref|NP_001288054.1|  calmodulin binding transcription activator 1     94.4    1e-18   
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...  94.7    1e-18   
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                  93.2    1e-18   
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...  94.4    1e-18   
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080        94.7    1e-18   
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  92.8    2e-18   
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2        93.2    3e-18   
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  92.8    3e-18   
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2        93.2    3e-18   
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2        93.2    3e-18   
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  92.8    4e-18   
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  92.4    4e-18   
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein       92.0    5e-18   
ref|XP_001756042.1|  predicted protein                                80.9    9e-18   
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein       90.9    1e-17   
gb|EPS64541.1|  hypothetical protein M569_10236                       89.7    2e-17   
ref|XP_001773763.1|  predicted protein                                77.8    5e-17   
emb|CDX76657.1|  BnaC08g32430D                                        86.3    6e-17   
ref|XP_001769838.1|  predicted protein                                88.6    6e-17   
ref|XP_002987473.1|  glycosyltransferase-like protein                 87.4    8e-17   
ref|XP_002980077.1|  glycosyltransferase-like protein                 86.3    2e-16   
ref|XP_001755245.1|  predicted protein                                79.3    5e-16   
gb|KEH19400.1|  xyloglucan xylosyltransferase                         84.0    5e-15   
ref|XP_001764909.1|  predicted protein                                81.6    3e-14   
ref|XP_001775066.1|  predicted protein                                81.3    3e-14   
ref|XP_001755939.1|  predicted protein                                80.9    5e-14   
ref|XP_001768129.1|  predicted protein                                79.0    2e-13   
gb|AEW08173.1|  hypothetical protein 2_1874_01                        73.9    4e-13   
gb|EMS48021.1|  Putative glycosyltransferase 3                        77.0    6e-13   
emb|CBI15187.3|  unnamed protein product                              71.2    3e-11   
ref|XP_002978152.1|  glycosyltransferase CAZy family GT34-like pr...  67.8    4e-11   
ref|XP_002966412.1|  glycosyltransferase CAZy family GT34-like pr...  67.8    6e-11   
emb|CAJ91142.1|  glycosyltransferase                                  64.3    5e-10   
gb|KEH31957.1|  galactosyl transferase GMA12/MNN10 family protein     61.2    7e-09   
ref|XP_008352151.1|  PREDICTED: putative uncharacterized protein ...  63.9    2e-08   
gb|AIA92435.1|  Glyco_transf_34                                       58.5    1e-07   
emb|CBI36830.3|  unnamed protein product                              60.5    3e-07   
emb|CDY65940.1|  BnaUnng01300D                                        58.5    8e-07   
emb|CDX97271.1|  BnaA02g20620D                                        58.5    1e-06   
gb|AEW08650.1|  hypothetical protein CL1035Contig1_03                 54.7    1e-06   
ref|XP_006840585.1|  hypothetical protein AMTR_s00045p00232030        56.2    1e-06   
ref|XP_009609259.1|  PREDICTED: putative glycosyltransferase 3        57.0    1e-06   



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 154/187 (82%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P YD WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWG+KIYVE  YYF
Sbjct  271  AWAKMGPQSPEYDKWGEILRSTFKDKIFQESDDQSGLAYLLLKEKEKWGDKIYVEGQYYF  330

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYWVEIVG LDNITD YLGIEK      LRRRH EKVSESY + W+EHL++AG GR  W
Sbjct  331  EGYWVEIVGTLDNITDKYLGIEKVVPS--LRRRHGEKVSESYGKVWEEHLKDAGYGRYSW  388

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV 
Sbjct  389  RRPFITHFTGCQPCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVF  448

Query  178  PLPYDFP  158
            P+P+DFP
Sbjct  449  PVPFDFP  455



>ref|XP_006363812.1| PREDICTED: putative glycosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=455

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 155/187 (83%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P YD WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYF
Sbjct  270  AWAKMGPQSPEYDKWGEILRTTFKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYF  329

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYWVEIVG  DNITD YL IEK+ A  +LRRRHAE+VSESYA  W+EHL+ AG GR  W
Sbjct  330  EGYWVEIVGTYDNITDRYLAIEKSEA--RLRRRHAERVSESYASVWEEHLKEAGYGRYSW  387

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV 
Sbjct  388  RRPFITHFTGCQPCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVF  447

Query  178  PLPYDFP  158
            P+P++FP
Sbjct  448  PVPFNFP  454



>ref|XP_006363813.1| PREDICTED: putative glycosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=423

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 155/187 (83%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P YD WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYF
Sbjct  238  AWAKMGPQSPEYDKWGEILRTTFKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYF  297

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYWVEIVG  DNITD YL IEK+ A  +LRRRHAE+VSESYA  W+EHL+ AG GR  W
Sbjct  298  EGYWVEIVGTYDNITDRYLAIEKSEA--RLRRRHAERVSESYASVWEEHLKEAGYGRYSW  355

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV 
Sbjct  356  RRPFITHFTGCQPCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVF  415

Query  178  PLPYDFP  158
            P+P++FP
Sbjct  416  PVPFNFP  422



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 151/178 (85%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG
Sbjct  280  PEYDKWGEILRSTFKDKIFQESDDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVG  339

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LDNITD YLGIEK      LRRRH EKVSESY + W+EHL++AG GR  WRRPFITHFT
Sbjct  340  TLDNITDKYLGIEKGVPS--LRRRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFT  397

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  398  GCQPCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_004231937.1| PREDICTED: putative glycosyltransferase 7 [Solanum lycopersicum]
Length=455

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 150/178 (84%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG  L  TFKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG
Sbjct  279  PEYDKWGEILHTTFKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVG  338

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNITD YL IEK+    +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFT
Sbjct  339  TYDNITDRYLAIEKSEG--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFT  396

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  397  GCQPCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>ref|XP_011099399.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=462

 Score =   277 bits (709),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG  L   FKDKIFPESDDQSGL+YLILKE+EKWGNKIYVE +YYFEGYW+EIVG
Sbjct  286  PDYEKWGEILSTMFKDKIFPESDDQSGLVYLILKEKEKWGNKIYVEGEYYFEGYWMEIVG  345

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNIT+ Y  IEK      LRRRHAEKVSESYA  W+E+L++AG GR  WRRPFITHFT
Sbjct  346  TFDNITERYTQIEKEVPA--LRRRHAEKVSESYARVWEEYLKDAGYGRGSWRRPFITHFT  403

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG+TC DAM KAL FADNQVLRNYGF+H DLLD ++V  LP+D+P
Sbjct  404  GCQPCSGDHNQMYSGQTCFDAMQKALIFADNQVLRNYGFVHPDLLDPSTVNLLPFDYP  461


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQWAMDFM+VWASMGPQ P     G+
Sbjct  266  RNCQWAMDFMEVWASMGPQSPDYEKWGE  293



>gb|EYU44510.1| hypothetical protein MIMGU_mgv1a018855mg [Erythranthe guttata]
Length=438

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -3

Query  721  TCGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYY  542
            T GP      P YD WG  L  TFKDKIFPESDDQSGL+YL+LKE+EKWGNKIYVES+YY
Sbjct  252  TMGP----QSPEYDKWGEILSATFKDKIFPESDDQSGLVYLLLKEKEKWGNKIYVESEYY  307

Query  541  FEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG  362
            FEGYW+EI+G  DNIT+ Y   EK AA   LRRRH EKVSE YA  W+++L+ AGQGR  
Sbjct  308  FEGYWMEIIGTFDNITERYTETEKPAAAAALRRRHGEKVSEGYATVWEDYLKEAGQGRGS  367

Query  361  WRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASV  182
            WRRPFITHFTGCQPCSG HN+MYSG+TC DAM +AL FADNQVLRNYGF+H D+ D  +V
Sbjct  368  WRRPFITHFTGCQPCSGAHNQMYSGQTCVDAMQRALTFADNQVLRNYGFVHPDIGDPTTV  427

Query  181  VPLPYDFP  158
             P+P+D+P
Sbjct  428  NPIPFDYP  435



>ref|XP_011073681.1| PREDICTED: glycosyltransferase 6 [Sesamum indicum]
Length=466

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG  LR TFKDKIFPESDDQSGL+YL+LKE+EKWG KIYVES+YYFEGYW+EIVG
Sbjct  290  PDYDKWGEILRTTFKDKIFPESDDQSGLVYLLLKEKEKWGEKIYVESEYYFEGYWMEIVG  349

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K DNIT  Y+ +EK      LRRRHAEKVS SY    +E+L++ G GR  WRRPFITHFT
Sbjct  350  KFDNITRKYMEMEKEVGA--LRRRHAEKVSGSYGRLREEYLKDVGYGRESWRRPFITHFT  407

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG+TC DAM KAL FADNQVLRNYGF+H DLLD ++V PLP+D+P
Sbjct  408  GCQPCSGDHNQMYSGQTCFDAMQKALTFADNQVLRNYGFVHPDLLDPSTVDPLPFDYP  465



>ref|XP_010646814.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
7 [Vitis vinifera]
Length=403

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG TL  TFKDK+FPESDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG
Sbjct  227  PDYDKWGKTLTSTFKDKMFPESDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVG  286

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LDNIT  YL IEK      LRRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFT
Sbjct  287  TLDNITSKYLEIEKGV--NTLRRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFT  344

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSG HN+MY+GE+C ++M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  345  GCQPCSGKHNQMYAGESCWNSMQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  402



>emb|CAN80825.1| hypothetical protein VITISV_015452 [Vitis vinifera]
Length=446

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG TL  TFKDK+FPESDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG
Sbjct  270  PDYDKWGKTLTSTFKDKMFPESDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVG  329

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LDNIT  YL IEK      LRRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFT
Sbjct  330  TLDNITSKYLEIEKGV--NTLRRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFT  387

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSG HN+MY+GE+C ++M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  388  GCQPCSGKHNQMYAGESCWNSMQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  445



>gb|EYU41378.1| hypothetical protein MIMGU_mgv1a006348mg [Erythranthe guttata]
Length=447

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG   + TFKDKIFPESDDQSGL+YL+LK+++KWG+KIY+ES YYFEGYW+EIVG
Sbjct  270  PEYDKWGEIQKSTFKDKIFPESDDQSGLVYLLLKDKDKWGDKIYLESGYYFEGYWMEIVG  329

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NIT+ Y  +E  AA  +LRRRHAEKVSE Y   W+EHL+ AG GR  WRRPFITHFT
Sbjct  330  NFENITERYKQVE--AAEGRLRRRHAEKVSEGYVPVWEEHLKEAGYGRGSWRRPFITHFT  387

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG+TC DAM KAL FADNQVLR+YG++H DLLD ++V+PLP+D+P
Sbjct  388  GCQPCSGDHNQMYSGQTCFDAMQKALIFADNQVLRSYGYVHPDLLDPSTVLPLPFDYP  445



>ref|XP_009777954.1| PREDICTED: putative glycosyltransferase 7 isoform X2 [Nicotiana 
sylvestris]
Length=412

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 153/191 (80%), Gaps = 10/191 (5%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P    YD WG  L+ TFKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF
Sbjct  228  AWAKMGPQSTEYDKWGQILQSTFKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYF  287

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYWV+IVG+L+NITD YLGIEK      LRRRHAEKVSE Y + W+E+L      +  W
Sbjct  288  QGYWVDIVGQLNNITDKYLGIEKKMPS--LRRRHAEKVSERYGKLWEEYLI-----KDKW  340

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGC+PCSGDHN +YS ETC +AM KALNFADNQVLR YGF+H+DLLD++SV 
Sbjct  341  RRPFITHFTGCEPCSGDHNPIYSWETCYNAMQKALNFADNQVLRKYGFVHKDLLDSSSVS  400

Query  178  PLPYDFPN*TS  146
            PLP+DFP+ +S
Sbjct  401  PLPFDFPSNSS  411



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 153/191 (80%), Gaps = 10/191 (5%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P    YD WG  L+ TFKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF
Sbjct  247  AWAKMGPQSTEYDKWGQILQSTFKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYF  306

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYWV+IVG+L+NITD YLGIEK      LRRRHAEKVSE Y + W+E+L      +  W
Sbjct  307  QGYWVDIVGQLNNITDKYLGIEKKMPS--LRRRHAEKVSERYGKLWEEYLI-----KDKW  359

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGC+PCSGDHN +YS ETC +AM KALNFADNQVLR YGF+H+DLLD++SV 
Sbjct  360  RRPFITHFTGCEPCSGDHNPIYSWETCYNAMQKALNFADNQVLRKYGFVHKDLLDSSSVS  419

Query  178  PLPYDFPN*TS  146
            PLP+DFP+ +S
Sbjct  420  PLPFDFPSNSS  430



>ref|XP_009618872.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 149/188 (79%), Gaps = 10/188 (5%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
             WA   P    YD WG TL+ TF DK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF
Sbjct  259  TWAKMGPQSTEYDKWGQTLQSTFNDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYF  318

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYWV+I+G+LDNITD YLGIEK      LRRRHAEKVSE Y + WKE+L      +  W
Sbjct  319  QGYWVDIIGQLDNITDKYLGIEKKMPS--LRRRHAEKVSERYGKLWKEYLI-----KDKW  371

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGC+PCSGDHN +YS ETC +AM K LNFADNQVLRNYGF+H+DLLD++SV 
Sbjct  372  RRPFITHFTGCEPCSGDHNPIYSWETCYNAMQKTLNFADNQVLRNYGFVHKDLLDSSSVS  431

Query  178  PLPYDFPN  155
            PL +DFP+
Sbjct  432  PLSFDFPS  439



>emb|CDP02616.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG   R TFKDK FPESDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG
Sbjct  264  PEYDKWGVIQRTTFKDKTFPESDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVG  323

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             L+NITD Y GIEK     +  RRHAE+V ESY + W+EHL++AG GR  WRRPF+THFT
Sbjct  324  TLENITDAYTGIEKRERRLR--RRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFT  381

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG++C DAM  ALNFADNQVLR YGF+HRDLLDT++V+PLP+D+P
Sbjct  382  GCQPCSGDHNQMYSGQSCWDAMQIALNFADNQVLRRYGFVHRDLLDTSTVLPLPFDYP  439



>ref|XP_010273069.1| PREDICTED: putative glycosyltransferase 7 [Nelumbo nucifera]
Length=460

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 148/187 (79%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P YD WG T R T  DK+FPE+DDQSGL+YL+L+E+EKW +KIY+E +YYF
Sbjct  275  AWAKMGPQTPNYDKWGKTQRSTLSDKLFPEADDQSGLVYLLLEEKEKWADKIYLEGEYYF  334

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+EIVG L+NITD Y+G+EK   G  LRRRHAEKV E Y+   +  L+ AG GR  W
Sbjct  335  EGYWLEIVGTLNNITDKYVGMEKEIRG--LRRRHAEKVMEHYSLVREPFLKAAGNGRGSW  392

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSG++N+MYSG++C   M KALNFADNQVLR++GFMHRDL D++SV 
Sbjct  393  RRPFITHFTGCQPCSGEYNQMYSGDSCWQGMEKALNFADNQVLRSFGFMHRDLQDSSSVS  452

Query  178  PLPYDFP  158
            PLP+D+P
Sbjct  453  PLPFDYP  459



>gb|ACE60602.1| putative galactomannan galactosyl transferase [Coffea arabica]
Length=448

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG   R TFKDK FPESDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG
Sbjct  264  PEYDKWGVIQRTTFKDKTFPESDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVG  323

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             L+NITD Y GIEK     +  RRHAE+V ESY + W+EHL++AG GR  WRRPF+THFT
Sbjct  324  TLENITDAYTGIEKRERRLR--RRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFT  381

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG++C DAM  ALNFADNQVLR YGF+HRDLLDT++V PLP+D+P
Sbjct  382  GCQPCSGDHNQMYSGQSCWDAMQIALNFADNQVLRRYGFVHRDLLDTSTVPPLPFDYP  439



>gb|EPS69883.1| hypothetical protein M569_04879, partial [Genlisea aurea]
Length=420

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P YD WG   R  F DK FPESDDQ+GLIYL+LKE +KWG KIYVES+YYF
Sbjct  236  AWAAMGPQSPEYDKWGEIQRSIFADKAFPESDDQAGLIYLLLKENKKWGPKIYVESEYYF  295

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+EIVG+LD I   YL I++      LRRRHAEK+S+SYA  W++HL++ G GR   
Sbjct  296  EGYWLEIVGELDRIAAEYLKIQRAVPA--LRRRHAEKLSKSYAAAWEKHLKDKGYGRGSL  353

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPF+THFTGCQPCSG+HN MY  ++CAD + KAL FAD+QVLRNYG++HRD LD ++VV
Sbjct  354  RRPFVTHFTGCQPCSGEHNPMYPEKSCADGLQKALTFADDQVLRNYGYLHRDPLDPSTVV  413

Query  178  PLPYDFP  158
            PLP+D+P
Sbjct  414  PLPFDYP  420



>ref|XP_004141854.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004167675.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN48624.1| hypothetical protein Csa_6G495780 [Cucumis sativus]
Length=444

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG  L+ T  DK+FPESDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV 
Sbjct  269  PNYEKWGQVLKSTIPDKLFPESDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVT  328

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNIT+ Y+ +E+   G++LRRRHAEKVSE Y E  +++L+ AG G+  WRRPFITHFT
Sbjct  329  TFDNITERYMEMER--GGQELRRRHAEKVSEQYGEFREKYLKEAGNGKGSWRRPFITHFT  386

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG +C D M KALNFADNQVLR YGFMH D  D+ SV  +PYD+P
Sbjct  387  GCQPCSGDHNQMYSGGSCWDGMRKALNFADNQVLRKYGFMHPDAFDS-SVSEVPYDYP  443


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW+MDFMDVWASMGPQ P     G+
Sbjct  249  RNCQWSMDFMDVWASMGPQTPNYEKWGQ  276



>ref|XP_010106924.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC12640.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=459

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 138/178 (78%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG+ LR TF DK FPESDDQ+GL YLI KE+EKW ++IY+ES+YYFEGYW EIV 
Sbjct  284  PEYEKWGSILRSTFADKAFPESDDQTGLAYLIYKEKEKWADRIYLESEYYFEGYWEEIVR  343

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LDNIT+ YL IEK    EKLRRRHAEKVSE Y    +EHL  AG G   WRRPFITHFT
Sbjct  344  TLDNITERYLEIEKK--DEKLRRRHAEKVSEQYGAFREEHLGAAGYGLGSWRRPFITHFT  401

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSG+HN+MYSGE+C D M KALNFADNQVLR YGFMH  LLD  SV  +P+D P
Sbjct  402  GCQPCSGNHNQMYSGESCWDGMTKALNFADNQVLRTYGFMHPHLLD-PSVNAVPFDHP  458



>ref|XP_010274411.1| PREDICTED: galactomannan galactosyltransferase 1-like [Nelumbo 
nucifera]
Length=467

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG T +   KDK++ ESDDQSGL+YL+L+++EKW +KIYVES YYFEGYW+EIV 
Sbjct  289  PDYDKWGKTQKSVLKDKVYAESDDQSGLVYLLLEQKEKWADKIYVESQYYFEGYWLEIVE  348

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            +L+NI+D Y+GIE T+AGE LRRRHAEKV+  YA+  + +L+ AG G   WRRPF+THFT
Sbjct  349  RLENISDRYVGIE-TSAGE-LRRRHAEKVNGYYAQLREPYLKEAGFGWGSWRRPFVTHFT  406

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GCQPC+G+HN +YSGE+C   M KALNFADNQVLR +GF+H D+LD++SV PLP+D+P+
Sbjct  407  GCQPCNGNHNRIYSGESCWKGMEKALNFADNQVLRTFGFVHGDMLDSSSVSPLPFDYPS  465


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW+MDFMDVWASMGPQ P     GK
Sbjct  269  RNCQWSMDFMDVWASMGPQTPDYDKWGK  296



>ref|XP_008440417.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
melo]
Length=445

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG  L+ T  DK+FPESDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV 
Sbjct  270  PNYEKWGQVLKSTIPDKLFPESDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVT  329

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNITD Y  +E+   G++LRRRHAEKVSE Y    +++L+ AG G+  WRRPFITHFT
Sbjct  330  TFDNITDKYREMER--GGQELRRRHAEKVSEQYGVFREKYLKEAGNGKGSWRRPFITHFT  387

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MYSG +C D M KALNFADNQVLR YGF+H D +D  SV  +PYD+P
Sbjct  388  GCQPCSGDHNQMYSGGSCWDGMRKALNFADNQVLRKYGFVHPDAMD-PSVSEVPYDYP  444


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW+MDFMDVWASMGPQ P     G+
Sbjct  250  RNCQWSMDFMDVWASMGPQTPNYEKWGQ  277



>gb|ADL36661.1| CAMTA domain class transcription factor [Malus domestica]
Length=449

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG
Sbjct  268  PEYEKWGETLRSTFKDKAFPESDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVG  327

Query  511  KLDNITDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I   Y  IE+   A   +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+TH
Sbjct  328  TLDKIEARYDEIERGEEANAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTH  387

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  388  FTGCQPCSGMHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>ref|XP_007205195.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
 gb|EMJ06394.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
Length=448

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 3/181 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG
Sbjct  268  PDYEKWGETLRSTFKDKAFPESDDQTGLAYLIYKEKEKWGKKIYMESEYYFEGYWAEIVG  327

Query  511  KLDNITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I D Y  IE+       +LRRRHAEKVSE Y E  +E+L  AG GR  WRRPFITH
Sbjct  328  TLDKIEDRYAEIERGEEDNAVRLRRRHAEKVSEQYGEFREEYLSEAGNGRGSWRRPFITH  387

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMY   +C D M KALNFADNQVLR YG++H   +D A V  +P+D+P
Sbjct  388  FTGCQPCSGRHNEMYKANSCWDGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYP  446

Query  157  N  155
            +
Sbjct  447  S  447



>ref|XP_009362595.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Pyrus x bretschneideri]
Length=495

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 138/180 (77%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI KE+EKWG+KIY+ES+YYFEGYW EIVG
Sbjct  314  PEYEKWGETLRSTFKDKAFPESDDQTGLAYLIYKEKEKWGDKIYLESEYYFEGYWAEIVG  373

Query  511  KLDNITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I   Y  IE+       +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+TH
Sbjct  374  TLDKIEARYDEIERGEEDNAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTH  433

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    D+A+  P+P+D+P
Sbjct  434  FTGCQPCSGMHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHASTGDSAA-TPVPFDYP  492



>gb|ADL36663.1| CAMTA domain class transcription factor [Malus domestica]
Length=441

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG
Sbjct  260  PDYEKWGETLRSTFKDKAFPESDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVG  319

Query  511  KLDNITDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I   Y  IE+    +  +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+TH
Sbjct  320  TLDKIEARYAEIERGEEDSAMRLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTH  379

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  380  FTGCQPCSGAHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  438



>ref|XP_008347885.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=449

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG
Sbjct  268  PEYEKWGETLRSTFKDKAFPESDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVG  327

Query  511  KLDNITDMYLGIEKTAAGE--KLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I   Y  IE+       +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+TH
Sbjct  328  TLDKIEARYDEIERGEEDNAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTH  387

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  388  FTGCQPCSGMHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>ref|XP_008237711.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
 ref|XP_008237720.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
Length=448

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG
Sbjct  268  PDYEKWGETLRSTFKDKAFPESDDQTGLAYLIYKEKEKWGKKIYLESEYYFEGYWAEIVG  327

Query  511  KLDNITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I D Y  IE+       +LRRRHAEKVSE Y    +E+L  AG GR  WRRPFITH
Sbjct  328  TLDKIEDRYAEIERGEEDNAVRLRRRHAEKVSEQYGAFREEYLSEAGYGRGSWRRPFITH  387

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMY   +C D M KALNFADNQVLR YG++H   +D A V  +P+D+P
Sbjct  388  FTGCQPCSGRHNEMYKANSCWDGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYP  446

Query  157  N  155
            +
Sbjct  447  S  447



>ref|XP_008362135.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=504

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG
Sbjct  323  PDYEKWGETLRSTFKDKAFPESDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVG  382

Query  511  KLDNITDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
             LD I   Y  IE+    +  +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+TH
Sbjct  383  TLDKIEARYAEIERGEEDSAMRLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTH  442

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  443  FTGCQPCSGAHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  501



>ref|XP_004288265.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 141/192 (73%), Gaps = 9/192 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y+ WG TLR TFKDK FPESDDQ+GL YLI KE EKW ++IY+ESDYYF
Sbjct  264  AWAAMGPQTPDYEKWGETLRATFKDKAFPESDDQTGLAYLIYKENEKWADRIYLESDYYF  323

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGE---KLRRRHAEKVSESYAEKWKEHLRNAGQ--  374
            EGYW EIVG L+NIT+ Y  IEK    E   +LRRRHAEKVSE Y    ++ L++AG   
Sbjct  324  EGYWAEIVGNLENITEKYTEIEKRRGDEDVARLRRRHAEKVSEQYGAFREKFLKDAGSGY  383

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G   WRRPF+THFTGCQPCSG HN MYSG +C D M KALNFADNQVLR YGF+H   +D
Sbjct  384  GVGSWRRPFVTHFTGCQPCSGAHNLMYSGTSCWDGMQKALNFADNQVLRKYGFVHASAVD  443

Query  193  TASVVPLPYDFP  158
            + S+ PLP+++P
Sbjct  444  S-SIQPLPFNYP  454



>gb|KHG22205.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=452

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y  WG   R TFKDK+FPESDDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ 
Sbjct  271  YKKWGEIQRSTFKDKLFPESDDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRY  330

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            +N T+MYL IE+ AA  +LRRRHAEKVSE Y    +E+L+ AG G+  WRRP ITHFTGC
Sbjct  331  ENTTEMYLEIERGAA--ELRRRHAEKVSEHYGAFREEYLKGAGNGKGSWRRPLITHFTGC  388

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            QPC+GDHN+MY GE+C + M KALNFADNQVLR YGF+H DLLD+++V  LP+D+P
Sbjct  389  QPCNGDHNKMYDGESCWNGMVKALNFADNQVLRKYGFIHPDLLDSSTVSELPFDYP  444



>ref|XP_003539263.1| PREDICTED: galactomannan galactosyltransferase 1-like isoformX1 
[Glycine max]
 ref|XP_006590622.1| PREDICTED: galactomannan galactosyltransferase 1-like isoform 
X2 [Glycine max]
Length=452

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 142/187 (76%), Gaps = 6/187 (3%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y+ WG TLR TFKDK FPESDDQ+GL YLI  E++KW ++IY+ES+YYF
Sbjct  264  AWASMGPQTPNYEKWGQTLRSTFKDKFFPESDDQTGLAYLIAIEKDKWADRIYLESEYYF  323

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW EI+G   NIT+ Y  +EK  +  +LRRRHAEKVSE+Y E  +E+L++AG G+  W
Sbjct  324  EGYWEEILGTFQNITEKYNEMEKGVS--RLRRRHAEKVSETYGEMREEYLKDAGNGKGSW  381

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSG +N MYS + C + M KALNFADNQV+R +G+M  DLLD A + 
Sbjct  382  RRPFITHFTGCQPCSGKYNAMYSADDCWNGMQKALNFADNQVMRKFGYMRPDLLDNA-IS  440

Query  178  PLPYDFP  158
            P+P+D+P
Sbjct  441  PVPFDYP  447



>gb|KJB18050.1| hypothetical protein B456_003G031400 [Gossypium raimondii]
Length=450

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y  WG   R TFKDK+FPESDDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ 
Sbjct  271  YKKWGEIQRSTFKDKLFPESDDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRY  330

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            +N T+MYL IE+ AA  +LRRRHAEKVSE Y    +E+L++AG G+  WRRP ITHFTGC
Sbjct  331  ENTTEMYLAIERGAA--ELRRRHAEKVSEQYGAFREEYLKSAGNGKGSWRRPLITHFTGC  388

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            QPC+GDHN+MY GE+C + M KALNFADNQVLR YGF+H DLLD++ V  +P+D+P
Sbjct  389  QPCNGDHNKMYDGESCWNGMVKALNFADNQVLRKYGFIHPDLLDSSIVSEVPFDYP  444



>gb|KHG22229.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=456

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y+ WG   R TFKDK+FPESDDQS ++YL+  E+EK+ + IY+E ++YFEGYWVEIVG  
Sbjct  277  YEKWGQIQRSTFKDKLFPESDDQSAMVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGY  336

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            +N T+ YL IE+ A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGC
Sbjct  337  ENTTERYLEIERGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGC  394

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            QPCSGDHN+MY+GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  395  QPCSGDHNQMYAGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>gb|KJB46680.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=424

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y+ WG   R TFKDK+FPESDDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  
Sbjct  245  YEKWGQIQRLTFKDKLFPESDDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGY  304

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            +N T+ YL IE+ A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGC
Sbjct  305  ENTTERYLEIERGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGC  362

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            QPCSGDHN MY+GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  363  QPCSGDHNLMYAGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  418



>ref|XP_006350640.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=411

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 149/208 (72%), Gaps = 15/208 (7%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            GI +G ++   C        AWA      P Y+ WG  LR TFKDK FP+SDDQSGL YL
Sbjct  208  GINAGVFLIRNCQWSMDLIEAWAKMGPQSPEYNKWGEILRTTFKDKKFPQSDDQSGLSYL  267

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            +LKE++KWG KIY+ES+YYF+GYWV+I+  LDNIT+ Y  IEK      LRRRHAEKV  
Sbjct  268  LLKEKDKWGEKIYIESEYYFQGYWVDIIETLDNITNKYFEIEKKIP--ILRRRHAEKVV-  324

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADN  239
            S  + W+E+L    +     RRPF+THFTGC+PCSGD+N +YS ETC DAM KALNFADN
Sbjct  325  SEIKVWEEYLI---KDNYSIRRPFVTHFTGCEPCSGDYNPIYSWETCYDAMQKALNFADN  381

Query  238  QVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            QVLR YGF+H +LLD+++V PLP+DFP+
Sbjct  382  QVLRKYGFLHNNLLDSSTVFPLPFDFPS  409



>gb|KJB46678.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46679.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46681.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46682.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=456

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y+ WG   R TFKDK+FPESDDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  
Sbjct  277  YEKWGQIQRLTFKDKLFPESDDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGY  336

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            +N T+ YL IE+ A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGC
Sbjct  337  ENTTERYLEIERGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGC  394

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            QPCSGDHN MY+GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  395  QPCSGDHNLMYAGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>emb|CDP02619.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG TLR TFKDK+FPESDDQS L+YL+LKE+ KWG+ +YVE++Y   GYW  +VG
Sbjct  285  PEYARWGQTLRSTFKDKMFPESDDQSALVYLLLKEKRKWGDMMYVENEYSLHGYWAAVVG  344

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            ++DNIT  Y  IE+     KLRRRHAE V E Y + W+EHL +AG  + GWRRPFITHFT
Sbjct  345  RIDNITGRYEKIERQEV--KLRRRHAEAVGERYGKLWEEHLEDAGDRKGGWRRPFITHFT  402

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN  Y G+ C   M +ALNFADNQVLRN+GF+H DL +  SV PL +DFP
Sbjct  403  GCQPCSGDHNPSYVGKDCWVGMERALNFADNQVLRNFGFVHPDLRN-GSVSPLAFDFP  459



>ref|XP_007156700.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
 gb|ESW28694.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
Length=450

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TLR TFKDK FPESDDQ+GL YLI  E+EKW +KIY+ESDYYFEGYW EIVG
Sbjct  277  PNYEKWGKTLRSTFKDKFFPESDDQTGLAYLIAIEKEKWADKIYLESDYYFEGYWKEIVG  336

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             L NI+D Y  +E+     +LRRRHAEKVSESY    +E L++AG    GWRRPFITHFT
Sbjct  337  TLQNISDKYKKMEEGV--HRLRRRHAEKVSESYGGIREEDLKDAG---FGWRRPFITHFT  391

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GCQPCSG +N MYS + C + MHKALNFADNQVLRNYGF+  DLL   SV  LP+D+P+
Sbjct  392  GCQPCSGKYNAMYSADDCWNGMHKALNFADNQVLRNYGFLRPDLL-LNSVSTLPFDYPH  449



>ref|XP_007047569.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047570.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91726.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91727.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
Length=455

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y  WG   R TFKDK+FPESDDQS LIYL+ KE+EK+ + IY+E ++Y EGYWVEIVG  
Sbjct  276  YVKWGQIQRSTFKDKLFPESDDQSALIYLLYKEKEKYYDHIYLEGEFYLEGYWVEIVGGY  335

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            +N T+ YL IE+     KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGC
Sbjct  336  ENTTERYLEIERGVP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGC  393

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            QPCSGDHN+MY+GETC + M KALNFADNQVLR YGF+  DL D+++V  +PYD+P
Sbjct  394  QPCSGDHNQMYAGETCWNGMVKALNFADNQVLRKYGFVRPDLRDSSTVTEVPYDYP  449



>ref|XP_006426098.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
 gb|ESR39338.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
Length=452

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 141/188 (75%), Gaps = 5/188 (3%)
 Frame = -3

Query  709  AWAHSXP---PYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
             WA+  P    Y  WG   R TFKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YF
Sbjct  262  TWANMGPIGADYAKWGQVQRSTFKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYF  321

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+EIV   DNIT  Y+ IE+     +  RRHAEKVSESYA + +++L+ AG GR  W
Sbjct  322  EGYWLEIVPTYDNITGRYMEIERRVRTLR--RRHAEKVSESYAAQREQYLKEAGNGRGSW  379

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDHN+MYSGETC   M KALNFADNQVLR YGF+H DL D++ V 
Sbjct  380  RRPFITHFTGCQPCSGDHNQMYSGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVS  439

Query  178  PLPYDFPN  155
            P+P+DFP+
Sbjct  440  PVPFDFPD  447



>ref|XP_004234713.2| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=446

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 150/208 (72%), Gaps = 15/208 (7%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            GI +G ++   C        AWA      P Y+ WG  LR TFKDK FP+SDDQSGL YL
Sbjct  243  GINAGVFLIRNCQWSMDLIEAWAKMGPQSPEYNRWGEILRTTFKDKNFPQSDDQSGLSYL  302

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            +LKE++KWG+KIY+ES+YYF+GYWV+I+  LDNIT+ Y  IEK      LRRRHAEKV  
Sbjct  303  LLKEKDKWGDKIYIESEYYFQGYWVDIIDTLDNITNKYFEIEKKIP--ILRRRHAEKVV-  359

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADN  239
            S  + W+E+L    +     RRPF+THFTGC+PCSGD+N +YS ETC +AM KALNFADN
Sbjct  360  SEIKVWEEYLI---KDSYSIRRPFVTHFTGCEPCSGDYNPIYSWETCYNAMQKALNFADN  416

Query  238  QVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            QVLR YGF+H +LLD++SV PLP+D+P+
Sbjct  417  QVLRKYGFVHNNLLDSSSVRPLPFDYPS  444



>ref|XP_006466460.1| PREDICTED: putative glycosyltransferase 7-like [Citrus sinensis]
Length=452

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 141/188 (75%), Gaps = 5/188 (3%)
 Frame = -3

Query  709  AWAHSXP---PYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
             WA+  P    Y  WG   R TFKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YF
Sbjct  262  TWANMGPIGADYAKWGQIQRSTFKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYF  321

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+EIV   DNIT  Y+ IE+     +  RRHAEKVSESYA + +++L+ AG GR  W
Sbjct  322  EGYWLEIVPTYDNITGRYMEIERRVRTLR--RRHAEKVSESYAAQREQYLKEAGNGRGSW  379

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDHN+MYSGETC   M KALNFADNQVLR YGF+H DL D++ V 
Sbjct  380  RRPFITHFTGCQPCSGDHNQMYSGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVS  439

Query  178  PLPYDFPN  155
            P+P+DFP+
Sbjct  440  PVPFDFPD  447



>ref|XP_003611556.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES94514.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=446

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 6/188 (3%)
 Frame = -3

Query  709  AWA---HSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y+ WG TLR TFKDK FPESDDQ+GL YLI  E+EKWG+KIY+E +YYF
Sbjct  261  AWAGMGPQSPDYEEWGKTLRSTFKDKFFPESDDQTGLAYLIAIEKEKWGDKIYLEGEYYF  320

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW EIV    NI+  Y  IEK     KLRRR+AEKVSE+Y    +E+L++AG G+  W
Sbjct  321  EGYWEEIVETFSNISKKYEDIEKVEP--KLRRRYAEKVSEAYGVIREEYLKDAGYGKGSW  378

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPF+THFTGCQPCSG +NEMY+ + C + M KALNFADNQV+R +GF+H+DL D   V 
Sbjct  379  RRPFVTHFTGCQPCSGKYNEMYTADACWNGMKKALNFADNQVMRKFGFVHKDLGDNG-VS  437

Query  178  PLPYDFPN  155
             LP+D+P 
Sbjct  438  SLPFDYPQ  445



>ref|XP_003517354.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=449

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 137/187 (73%), Gaps = 9/187 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y+ WG TLR TFKDK FPESDDQ+GL YLI  E++KW  +IY+ES+YYF
Sbjct  267  AWASMGPQSPNYEKWGQTLRSTFKDKFFPESDDQTGLAYLIAMEKDKWAERIYLESEYYF  326

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW EI G   NIT+ Y  +EK    ++LRRRHAEKVSE+Y E  +E+L++AG  +  W
Sbjct  327  EGYWEEIQGTFKNITEKYKEMEKGV--QRLRRRHAEKVSETYGEMREEYLKDAGNAKGSW  384

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSG +N MYS   C +AMH ALNFADNQV+R +G+    LLD A V 
Sbjct  385  RRPFITHFTGCQPCSGKYNAMYSAHDCWNAMHNALNFADNQVMRKFGY---SLLDNA-VS  440

Query  178  PLPYDFP  158
            PLP+D+P
Sbjct  441  PLPFDYP  447



>emb|CAI79403.1| galactomannan galactosyltransferase [Senna occidentalis]
Length=449

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG  LR TFKDK FPESDDQ+GL YLI  E+EKW ++IY+ES+YYFEGYW EIV 
Sbjct  274  PSYEKWGEKLRTTFKDKAFPESDDQTGLAYLIAVEKEKWADRIYLESEYYFEGYWKEIVE  333

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NITD Y  +E+      LRRRHAEKVSESY    + ++  AG GR  WRRPFITHFT
Sbjct  334  TYENITDKYHEVERKV--RSLRRRHAEKVSESYGAVREPYVMVAGSGRGSWRRPFITHFT  391

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSG+HN MYS + C + M+KAL FADNQVLR +G++H DL D  SV P+P+D+P
Sbjct  392  GCQPCSGNHNAMYSPDACWNGMNKALIFADNQVLRKFGYVHPDLQDN-SVSPIPFDYP  448


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQDIP  633
            RNCQW++DFMDVWASMGPQ P+    G+      + +  P
Sbjct  254  RNCQWSLDFMDVWASMGPQTPSYEKWGEKLRTTFKDKAFP  293



>gb|KJB43940.1| hypothetical protein B456_007G224800 [Gossypium raimondii]
Length=456

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 139/179 (78%), Gaps = 6/179 (3%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y+ WG   R  FKDK++PESDDQS LIYL+ KE+EK+ + IY+E ++YF+GYWV+++G  
Sbjct  273  YEKWGQIQRSMFKDKLYPESDDQSALIYLLYKEKEKYYDHIYLEKEFYFQGYWVDLIGVY  332

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            DN T+ YL +E+  A  +LRRRHAEKVSE YA   +E L+  G+    W+RPFITHFTGC
Sbjct  333  DNTTERYLQMERKVA--RLRRRHAEKVSEQYAAFREEFLKETGK----WKRPFITHFTGC  386

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  149
            +PCSG+HN+ Y GETC + M KALNFADNQ+LRNYGF+H DLLD+++V  +P+D+PN T
Sbjct  387  EPCSGNHNQKYDGETCWEGMVKALNFADNQILRNYGFLHSDLLDSSTVTEVPFDYPNPT  445



>gb|KDP32091.1| hypothetical protein JCGZ_12552 [Jatropha curcas]
Length=453

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  + WG   R  FKDK+FP SDDQS LIYL+ K++    +KIY+E +YYFEGYW EI+ 
Sbjct  274  PDVEKWGQIQRSLFKDKLFPGSDDQSALIYLLYKDKS-LMDKIYLEGEYYFEGYWSEILP  332

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNITD Y  IEK     KLRRRHAEKVSE YA   + HLR AG G+  WRRPFITHFT
Sbjct  333  TYDNITDKYTEIEK--EDPKLRRRHAEKVSEQYAAFREPHLREAGNGKGSWRRPFITHFT  390

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN+MY G++C   M KALNFADNQVLR YGF+H DLLD+ +VV  P+D+P
Sbjct  391  GCQPCSGDHNKMYEGDSCWKGMVKALNFADNQVLRKYGFVHPDLLDSKTVVETPFDYP  448



>ref|XP_002310890.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE91340.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y+ WG   R  FKDK+FPESDDQSGL YL+ K++   G KIY+E +YYFEGYW +I+   
Sbjct  280  YEKWGEIQRSVFKDKLFPESDDQSGLTYLLYKDKSLTG-KIYLEGEYYFEGYWADILPTY  338

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            DNIT+ Y  +EK     KLRRRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGC
Sbjct  339  DNITEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGC  396

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            QPCSGDHN+MY GETC + M KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  397  QPCSGDHNQMYEGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>gb|KDO78929.1| hypothetical protein CISIN_1g045999mg [Citrus sinensis]
Length=438

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 134/188 (71%), Gaps = 19/188 (10%)
 Frame = -3

Query  709  AWAHSXP---PYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
             WA+  P    Y  WG   R TFKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YF
Sbjct  262  TWANMGPIGADYAKWGQIQRSTFKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYF  321

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+EIV  +                  LRRRHAEKVSESYA + +++L+ AG GR  W
Sbjct  322  EGYWLEIVPTV----------------RTLRRRHAEKVSESYAAQREQYLKEAGNGRGSW  365

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDHN+MYSGETC   M KALNFADNQVLR YGF+H DL D++ V 
Sbjct  366  RRPFITHFTGCQPCSGDHNQMYSGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVS  425

Query  178  PLPYDFPN  155
            P+P+DFP+
Sbjct  426  PVPFDFPD  433



>ref|XP_006857127.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
 gb|ERN18594.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
Length=478

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 132/178 (74%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+  G T      D++F  SDDQS L+YL+L E++KWG+KI++E+ YYFEGYWVEI+G
Sbjct  299  PNYEEAGKTQTSVLSDRLFSASDDQSALVYLLLTERDKWGDKIFLENSYYFEGYWVEIIG  358

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NIT  Y  +EK  A   LRRR  EK++  + E  + +L+ AG GR  WRRPF+THFT
Sbjct  359  TYENITRRYEDMEK--AQPILRRRKPEKLAMKFGELREPYLKEAGNGRFSWRRPFVTHFT  416

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDHN++YSGE C   M +ALNFADNQVLRN+GF+H DL D+ASV PLP+DFP
Sbjct  417  GCQPCSGDHNKIYSGENCWKGMERALNFADNQVLRNFGFVHEDLSDSASVKPLPFDFP  474



>ref|XP_004511818.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG+ LR TFKDK FPESDDQ+GL YLI  E+EKW ++IY+E +YYFEGYW EIVG
Sbjct  282  PDYEEWGHKLRSTFKDKFFPESDDQTGLAYLIAIEKEKWADRIYLEGEYYFEGYWEEIVG  341

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NI+  Y  IEK     +LRRRHAEKVSESY    +E+LR AG G+  WRRPF+THFT
Sbjct  342  TFENISKKYDEIEKGV--RRLRRRHAEKVSESYGAVREEYLREAGYGKGSWRRPFVTHFT  399

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GCQPCSG +NEMY+ + C + M +AL+FADNQV+R YG++H DL +   V  +P+D+P 
Sbjct  400  GCQPCSGKYNEMYTADACWNGMRRALHFADNQVIRKYGYVHPDLGNNL-VTSIPFDYPQ  457



>ref|XP_011007841.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011007842.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=458

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y  WG   R  FKDK+FPESDDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   
Sbjct  281  YKKWGPIQRSVFKDKLFPESDDQSGLIYMLYQDK-GLMDKIYLEGEYYFEGYWADIVPTY  339

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            DNIT+ Y  +EK     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGC
Sbjct  340  DNITEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGC  397

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            QPCSGDHN++Y GETC + M KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  398  QPCSGDHNQIYHGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_011031309.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011016265.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=457

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 129/177 (73%), Gaps = 3/177 (2%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y+ WG   R  FKDK+FPESDDQSGL YL+ K++     KIY+E +YYFEGYW +I+   
Sbjct  280  YEKWGEIQRSVFKDKLFPESDDQSGLTYLLYKDKS-LTEKIYLEGEYYFEGYWADILPTY  338

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            DNIT+ Y  +EK     KLRRRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGC
Sbjct  339  DNITEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGC  396

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            QPCSGDHN+MY GETC   M KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  397  QPCSGDHNQMYEGETCWTGMVKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>ref|XP_002320005.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98320.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=458

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  685  YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL  506
            Y  WG   R  FKDK+FPESDDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   
Sbjct  281  YKKWGPIQRSVFKDKLFPESDDQSGLIYMLYQDK-GLMDKIYLEGEYYFEGYWADIVPTY  339

Query  505  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  326
            DNIT+ Y  +EK     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGC
Sbjct  340  DNITEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGC  397

Query  325  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            QPCSGDHN++Y GETC + M KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  398  QPCSGDHNQIYHGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_009394361.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 136/182 (75%), Gaps = 6/182 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG   +  FKDK+F ESDDQS L+YL+LK +++WG+KI++ESDYYFEGYWVEIVG
Sbjct  271  PDYDRWGQLQKAEFKDKLFNESDDQSALVYLLLKHKDQWGDKIFLESDYYFEGYWVEIVG  330

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLR---NAGQGRSGWRRPFIT  341
            +L+N+T  Y  +E+   G  LRRRHAE  + +Y      HL     A  G +GWRRPF+T
Sbjct  331  RLENMTAKYAAVERQVQG--LRRRHAEVANGAYGRLRDRHLSGEDGAVSGPNGWRRPFMT  388

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDF  161
            HFTGCQPCSGDHN+MYSGE+C + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+
Sbjct  389  HFTGCQPCSGDHNKMYSGESCWEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDY  447

Query  160  PN  155
            P+
Sbjct  448  PS  449



>ref|XP_002525290.1| transferase, putative [Ricinus communis]
 gb|EEF37118.1| transferase, putative [Ricinus communis]
Length=446

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P +  WG+  R  FKDK+FP+SDDQ+ LIY++ K++    +KIY+E +YYFEGYW+EIV 
Sbjct  267  PDFQKWGHIQRSLFKDKLFPDSDDQTALIYMLYKDKSL-TDKIYLEGEYYFEGYWLEIVP  325

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNIT+ Y  IE+     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFT
Sbjct  326  TYDNITEKYTEIERQDV--KLRRRHAEKVSEQYGAFREPHLKAAGNGKGSWRRPFITHFT  383

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GCQPCSG+HN+MY G+ C D M +ALNFADNQVLR YGF+H DLL++ +VV  P+D+P+
Sbjct  384  GCQPCSGEHNKMYEGDACWDGMVRALNFADNQVLRKYGFVHPDLLNSNTVVETPFDYPD  442



>ref|XP_011099400.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=430

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 3/179 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  L  TFKDK+FPESDDQS LIYL+LKE+ KWG+ IYVE++Y   GYW+EIV 
Sbjct  249  PDYRKWGQILISTFKDKLFPESDDQSALIYLLLKERRKWGDMIYVENEYSLHGYWLEIVK  308

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGR-SGWRRPFITHF  335
            K   I   Y+ IEK     +LRRRHAE V ESYA + + HL   G+ + SGWRRPFITHF
Sbjct  309  KFARIAKKYVEIEKRVP--RLRRRHAEAVRESYAAELERHLAGGGERQDSGWRRPFITHF  366

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            TGCQPCSG+HN  Y G++C   M +ALNFADNQVLR+YGF+H D+ + + V PLP+D+P
Sbjct  367  TGCQPCSGEHNPAYEGDSCWVGMERALNFADNQVLRSYGFVHPDIANGSYVRPLPFDYP  425



>gb|KHN36310.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=417

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 134/187 (72%), Gaps = 10/187 (5%)
 Frame = -3

Query  706  WAHSXPPYDHW----GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            WAH       W      TLR TFKDK FPESDDQ+GL YLI  E++KW  +IY+ES+YYF
Sbjct  235  WAHLIHEKRSWTGLNAGTLRSTFKDKFFPESDDQTGLAYLIAMEKDKWAERIYLESEYYF  294

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW EI G   NIT+ Y  +EK    ++LRRRHAEKVSE+Y E  +E+L++AG  +  W
Sbjct  295  EGYWEEIQGTFKNITEKYKEMEKGV--QRLRRRHAEKVSETYGEMREEYLKDAGNAKGSW  352

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSG +N MYS   C++AMH ALNFADNQV+R +G+    LLD A V 
Sbjct  353  RRPFITHFTGCQPCSGKYNAMYSPHDCSNAMHNALNFADNQVMRKFGY---SLLDNA-VS  408

Query  178  PLPYDFP  158
            PLP+D+P
Sbjct  409  PLPFDYP  415



>ref|XP_010531308.1| PREDICTED: putative glycosyltransferase 7 [Tarenaya hassleriana]
Length=449

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = -3

Query  697  SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEI  518
            + P Y+ WG   R  FKDK+FPESDDQ+ LIYL+ K +E + +KIY+E  YYFEGYW+EI
Sbjct  267  TSPEYEKWGEIQRSIFKDKLFPESDDQTALIYLLYKHREVYYDKIYLEGAYYFEGYWLEI  326

Query  517  VGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFIT  341
            V  LDN+T+ YL +E+  A    RRRHAEKVSE Y A + +  L+    G+   RRPFIT
Sbjct  327  VSGLDNVTERYLEMERQDA--TCRRRHAEKVSERYGAFREERFLKGVAGGKGSVRRPFIT  384

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDF  161
            HFTGCQPCSGDHN MY+G+TC + M +ALNFADNQV+R+YGF+H DL  T+ + P+P+D+
Sbjct  385  HFTGCQPCSGDHNRMYNGDTCWNGMIRALNFADNQVMRSYGFVHSDLRKTSPLQPVPFDY  444

Query  160  PN  155
            P+
Sbjct  445  PD  446



>ref|XP_010109205.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC21327.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=433

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 136/186 (73%), Gaps = 11/186 (6%)
 Frame = -3

Query  706  WAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFE  536
            WA   P    Y+ WG T +  FKDK++PESDDQSGLIYL+LKE EKWG+KIY+ES+Y FE
Sbjct  253  WAKMGPQSLEYEKWGKTQKLVFKDKLYPESDDQSGLIYLLLKENEKWGDKIYLESEYNFE  312

Query  535  GYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWR  356
            GYW+ +VG LDNIT  Y  IEK      LRRRHAEK+SE Y+E       N  +G    +
Sbjct  313  GYWLGMVGGLDNITKGYTEIEKKVG--VLRRRHAEKMSEYYSEI----RENYSKGVE--K  364

Query  355  RPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVP  176
            RPF+ HFTGC+PC+GDHN +Y+ E C + M KALNFADNQVLR++GF+H DLL+++ V P
Sbjct  365  RPFVIHFTGCEPCTGDHNPVYTWEACWNGMQKALNFADNQVLRSFGFVHPDLLNSSLVSP  424

Query  175  LPYDFP  158
            LP+DFP
Sbjct  425  LPFDFP  430



>ref|XP_004231939.1| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=443

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 123/178 (69%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  LR TFKDK FPESDDQS L YLILK ++KW +KI+  +DY   GYW+ IV 
Sbjct  260  PEYKQWGKILRTTFKDKTFPESDDQSALSYLILKGEQKWRSKIHAITDYSLHGYWLGIVN  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + +NIT  Y+ IE+     KLRRRHAE VS SYA  W+  L      + GWRRPFITHFT
Sbjct  320  RFENITANYMKIERDVP--KLRRRHAEAVSHSYAAAWEPLLAEGADEKGGWRRPFITHFT  377

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDH   Y G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  378  GCQPCSGDHATEYVGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_006404757.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
 gb|ESQ46210.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
Length=449

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 138/193 (72%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWT-CGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E++  KIY+E 
Sbjct  260  TWTNMGPV----SPEYAKWGQIQRSIFKDKLFPESDDQTALIYLLFKHREEYYPKIYLEG  315

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQ  374
            +YYFEGYW+EIV  L N+TD YL +E+  A   LRRRHAEKVSE Y A + +  LR    
Sbjct  316  EYYFEGYWLEIVPGLANVTDRYLEMEREDA--TLRRRHAEKVSERYGAFREERFLRGERG  373

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  374  GKGSLRRPFVTHFTGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRRYGFVHSDLGK  433

Query  193  TASVVPLPYDFPN  155
            T+ + P+P+D+P+
Sbjct  434  TSPLQPVPFDYPD  446



>emb|CAI11452.1| alpha-6-galactosyltransferase [Solanum tuberosum]
Length=443

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 123/178 (69%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  LR TFKDK FPESDDQS L YLILK + KW +KI+  +DY   GYW+ IV 
Sbjct  260  PEYKQWGKILRTTFKDKTFPESDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVN  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + D IT+ Y  IE+     KLRRRHAE VS+SYAE  +  L     G+ GWRRPFITHFT
Sbjct  320  RFDKITENYTKIERDVP--KLRRRHAEAVSDSYAEAREPLLAEGADGKGGWRRPFITHFT  377

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDH   Y G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  378  GCQPCSGDHAAEYVGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_006363811.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=443

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 123/178 (69%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  LR TFKDK FPESDDQS L YLILK + KW +KI+  +DY   GYW+ IV 
Sbjct  260  PEYKQWGKILRTTFKDKTFPESDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVN  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + D IT+ Y  IE+     KLRRRHAE VS+SYAE  +  L     G+ GWRRPFITHFT
Sbjct  320  RFDKITENYTKIERDVP--KLRRRHAEAVSDSYAEAREPLLAEGEDGKGGWRRPFITHFT  377

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDH   Y G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  378  GCQPCSGDHAAEYVGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>emb|CDY49440.1| BnaA09g42270D [Brassica napus]
Length=448

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 137/193 (71%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWTC-GPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P +  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E 
Sbjct  259  TWTSMGPV----SPDFAKWGEIQRSIFKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEG  314

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQ  374
            +YYFEGYW+EIV  L NIT+ YL +E+  A   LRRRHAEKVSE YA   +E  LR    
Sbjct  315  EYYFEGYWLEIVPGLANITERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLRGESG  372

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN MY+G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  373  GKGSKRRPFVTHFTGCQPCSGDHNTMYNGDTCWNGMIKAINFADNQVMRRYGFVHSDLGK  432

Query  193  TASVVPLPYDFPN  155
            T+ + P+P+D+P+
Sbjct  433  TSPLQPVPFDYPD  445



>ref|XP_009117319.1| PREDICTED: putative glycosyltransferase 7 [Brassica rapa]
Length=448

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 137/193 (71%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWTC-GPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P +  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E 
Sbjct  259  TWTSMGPV----SPDFAKWGEIQRSIFKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEG  314

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQ  374
            +YYFEGYW+EIV  L NIT+ YL +E+  A   LRRRHAEKVSE YA   +E  LR    
Sbjct  315  EYYFEGYWLEIVPGLANITERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLRGESG  372

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN MY+G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  373  GKGSKRRPFVTHFTGCQPCSGDHNTMYNGDTCWNGMIKAINFADNQVMRRYGFVHSDLGK  432

Query  193  TASVVPLPYDFPN  155
            T+ + P+P+D+P+
Sbjct  433  TSPLQPVPFDYPD  445



>ref|XP_002880469.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56728.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=434

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 137/193 (71%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWT-CGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E 
Sbjct  245  TWTGMGPV----SPEYAKWGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEG  300

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQ  374
            D+YFEGYW+EIV  L N+T+ YL +E+  A   LRRRHAEKVSE YA   +E  L+    
Sbjct  301  DFYFEGYWLEIVPGLTNVTERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLKGERG  358

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  359  GKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGK  418

Query  193  TASVVPLPYDFPN  155
            T+ + PLP+D+P+
Sbjct  419  TSPLQPLPFDYPD  431



>emb|CDX76887.1| BnaC08g34730D [Brassica napus]
Length=448

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 136/193 (70%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWTC-GPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P +  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E 
Sbjct  259  TWTSMGPV----SPDFAKWGEIQRSIFKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEG  314

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQ  374
            +YYFEGYW+EIV  L NIT+ YL +E+  A   LRRRHAEKVSE YA   +E  LR    
Sbjct  315  EYYFEGYWLEIVPGLANITERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLRGESG  372

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN MY G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  373  GKGSKRRPFVTHFTGCQPCSGDHNTMYDGDTCWNGMIKAINFADNQVMRRYGFVHSDLGK  432

Query  193  TASVVPLPYDFPN  155
            T+ + P+P+D+P+
Sbjct  433  TSPLQPVPFDYPD  445



>ref|XP_010417049.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=466

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 131/180 (73%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E DYYFEGYW+EIV 
Sbjct  286  PEYAKWGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDYYFEGYWLEIVP  345

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THF
Sbjct  346  GFANVTERYLEMEREDAA--LRRRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHF  403

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  404  TGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  463



>ref|XP_009607432.1| PREDICTED: glycosyltransferase 6-like [Nicotiana tomentosiformis]
Length=443

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  LR TFKDKIFPESDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV 
Sbjct  260  PEYKQWGKILRSTFKDKIFPESDDQSALSYIIMKGEEKWRSKIHAITDYSLHGYWLGIVD  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + DNIT  Y+ I++     KLRRRHAE VSESYA   +  +   G  + GWRRPFITHFT
Sbjct  320  RFDNITGNYVKIDRDVP--KLRRRHAEAVSESYAAAREPLVAEGGDWKGGWRRPFITHFT  377

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDH   Y G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  378  GCQPCSGDHAAEYVGDKCWVGMERALNFADNQVLRNFGFMHNDIKSNSPVSPVNFDFP  435



>ref|XP_010472288.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 136/193 (70%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWT-CGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E 
Sbjct  266  TWTGMGPV----SPEYAKWGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEG  321

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQ  374
            D+YFEGYW+EIV    N+T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    
Sbjct  322  DFYFEGYWLEIVPGFANVTERYLEMEREDA--TLRRRHAEKVSEGYAAFREKRFLKGERG  379

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  380  GKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGK  439

Query  193  TASVVPLPYDFPN  155
            T+ + P+P+D+P+
Sbjct  440  TSPLQPVPFDYPD  452



>ref|NP_565544.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 sp|O81007.1|GT7_ARATH RecName: Full=Putative glycosyltransferase 7; Short=AtGT7 [Arabidopsis 
thaliana]
 gb|AAC32437.1| Expressed protein [Arabidopsis thaliana]
 emb|CAC01675.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAK59529.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15201.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07370.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 gb|AHL38845.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 137/193 (71%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWT-CGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P Y  WG   R  FKDK+FPESDDQ+ L+YL+ K +E +  KIY+E 
Sbjct  260  TWTGMGPV----SPEYAKWGQIQRSIFKDKLFPESDDQTALLYLLYKHREVYYPKIYLEG  315

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQ  374
            D+YFEGYW+EIV  L N+T+ YL +E+  A   LRRRHAEKVSE YA   +E  L+    
Sbjct  316  DFYFEGYWLEIVPGLSNVTERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLKGERG  373

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  374  GKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGK  433

Query  193  TASVVPLPYDFPN  155
            T+ + P+P+D+P+
Sbjct  434  TSPLQPVPFDYPD  446



>ref|XP_010429224.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 131/180 (73%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV 
Sbjct  275  PEYAKWGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVP  334

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THF
Sbjct  335  GFANVTERYLEMEREDA--TLRRRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHF  392

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  393  TGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>emb|CDP02617.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 128/179 (72%), Gaps = 3/179 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y +W  TL  T  DK+ P +D+QS L+YL+L+E++KWG+ IY+E+ YY  GYWVEIVG
Sbjct  260  PDYKYWSETLMSTLSDKVIPGADEQSSLVYLLLREKKKWGDMIYLENQYYLHGYWVEIVG  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHF  335
            +L++I   YL  E  A    LRRR AE VSES    W++ LR+AG  G SGWRRPFITHF
Sbjct  320  RLNDIIKKYLDTE--AKVPVLRRRVAEVVSESLDGVWEKCLRDAGGFGNSGWRRPFITHF  377

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            TGCQPC+G  +  Y G  C  AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  378  TGCQPCTGKRDPAYKGNACWVAMEKALNFADNQVLRRYGFMHPDLGNGSSVFPVPFDFP  436



>ref|XP_006294199.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
 gb|EOA27097.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
Length=452

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 137/193 (71%), Gaps = 8/193 (4%)
 Frame = -3

Query  727  SWT-CGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            +WT  GP      P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E++  KIY+E 
Sbjct  263  TWTGMGPV----SPEYAKWGQIQRSIFKDKLFPESDDQTALIYLLYKHREEYYPKIYLEG  318

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQ  374
            DYYFEGYW+EIV  L N+T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    
Sbjct  319  DYYFEGYWLEIVPGLANVTERYLEMEREDA--TLRRRHAEKVSERYAAFREKRFLKGERG  376

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G+   RRPF+THFTGCQPCSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  
Sbjct  377  GKGSKRRPFVTHFTGCQPCSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGK  436

Query  193  TASVVPLPYDFPN  155
            T+ +  +P+D+P+
Sbjct  437  TSPLQHVPFDYPD  449



>ref|NP_001105164.1| alpha-6-galactosyltransferase [Zea mays]
 emb|CAI11455.1| alpha-6-galactosyltransferase [Zea mays]
 gb|ACF82483.1| unknown [Zea mays]
 gb|AFW63649.1| hypothetical protein ZEAMMB73_992521 [Zea mays]
Length=444

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 126/181 (70%), Gaps = 4/181 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y HWG  L+ TFKDK+F ESDDQS L+Y++L+E  +W +K+++ES YYFEGYW+EIVG
Sbjct  259  PDYQHWGAVLKSTFKDKVFDESDDQSALVYMLLQEGSRWRDKVFLESGYYFEGYWMEIVG  318

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG---QGRSGWRRPFIT  341
            +L N+T+ Y  +E+      LRRRHAE+    YA      L  AG    G  GWRRPF+T
Sbjct  319  RLANMTERYEAMERRPGAAALRRRHAEREHAEYAVARNAALGGAGLAETGVHGWRRPFVT  378

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDF  161
            HFTGCQPCSG  NE YSG++C   M +ALNFAD+QVLR YGF H   L +  V PLP+D+
Sbjct  379  HFTGCQPCSGQRNEHYSGDSCDQGMRRALNFADDQVLRAYGFRHASSL-SDDVQPLPFDY  437

Query  160  P  158
            P
Sbjct  438  P  438



>gb|ACH58908.1| galactosyl transferase [Coffea canephora]
Length=444

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 3/179 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y +W  TL  T  DK+ P +D+QS L+YL+L+E++KWG+  Y+E+ YY  GYWV IVG
Sbjct  260  PDYKYWSETLMSTLSDKVIPGADEQSSLVYLLLREKKKWGDMTYLENQYYLHGYWVAIVG  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHF  335
            +L++I   YL  E  A    LRRR AE VSES    W+++LR+AG  G SGWRRPFITHF
Sbjct  320  RLNDIIKKYLDTE--AKVPVLRRRVAEVVSESLDGVWEKYLRDAGGFGNSGWRRPFITHF  377

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            TGCQPC+G  +  Y G  C  AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  378  TGCQPCTGKRDPAYKGNACWVAMEKALNFADNQVLRRYGFMHPDLGNGSSVSPVPFDFP  436



>emb|CAI11453.1| alpha-6-galactosyltransferase [Nicotiana benthamiana]
Length=443

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  LR TFKDK FPESDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV 
Sbjct  260  PEYKKWGKILRSTFKDKTFPESDDQSALSYVIMKGEEKWRSKIHAITDYSLHGYWLGIVD  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + DNIT  Y  I++     KLRRRHAE VSESYA   +  +   G  + GWRRPFITHFT
Sbjct  320  RFDNITGNYEKIDRDVP--KLRRRHAESVSESYAAAREPLVAEGGDWKGGWRRPFITHFT  377

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSGDH   Y G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  378  GCQPCSGDHVSEYVGDKCWVGMERALNFADNQVLRNFGFMHVDIKSNSPVTPVNFDFP  435



>gb|KHN20359.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=268

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 8/179 (4%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TL+ TFKDK+ P+SDDQ+ L YLI  E+ KW +KI++ES+YYF+GYW+EI  
Sbjct  96   PEYEKWGETLKSTFKDKVLPDSDDQTALAYLIAVEK-KWADKIFLESEYYFQGYWLEISK  154

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
               N+++ Y  +E+   G  LRRRHAEKVSESY    +E+L + G+    W+RPFITHFT
Sbjct  155  TYYNVSERYDEVERKVKG--LRRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFT  208

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GCQPC+G HN  Y    C ++M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  209  GCQPCNGHHNPAYDAMDCWNSMERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  266



>ref|XP_009761596.1| PREDICTED: glycosyltransferase 6-like [Nicotiana sylvestris]
Length=443

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 124/187 (66%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
             WA+  P    Y  WG  LR TFKDK FPESDDQS L Y+I+K +EKW  KI+  +DY  
Sbjct  251  VWANMGPKSREYKQWGKILRTTFKDKTFPESDDQSALSYIIMKGEEKWRRKIHAITDYSL  310

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW+ IV + DNIT  Y+ I++     KLRRRHAE VSESYA   +  +      + GW
Sbjct  311  HGYWLGIVDRFDNITGNYVKIDRDVP--KLRRRHAEAVSESYAAAREPLVAEGSDWKGGW  368

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPFITHFTGCQPCSGDH   Y G+ C   M +ALNFADNQVLRN+GFMH D+   + V 
Sbjct  369  RRPFITHFTGCQPCSGDHAAEYVGDKCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVS  428

Query  178  PLPYDFP  158
            P+ +DFP
Sbjct  429  PVNFDFP  435



>emb|CAD98924.1| galactomannan galactosyltransferase [Lotus japonicus]
Length=437

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 125/180 (69%), Gaps = 7/180 (4%)
 Frame = -3

Query  697  SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEI  518
            S P Y  WG  L  TFKDK+ P+SDDQ+ L YLI   ++KW  KIY+E DYYFEGYWVE+
Sbjct  263  SSPDYKKWGEKLMATFKDKVIPDSDDQTALAYLIAMGEDKWTEKIYLEKDYYFEGYWVEL  322

Query  517  VGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
                +N++  Y  +E+   G  LRRRHAEKVSE Y E  +EH++  GQ    WRRPFITH
Sbjct  323  AKMYENVSVRYDEVERRVGG--LRRRHAEKVSERYGEMREEHVKYFGQ----WRRPFITH  376

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPC+G HN  Y+ + C + M +ALNFADNQVLR YG++ R L D A V P+PYD+P
Sbjct  377  FTGCQPCNGHHNPAYAADDCWNGMDRALNFADNQVLRTYGYVRRSLNDKA-VTPIPYDYP  435



>ref|XP_002513422.1| transferase, putative [Ricinus communis]
 gb|EEF48825.1| transferase, putative [Ricinus communis]
Length=424

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 5/173 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG   R  FKDK+ PE+DDQ+ LIYL+LKE+EKWG+KIY+E +Y  + YW+++V 
Sbjct  255  PNYESWGQIQRSKFKDKMIPEADDQAALIYLLLKEKEKWGDKIYIEEEYDLQKYWLDVVD  314

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              DNIT  YL I++      LRRRHAEKVSE Y   W+++L+     +   RRP ITHFT
Sbjct  315  AYDNITRGYLEIKREVPS--LRRRHAEKVSEKYGASWEQYLKAKSSFQ---RRPLITHFT  369

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  173
            GC+PCSG+HN  YS ++C + M KALNFADNQVL NYGF+H++L+D++SV PL
Sbjct  370  GCEPCSGNHNPAYSWDSCFNGMRKALNFADNQVLLNYGFLHQNLVDSSSVSPL  422


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQDIP  633
            RNCQW+MDFMDVW SMGPQ P   S G+      + + IP
Sbjct  235  RNCQWSMDFMDVWVSMGPQTPNYESWGQIQRSKFKDKMIP  274



>ref|XP_010437192.1| PREDICTED: glycosyltransferase 6-like [Camelina sativa]
Length=429

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 130/180 (72%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG
Sbjct  249  PDYKKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVG  308

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THF
Sbjct  309  GFANVTERYLEMERQ--DDTLRRRHAEKVSERYGAFREERFLKGEFGGRDSRRRAFVTHF  366

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN +Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  367  TGCQPCSGDHNPIYHGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>ref|XP_010432039.1| PREDICTED: glycosyltransferase 6 [Camelina sativa]
Length=429

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 130/180 (72%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG
Sbjct  249  PDYKKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVG  308

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THF
Sbjct  309  GFANVTERYLEMER--QDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHF  366

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN +Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  367  TGCQPCSGDHNPIYHGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>gb|KDP25125.1| hypothetical protein JCGZ_22660 [Jatropha curcas]
Length=432

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 127/173 (73%), Gaps = 5/173 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG   R TFKDK+ PE+DDQ+ L+YL+LKE+EKWG+KIY+E DY  + YW+E V 
Sbjct  263  PNYDKWGQIQRSTFKDKMIPEADDQAALVYLLLKEKEKWGDKIYIEEDYDLQTYWLEAVQ  322

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              D IT  Y+ IE+  +   LRR+HAEKVSESY    +++++     R   +RP ITHFT
Sbjct  323  DYDKITQDYMEIERKVSS--LRRKHAEKVSESYGASREQYIKVKNNFR---KRPLITHFT  377

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  173
            GC+PC+G+HN +YS E C + + +ALNFADNQVL+NYGF+H++LLD +SV PL
Sbjct  378  GCEPCTGNHNPVYSWEDCLNGIQRALNFADNQVLQNYGFLHQNLLDFSSVSPL  430



>ref|XP_008806204.1| PREDICTED: galactomannan galactosyltransferase 1-like [Phoenix 
dactylifera]
Length=469

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 129/180 (72%), Gaps = 5/180 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  L+  FK K+F ESDDQS L++++++E++ W +KI++E  +YFEGYW+EI+G
Sbjct  291  PDYVQWGQRLKNEFKGKVFAESDDQSALVHILIRERDLWADKIFLEDSFYFEGYWLEIIG  350

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITH  338
            +L+ +++MYL +E+      LRRRHAEKV+  Y       L   G   G +GWRRPF+TH
Sbjct  351  RLEKMSEMYLALERNVP--PLRRRHAEKVAAVYGRMRDGELERQGAETGPAGWRRPFMTH  408

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSGDHN+ YSGE C   M +ALNFAD+QV+R YGF H + L++  V PLP+D+P
Sbjct  409  FTGCQPCSGDHNKKYSGENCYQGMLRALNFADDQVMRVYGFKHTE-LESYGVTPLPFDYP  467



>ref|XP_003525869.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=428

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 130/179 (73%), Gaps = 8/179 (4%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG TL+ TFKDK+ P+SDDQ+ L YLI  E  KW +KI++ES+YYF+GYW+EI  
Sbjct  256  PEYEKWGETLKSTFKDKVLPDSDDQTALAYLIAVEN-KWADKIFLESEYYFQGYWLEISK  314

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
               N+++ Y  +E+   G  LRRRHAEKVSESY    +E+L + G+    W+RPFITHFT
Sbjct  315  TYYNVSERYDEVERKVKG--LRRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFT  368

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GCQPC+G HN  Y    C ++M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  369  GCQPCNGHHNPAYDAMDCWNSMERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  426



>ref|XP_006411860.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
 gb|ESQ53313.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
Length=440

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 128/180 (71%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +VG
Sbjct  260  PDYAKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEGEYYLQGYWIGVVG  319

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
             L N+T+ YL +E+  A   LRRRHAEKVSE Y A + +  LR    GR   RR F+THF
Sbjct  320  GLANVTERYLEMERDDA--TLRRRHAEKVSERYGAFREERFLRGEFGGRGSRRRAFVTHF  377

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN +Y G+TC   M +ALNFADNQV+R YG++H DL  T+ + P+P+D+P+
Sbjct  378  TGCQPCSGDHNPIYDGDTCWKEMIRALNFADNQVMRTYGYVHSDLSKTSPLQPVPFDYPD  437



>ref|XP_009345079.1| PREDICTED: putative glycosyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 128/179 (72%), Gaps = 2/179 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  + WG   +   KDK +P SDDQS L+YL++KE+ +W  KIY+ES+YY  GYW+ IV 
Sbjct  265  PNPEKWGKIQKSLIKDKAYPGSDDQSALVYLLIKEKSRWAAKIYLESEYYLHGYWLGIVD  324

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  Y+ I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFT
Sbjct  325  GLDGISKGYMEIDREV--DLLRRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFT  382

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GC+PCSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  383  GCEPCSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_010028081.1| PREDICTED: putative glycosyltransferase 7 [Eucalyptus grandis]
 gb|KCW54740.1| hypothetical protein EUGRSUZ_I00693 [Eucalyptus grandis]
Length=460

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 130/178 (73%), Gaps = 8/178 (4%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG+ LR TF DK+FP+SDDQS LIYL+L +++++G+KIYVE++YYFEGYW  IVG
Sbjct  273  PEYERWGHVLRSTFADKLFPDSDDQSALIYLLLTQKDRYGDKIYVENEYYFEGYWEGIVG  332

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             L NIT  Y  +++      LRRRHAEK S  YA +  E      +       PF+THFT
Sbjct  333  TLPNITREYEDMDRQGP-PALRRRHAEKASRHYAARRAEAGAARKR-------PFVTHFT  384

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GCQPCSG+HN+MYSGE+C + M KALNFADNQVLR YG++  DL+D+A V P+P+D+P
Sbjct  385  GCQPCSGNHNQMYSGESCWNGMVKALNFADNQVLRRYGYVRPDLMDSAVVKPIPFDYP  442



>ref|XP_004294205.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  + WG   R   KDK++P SDDQS LIYL+LK+++KWG+K+Y+ESD  F+ YW+ +V 
Sbjct  259  PAQEKWGEIQRSMLKDKLYPGSDDQSALIYLLLKQKQKWGDKVYLESDN-FQSYWLGVVD  317

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LDNIT  Y  +++     KLRRRH EKVSE Y E  ++++++ G  R   RRPF+THFT
Sbjct  318  GLDNITKGYTEVDREMG--KLRRRHGEKVSELYGEMREQYMKDKGMWRENVRRPFVTHFT  375

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GC+PCSGD N  Y+ E C   M KALN+ADNQVLR YGF+H DLL+++ V PLP+D+P
Sbjct  376  GCEPCSGDCNPDYTWEDCWKGMQKALNYADNQVLRKYGFVHPDLLNSSLVTPLPFDYP  433



>ref|XP_010446636.1| PREDICTED: LOW QUALITY PROTEIN: glycosyltransferase 6 [Camelina 
sativa]
Length=428

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 132/180 (73%), Gaps = 4/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG  ++R+ KDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG
Sbjct  249  PDYKKWG-PIQRSXKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVG  307

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THF
Sbjct  308  GFANVTERYLEMER--QDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHF  365

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN +Y G+TC D M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  366  TGCQPCSGDHNPIYRGDTCWDEMIRALNFADNQVMRVYGYVHSDLSMTSPLQPLPFDYPN  425



>ref|NP_680773.1| glycosyltransferase 6 [Arabidopsis thaliana]
 sp|Q9SZG1.1|GT6_ARATH RecName: Full=Glycosyltransferase 6; Short=AtGT6 [Arabidopsis 
thaliana]
 emb|CAB38308.1| putative protein [Arabidopsis thaliana]
 emb|CAB80434.1| putative protein [Arabidopsis thaliana]
 gb|ABH04623.1| At4g37690 [Arabidopsis thaliana]
 gb|AEE86828.1| glycosyltransferase 6 [Arabidopsis thaliana]
 gb|AHL38658.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=432

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 127/180 (71%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YY +GYW+ + G
Sbjct  252  PDYKKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYLQGYWIGVFG  311

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR FITHF
Sbjct  312  DFANVTERYLEMER--EDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFITHF  369

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  370  TGCQPCSGDHNPSYDGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  429



>ref|XP_008363062.1| PREDICTED: glycosyltransferase 6-like [Malus domestica]
Length=442

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P   +WG   +   KDK +P SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV 
Sbjct  265  PDPKNWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVD  324

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  YL I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFT
Sbjct  325  GLDGISKGYLEIDREV--DLLRRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFT  382

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GC+PCSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  383  GCEPCSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>ref|XP_010939020.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Elaeis guineensis]
Length=470

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 128/180 (71%), Gaps = 5/180 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG+ L+  FKDK+F ESDDQS L++L+  E+++W +K+++E  +YFEGYW+EIVG
Sbjct  291  PEYEQWGHRLKNEFKDKLFVESDDQSALVHLLNAERDRWADKVFLEDAFYFEGYWIEIVG  350

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITH  338
            +  N+T+ YL +E+      LRRRHAEKV+  Y       L   G   G +GWRRPF+TH
Sbjct  351  RFGNMTEKYLAMERKVP--PLRRRHAEKVAGVYGRMRDGELEREGAETGPTGWRRPFMTH  408

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSGDHN+ YSGE C + M +ALNFAD+QV R+YGF H + L    V PLP+D+P
Sbjct  409  FTGCQPCSGDHNKKYSGENCYEGMLRALNFADDQVSRDYGFRHTE-LGGYDVKPLPFDYP  467



>ref|XP_008392336.1| PREDICTED: putative glycosyltransferase 7 [Malus domestica]
Length=442

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P   +WG   +   KDK +P SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV 
Sbjct  265  PDPKNWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVD  324

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  YL I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFT
Sbjct  325  GLDGISKGYLEIDREV--DLLRRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFT  382

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GC+PCSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  383  GCEPCSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>emb|CAI11454.1| alpha-6-galactosyltransferase [Medicago truncatula]
 gb|AES90738.2| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=438

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 126/180 (70%), Gaps = 7/180 (4%)
 Frame = -3

Query  697  SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEI  518
            + P Y+ WG  LR TFK K+ P+SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI
Sbjct  262  NSPEYEKWGERLRATFKTKVVPDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEI  321

Query  517  VGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
                D +   Y  IEK   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITH
Sbjct  322  SKMYDKMGKKYDEIEKRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITH  375

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPC+G HN MY+ + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  376  FTGCQPCNGHHNPMYAADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|NP_001281283.1| putative glycosyltransferase 7 [Malus domestica]
 gb|ADL36662.1| CAMTA domain class transcription factor [Malus domestica]
Length=442

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  + WG   +   KDK +P SDDQS LIYL++KE+ +W  KIY+ES+Y   GYW+ IV 
Sbjct  265  PNPEKWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKSRWAAKIYLESEYNLHGYWLGIVD  324

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  Y+ +++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFT
Sbjct  325  GLDGISKGYMEVDREV--DLLRRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFT  382

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GC+PCSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  383  GCEPCSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_008226081.1| PREDICTED: putative glycosyltransferase 7 [Prunus mume]
Length=439

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P ++ WG   +   KDK +P SDDQS LIYL++KE+++W +KIY+ES+Y   GYW+ IV 
Sbjct  263  PDHEKWGKAQKSLIKDKAYPGSDDQSALIYLLIKEKDRWADKIYLESEYNLHGYWLGIVD  322

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  Y+ I++    + LRRRHAEK+S  Y    ++H+++ G  +   RRPF+THFT
Sbjct  323  GLDKISKGYMEIDREV--DLLRRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFT  380

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GC+PCSG+HN MY+ E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  381  GCEPCSGEHNSMYTWEACWNGMQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  438



>ref|XP_003608541.1| Alpha-6-galactosyltransferase [Medicago truncatula]
Length=462

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 126/180 (70%), Gaps = 7/180 (4%)
 Frame = -3

Query  697  SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEI  518
            + P Y+ WG  LR TFK K+ P+SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI
Sbjct  262  NSPEYEKWGERLRATFKTKVVPDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEI  321

Query  517  VGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
                D +   Y  IEK   G  LRRRHAEKVSE Y E  +E+++N G      RRPFITH
Sbjct  322  SKMYDKMGKKYDEIEKRVEG--LRRRHAEKVSERYGEMREEYVKNLGD----MRRPFITH  375

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPC+G HN MY+ + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  376  FTGCQPCNGHHNPMYAADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|XP_007211970.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
 gb|EMJ13169.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
Length=402

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P ++ WG   +   KDK +P SDDQS LIYL++KE+++W ++IY+ES+Y   GYW+ IV 
Sbjct  226  PDHEKWGKAQKSLIKDKAYPGSDDQSALIYLLIKEKDRWADRIYLESEYNLHGYWLGIVD  285

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  Y+ I++    + LRRRHAEK+S  Y    ++H+++ G  +   RRPF+THFT
Sbjct  286  GLDKISKGYMEIDREV--DLLRRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFT  343

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            GC+PCSG+HN MY+ E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  344  GCEPCSGEHNSMYTWEACWNGMQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  401



>emb|CDY29577.1| BnaA03g54220D [Brassica napus]
Length=438

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG
Sbjct  257  PDYAKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVG  316

Query  511  KL-DNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITH  338
                N+T+ YL +E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+TH
Sbjct  317  GFFANVTERYLEMEREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTH  374

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P
Sbjct  375  FTGCQPCSGDHNPSYDGDTCWNEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYP  434

Query  157  N*T  149
            + T
Sbjct  435  DET  437



>ref|XP_009138524.1| PREDICTED: glycosyltransferase 6 [Brassica rapa]
Length=438

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG
Sbjct  257  PDYAKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVG  316

Query  511  KL-DNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITH  338
                N+T+ YL +E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+TH
Sbjct  317  GFFANVTERYLEMEREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTH  374

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P
Sbjct  375  FTGCQPCSGDHNPSYDGDTCWNEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYP  434

Query  157  N*T  149
            + T
Sbjct  435  DET  437



>ref|XP_009361779.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=442

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P   +WG   +   KDK +P SDDQS LIYL++KE+ KW +KIY+ES+Y   GYW+ IV 
Sbjct  265  PDPKNWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKAKWADKIYLESEYNLHGYWLGIVD  324

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
             LD I+  Y+ I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFT
Sbjct  325  GLDGISKGYMEIDREV--DLLRRRHAEKVSLFYGQMREKYMREKGIWRENKRRPFVTHFT  382

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            GC+PCSG+HN MY+ E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP+
Sbjct  383  GCEPCSGEHNGMYTWEACWNGMQKALNFADNQVLIRFGFLHPDLLNSSWVSPLPFDFPD  441



>gb|KFK30380.1| hypothetical protein AALP_AA7G253700 [Arabis alpina]
Length=439

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 127/180 (71%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K ++ + +KIY+E +YY +GYW+ +V 
Sbjct  259  PEYAKWGEIQRSVFKDKLFPESDDQTALIYLLYKHKDVYYDKIYLEGEYYLQGYWIGVVD  318

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+     +LRRRHAEKVSE Y A + +  L+    GR   RR F+THF
Sbjct  319  GFGNVTERYLEMEREDV--RLRRRHAEKVSEGYGAFREERFLKGEFGGRGSRRRAFVTHF  376

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN +Y G+ C + M +ALNF DNQV+R YG++H DL  T+ +VPLP+D+P+
Sbjct  377  TGCQPCSGDHNPIYDGDKCWNEMIRALNFGDNQVMRVYGYVHSDLSKTSPLVPLPFDYPD  436



>gb|EAY87343.1| hypothetical protein OsI_08746 [Oryza sativa Indica Group]
 gb|EAZ24444.1| hypothetical protein OsJ_08194 [Oryza sativa Japonica Group]
Length=422

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 128/194 (66%), Gaps = 9/194 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y HWG  L  TFKDK+F ESDDQS L+Y++L+    W +K+Y+ESDYYF
Sbjct  232  AWAAMGPDSPEYQHWGAVLTSTFKDKVFNESDDQSALVYMLLQSGSPWRDKVYLESDYYF  291

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGR  368
            EGYW+EI G+L NIT+ Y  +E+ AA   LRRRHAE       +  +        A  G 
Sbjct  292  EGYWLEIAGRLGNITERYEAMERGAA--PLRRRHAEAEHASYAAARDAALAGAGLAESGV  349

Query  367  SGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  188
            SGWRRPF+THFTGCQPCSG  NE Y+G++C + + +AL+FAD+QVLR YGF H   L  A
Sbjct  350  SGWRRPFVTHFTGCQPCSGHRNEHYTGKSCDEGIRRALSFADDQVLRAYGFRHAGPLSDA  409

Query  187  SVVPLPYDFPN*TS  146
             V PLP+D P  T+
Sbjct  410  -VSPLPFDHPTQTA  422



>emb|CDX72649.1| BnaC07g46710D [Brassica napus]
Length=438

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 4/183 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG
Sbjct  257  PDYAKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVG  316

Query  511  KL-DNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITH  338
                N+T+ YL +E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+TH
Sbjct  317  GFFANVTERYLEMEREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTH  374

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+ +P
Sbjct  375  FTGCQPCSGDHNPSYDGDTCWNEMIRALNFADNQVMRAYGYVHSDLSKTSPLQPLPFGYP  434

Query  157  N*T  149
            + T
Sbjct  435  DET  437



>emb|CAB52246.1| alpha galactosyltransferase [Trigonella foenum-graecum]
Length=438

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 126/180 (70%), Gaps = 7/180 (4%)
 Frame = -3

Query  697  SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEI  518
            + P Y+ WG  LR TFK K+  +SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI
Sbjct  262  NSPEYEKWGERLRETFKTKVVRDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWLEI  321

Query  517  VGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITH  338
                D + + Y  IEK   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITH
Sbjct  322  SKMYDKMGERYDEIEKRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITH  375

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPC+G HN +Y+ + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  376  FTGCQPCNGHHNPIYAADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|NP_001047970.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAD13026.1| putative alpha galactosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09884.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAG98296.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 125/185 (68%), Gaps = 6/185 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y HWG  L  TFKDK+F ESDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G
Sbjct  266  PEYQHWGAVLTSTFKDKVFNESDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAG  325

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFIT  341
            +L NIT+ Y  +E+ AA   LRRRHAE       +  +        A  G SGWRRPF+T
Sbjct  326  RLGNITERYEAMERGAA--PLRRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVT  383

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDF  161
            HFTGCQPCSG  NE Y+G++C + + +AL+FAD+QVLR YGF H   L  A V PLP+D 
Sbjct  384  HFTGCQPCSGHRNEHYTGKSCDEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDH  442

Query  160  PN*TS  146
            P  T+
Sbjct  443  PTQTA  447



>ref|XP_002868971.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45230.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=436

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 125/180 (69%), Gaps = 3/180 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +V 
Sbjct  256  PDYKKWGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEGEYYLQGYWIGVVD  315

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHF  335
               N+T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THF
Sbjct  316  GFANVTERYLEMER--EDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHF  373

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  155
            TGCQPCSGDHN  Y G+TC + + +ALNFADNQV+R YG +H DL  T+ + PLP+D+PN
Sbjct  374  TGCQPCSGDHNPSYDGDTCWNEIIRALNFADNQVMRVYGHVHSDLSKTSPLQPLPFDYPN  433



>ref|XP_009394626.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 127/182 (70%), Gaps = 6/182 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD WG  L    KDK+F  SDDQS L+YL+LK +++WG+K+++ESDY  E YWV IV 
Sbjct  249  PDYDRWGQVLAAELKDKLFNVSDDQSALVYLLLKHRDQWGDKVFLESDYDLEAYWVAIVD  308

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHL---RNAGQGRSGWRRPFIT  341
            +L+N+T  Y  +E+   G  LRRRHAE VS  Y    +E L     A  G +GW RPF+T
Sbjct  309  RLENMTAKYAEVERRVDG--LRRRHAEVVSGGYGRLREEQLATEEGAVSGPNGWHRPFMT  366

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDF  161
            HFTGCQPC+G HN+MY+ ++C + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+
Sbjct  367  HFTGCQPCNGAHNKMYTWKSCWEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDY  425

Query  160  PN  155
            P+
Sbjct  426  PS  427



>ref|XP_002454367.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
 gb|EES07343.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
Length=443

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 128/193 (66%), Gaps = 10/193 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQE---KWGNKIYVESD  548
            AWA      P Y  WG+ L+ TFKDK+F ESDDQS L+Y++L++++    W +K+++ESD
Sbjct  246  AWAAMGPDSPDYQRWGSVLKSTFKDKVFDESDDQSALVYMLLQKEKGSRPWRDKVFLESD  305

Query  547  YYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAG  377
            YYFEGYW EIVG+L N+T+ Y  +E+      LRRRHAE+      +  +        A 
Sbjct  306  YYFEGYWAEIVGRLGNMTERYEAMERRPGAAALRRRHAEREHAEYAAARDAALAGAGLAE  365

Query  376  QGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
             G  GWRRPF+THFTGCQPCSG  NE YSG++C   M +ALNFAD+QVLR YGF H   L
Sbjct  366  TGVHGWRRPFVTHFTGCQPCSGQRNEHYSGDSCDQGMRRALNFADDQVLRAYGFRHAGPL  425

Query  196  DTASVVPLPYDFP  158
             +  V PLP+D+P
Sbjct  426  -SDDVEPLPFDYP  437



>ref|NP_001068066.1| Os11g0546500 [Oryza sativa Japonica Group]
 gb|ABA94224.1| Glycosyltransferase 6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28429.1| Os11g0546500 [Oryza sativa Japonica Group]
Length=483

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 132/194 (68%), Gaps = 11/194 (6%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P Y  WG+ L  T + K   ESDDQS L+YL+ + +EKWG K Y+E  Y+F
Sbjct  288  AWARMGPASPEYARWGSVLHDTLRGKSDKESDDQSALVYLLSEHEEKWGAKTYLEKGYFF  347

Query  538  EGYWVEIVGKLDNITDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG--  371
            +GYWVE+V +LD+I   Y   E+  +AA   LRRRHAE+  E YA      +R A  G  
Sbjct  348  QGYWVEVVDRLDDIAARYEAAERRPSAAAAHLRRRHAEREHERYAAARNAAVRGAVPGPA  407

Query  370  ---RSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
               +SGWRRPF+THFTGCQPC G+ N++YS ++CAD M++ALNFAD+QVLRNYG+ H+D 
Sbjct  408  GGGQSGWRRPFVTHFTGCQPCGGEPNKIYSKKSCADGMNRALNFADDQVLRNYGYRHKDP  467

Query  199  LDTASVVPLPYDFP  158
            L +  V PLP+D+P
Sbjct  468  L-SDEVRPLPFDYP  480



>gb|EAY81250.1| hypothetical protein OsI_36429 [Oryza sativa Indica Group]
Length=483

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 133/198 (67%), Gaps = 13/198 (7%)
 Frame = -3

Query  727  SWT-CGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVES  551
            SW   GPA     P Y  WG+ L  T + K   ESDDQS L+YL+ + +EKWG K Y+E 
Sbjct  288  SWARMGPA----SPEYARWGSVLHDTLRGKSDKESDDQSALVYLLSEHEEKWGAKTYLEK  343

Query  550  DYYFEGYWVEIVGKLDNITDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAG  377
             Y+F+GYWVE+V +LD+I   Y   E+  +AA   LRRRHAE+  E YA      +R A 
Sbjct  344  GYFFQGYWVEVVDRLDDIAARYEAAERRPSAAAAHLRRRHAEREHERYAAARNAAVRGAV  403

Query  376  QG-----RSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFM  212
             G     +SGWRRPF+THFTGCQPC G+ N++YS ++CAD M++ALNFAD+QVLRNYG+ 
Sbjct  404  PGPAGGGQSGWRRPFVTHFTGCQPCGGEPNKIYSKKSCADGMNRALNFADDQVLRNYGYR  463

Query  211  HRDLLDTASVVPLPYDFP  158
            H+D L +  V PLP+D+P
Sbjct  464  HKDPL-SDEVRPLPFDYP  480



>gb|ACF33173.1| putative galactomannan galactosyl transferase [Coffea canephora]
Length=447

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 125/190 (66%), Gaps = 11/190 (6%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y  W  TL  T  DK+FP +D+QS L+YL+L E++KWG+KIY+E+ Y  
Sbjct  250  AWARMSPRSPDYKFWSETLMSTLSDKMFPGADEQSSLVYLLLTEKKKWGDKIYLENQYDL  309

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN--AGQGRS  365
              YWV +VGKLD  T      EK      LRRR AE V ES  E W+++L N  A +G+ 
Sbjct  310  SSYWVGVVGKLDKFTRTEADAEKNLP--LLRRRRAEVVGESVGEVWEKYLENNTASEGK-  366

Query  364  GWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTAS  185
               RPFITHFTGCQPCSG+H+  Y G TC DAM + LN+ADNQVLRN GF+HRD+   + 
Sbjct  367  ---RPFITHFTGCQPCSGNHDPSYVGNTCWDAMERTLNYADNQVLRNLGFVHRDISRGSY  423

Query  184  VVPLPYDFPN  155
            V+PL +DFP+
Sbjct  424  VLPLAFDFPS  433



>emb|CDP02618.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 120/181 (66%), Gaps = 8/181 (4%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  W  TL  T  DK+FP +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VG
Sbjct  259  PDYKFWSETLMSTLSDKMFPGADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVG  318

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITH  338
            KLD  T      EK      LRRR AE VSES  E W+++L N  A +G+    RPFITH
Sbjct  319  KLDKFTRTEADAEKNLP--LLRRRRAEVVSESVGEVWEKYLENNTASEGK----RPFITH  372

Query  337  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            FTGCQPCSG H+  Y G TC DAM + LN+ADNQVLRN GF HRD+   + V PL +DFP
Sbjct  373  FTGCQPCSGSHDPSYVGNTCWDAMERTLNYADNQVLRNLGFAHRDISHGSYVSPLAFDFP  432

Query  157  N  155
            +
Sbjct  433  S  433



>ref|XP_006663513.1| PREDICTED: putative glycosyltransferase 7-like [Oryza brachyantha]
Length=332

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 129/194 (66%), Gaps = 11/194 (6%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P Y  WGN L  T + K   ESDDQS L+YL+ + +EKWG+K  +E  YYF
Sbjct  137  AWARMGPASPEYAKWGNVLHDTLQGKSDHESDDQSALVYLLSEHEEKWGSKTILELGYYF  196

Query  538  EGYWVEIVGKLDNITDMYLGIEKT--AAGEKLRRRHAEKVSESYAEKWKEHLRNA-----  380
            +GYWVEIV +LD I   Y   E+   AA + LRRRHAE+    YAE     +R+A     
Sbjct  197  QGYWVEIVDRLDGIAARYESAERRPGAAAKALRRRHAEREHLRYAEARNAAMRSAIPGPA  256

Query  379  GQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            G G++GWRRP +THFTG QPC G  N++YS ++CAD M++ALNFAD+QVLR YGF H+D 
Sbjct  257  GGGQTGWRRPVMTHFTGGQPCGGKPNKIYSKKSCADGMNRALNFADDQVLRAYGFRHKDP  316

Query  199  LDTASVVPLPYDFP  158
            L +  V PLP+D+P
Sbjct  317  L-SDEVRPLPFDYP  329



>ref|XP_009362594.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=422

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 122/173 (71%), Gaps = 8/173 (5%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P +++WG  L   FKDK FP  DDQS LIYL+  ++E+WG K Y+E +YY E YW+ +VG
Sbjct  258  PDFENWGRILTSVFKDKPFPLPDDQSALIYLLFTDEERWGKKTYLEWEYYLEAYWIGVVG  317

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K DN T+ Y   E+  +G  LRRRHAEKV+E Y  K + +++    GR   RRPF+THFT
Sbjct  318  KYDNFTESYAETERNDSG--LRRRHAEKVNEWYGAKRETYIK----GRV--RRPFVTHFT  369

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  173
            GCQPCSG+HN  Y+G++C D M++ALNFADNQVLRNYGF+H DL  +   V L
Sbjct  370  GCQPCSGEHNPQYTGDSCWDEMNRALNFADNQVLRNYGFVHPDLSSSTVSVLL  422



>sp|Q564G7.1|GMGT1_CYATE RecName: Full=Galactomannan galactosyltransferase 1 [Cyamopsis 
tetragonoloba]
 emb|CAI79402.1| galactomannan galactosyltransferase [Cyamopsis tetragonoloba]
Length=435

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 125/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKE-QEKWGNKIYVESDYYFEGYWVEIV  515
            P Y+ WG  LR TFKDK+ P+SDDQ+ L YLI  + ++ W  KI++ES+YYFEGYW+EIV
Sbjct  264  PEYEKWGERLRETFKDKVLPDSDDQTALAYLIATDNKDTWREKIFLESEYYFEGYWLEIV  323

Query  514  GKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHF  335
               +NI++ Y  +E+   G  LRRRHAEKVSE Y    +E+L++        RRPFITHF
Sbjct  324  KTYENISERYDEVERKVEG--LRRRHAEKVSEKYGAMREEYLKDNK------RRPFITHF  375

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  158
            TGCQPC+G HN  Y+   C + M +ALNFADNQ+LR YG+  ++LLD  SV PLP+ +P
Sbjct  376  TGCQPCNGHHNPAYNANDCWNGMERALNFADNQILRTYGYHRQNLLD-KSVSPLPFGYP  433



>ref|XP_010679659.1| PREDICTED: putative glycosyltransferase 7 [Beta vulgaris subsp. 
vulgaris]
Length=431

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ WG+ L+  F DK++PESDDQ+G+ YL++KE E W +KIY+E DYYFEGYWVEIVG
Sbjct  261  PDYEKWGDILKSVFTDKLYPESDDQTGIAYLMVKEGENWKDKIYLEKDYYFEGYWVEIVG  320

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +N+T  Y  IEK       RRRHAEK  E Y  +W+ +L    +     +RPFITHFT
Sbjct  321  NYENVTAHYSKIEKKERRL--RRRHAEKAGEDYRAQWEYNLERENEKLM--KRPFITHFT  376

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  173
            GC+PCSG HNEMY+ E+C   M+KALNFADNQVLRN+G+   +L +++ V PL
Sbjct  377  GCEPCSGKHNEMYNLESCFKGMNKALNFADNQVLRNFGYFRPNLDNSSWVQPL  429



>dbj|BAK05879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 122/192 (64%), Gaps = 9/192 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y+ WG  L  TF+DK+F ESDDQS L+Y++      W  K+++E+ YYF
Sbjct  231  AWAAMGPDSPDYERWGAVLTSTFRDKLFNESDDQSALVYMLQHRGSPWREKVFLENGYYF  290

Query  538  EGYWVEIVGKLDNITDMYLGIEKTA-AGEKLRRRHAEK-VSESYAEK---WKEHLRNAGQ  374
            +GYWVEIVG+L  I   Y  IE+ A A   LRRRHA     E YA+           A  
Sbjct  291  QGYWVEIVGRLGGIAARYEAIERRAPAVALLRRRHAASWEHEGYAQAREAALAGAGLAES  350

Query  373  GRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
            G  GWRRPF+THFTGCQPCSG+ N  YSG++C D M +ALNFAD+QVLR+YGF H   L 
Sbjct  351  GVKGWRRPFVTHFTGCQPCSGNRNRDYSGDSCDDGMRRALNFADDQVLRDYGFRHAGPL-  409

Query  193  TASVVPLPYDFP  158
            +  V PLP+D+P
Sbjct  410  SDDVRPLPFDYP  421



>ref|XP_007208181.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
 gb|EMJ09380.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
Length=366

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 117/164 (71%), Gaps = 8/164 (5%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P ++ WG  L   FKDK+F  SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VG
Sbjct  202  PDFERWGQILTSVFKDKLFSVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVG  261

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K D + + Y+ +E+      LRRRHAEKV++ YA + +++L    QG    RRPF+THFT
Sbjct  262  KYDTLAESYIKMERNEG--VLRRRHAEKVNDWYAAEREKYL----QGHE--RRPFVTHFT  313

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GCQPCSG+HN  YS ++C + M +ALN+ADNQVL+NYGF+H +L
Sbjct  314  GCQPCSGEHNPQYSADSCWNEMKRALNYADNQVLKNYGFVHPEL  357



>tpg|DAA64594.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase, 
partial [Pinus taeda]
Length=173

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 11/175 (6%)
 Frame = -3

Query  658  RTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLG  479
            +   D+ F  SDDQS L+YL+LKE++KW ++I++E  YY  GYW++IVG  +NIT+ Y  
Sbjct  1    KVLYDRAFNSSDDQSALVYLLLKEKDKWADRIFIEHKYYLNGYWLDIVGTYENITEKYEA  60

Query  478  IEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHFTGCQP  320
            +EK      L +RHAEK++  YAE  + H+R+     S         RRPF+THFTGCQP
Sbjct  61   MEK--ENPMLNKRHAEKMNRDYAEMREHHMRDNKNFYSDNDDIMVRRRRPFVTHFTGCQP  118

Query  319  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFP  158
            CSGDHN++Y GE C   M +ALNFAD+QVL+NYGF H D L ++ V P+  + FP
Sbjct  119  CSGDHNKIYKGENCWKGMERALNFADDQVLKNYGFRH-DNLQSSHVNPIQSFYFP  172



>ref|XP_008238162.1| PREDICTED: glycosyltransferase 6-like [Prunus mume]
Length=417

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 121/172 (70%), Gaps = 9/172 (5%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P ++ WG  L   FKDK+F  SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VG
Sbjct  253  PDFERWGQILTSVFKDKLFSVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVG  312

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K D +T  Y+ +E+      LRRRHAEKV++ Y  + +++L    QGR   RRPF+THFT
Sbjct  313  KYDTLTASYIKMERNEG--VLRRRHAEKVNDWYDAEREKYL----QGRE--RRPFVTHFT  364

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  179
            GCQPCSG+HN  YS ++C + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  365  GCQPCSGEHNPQYSADSCWNEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  416



>ref|XP_003608540.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES90737.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=422

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 12/187 (6%)
 Frame = -3

Query  709  AWAHSXP---PYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
             WA   P    Y  WG  L   FKDK FP  DDQS LIYL+ +++ KWG K ++E  Y  
Sbjct  243  VWAQMGPLTSNYAKWGKILTSIFKDKPFPLPDDQSSLIYLLSRQRRKWGAKTFLEEGYDL  302

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+  +GKL+ I + Y  IEK A    LRRRH+EKVS  Y E  + +L+ +       
Sbjct  303  EGYWIATMGKLEGIQNKYDEIEKKA--RVLRRRHSEKVSVWYGEMREPYLKWSE------  354

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPF+ HFTGCQPCSGDHN  Y G+ C   M +ALNFADNQVLRNYGF+ ++L+ T+SV 
Sbjct  355  RRPFVKHFTGCQPCSGDHNPSYKGDVCWKEMERALNFADNQVLRNYGFVRKNLM-TSSVY  413

Query  178  PLPYDFP  158
             +P+ +P
Sbjct  414  EVPFGYP  420



>ref|XP_004953741.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=429

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 120/190 (63%), Gaps = 7/190 (4%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y  WG  L+ TFKDK+F ESDDQS L+Y++L+    W  K+++ESDYYF
Sbjct  237  AWAAMGPDSPDYRRWGTVLKSTFKDKVFDESDDQSALVYMLLQSGSPWREKVFLESDYYF  296

Query  538  EGYWVEIVGKLDNITDMYLGIEK---TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGR  368
            EGYW+EIVG+L N+T+ Y  +E+   +AA  + R         +           A  G 
Sbjct  297  EGYWLEIVGRLGNVTERYEAMERRPGSAALRRRRAEAEHVAHAAARNAALAGAGLAEAGV  356

Query  367  SGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  188
             GWRRPF+THFTGCQPCSG  NE YSG +C + M +ALNFAD+QVLR YGF H   L + 
Sbjct  357  RGWRRPFVTHFTGCQPCSGHRNEHYSGASCDEGMRRALNFADDQVLRAYGFRHAGPL-SD  415

Query  187  SVVPLPYDFP  158
             V PLP+D+P
Sbjct  416  DVQPLPFDYP  425



>gb|AFW64907.1| glycosyltransferase 6 [Zea mays]
Length=479

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 125/202 (62%), Gaps = 19/202 (9%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILK--EQEKWGNKIYVESDY  545
            AWA    + P Y  WG TLR   + K   ESDDQS L+YL+ +  E+E+W N  ++ES Y
Sbjct  276  AWARMGPASPEYARWGKTLREELEGKPNDESDDQSALVYLLSRHLERERWANATFLESGY  335

Query  544  YFEGYWVEIVGKLDNITDMYLGIEKTAAGEK--LRRRHAEKVSESYAEKWKEHLRN----  383
            YF+GYW EIV +LD +   Y  +E+  AG +  LRRRHAE+    YA   ++ +R     
Sbjct  336  YFQGYWAEIVDRLDGVATRYEAVERGRAGGRAGLRRRHAEREHLLYAAARRQAVRQQRGT  395

Query  382  -------AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRN  224
                    G G+ GWRRPF+THFTGCQPC G  N MY+   CA+ + +AL FAD+QVLR+
Sbjct  396  GGGVPGPDGGGQKGWRRPFVTHFTGCQPCGGAPNRMYTRRRCAEGIRRALAFADDQVLRS  455

Query  223  YGFMHRDLLDTASVVPLPYDFP  158
            YGF H   L + SV PLP+D+P
Sbjct  456  YGFRHAAPL-SDSVTPLPFDYP  476



>ref|NP_001152534.1| glycosyltransferase 6 [Zea mays]
 gb|ACG48084.1| glycosyltransferase 6 [Zea mays]
Length=473

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 124/202 (61%), Gaps = 19/202 (9%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILK--EQEKWGNKIYVESDY  545
            AWA    + P Y  WG TLR   + K   ESDDQS L+YL+ +  E+E+W N  ++ES Y
Sbjct  270  AWARMGPASPEYARWGKTLREELEGKPNDESDDQSALVYLLSRHLERERWANATFLESGY  329

Query  544  YFEGYWVEIVGKLDNITDMYLGIEKTAAGEK--LRRRHAEKVSESYAEKWKEHLRN----  383
            YF+G W EIV +LD +   Y  +E+  AG +  LRRRHAE+    YA   +E +R     
Sbjct  330  YFQGXWAEIVDRLDGVATRYEAVERGRAGGRAGLRRRHAEREHLLYAAARREXVRQQRGT  389

Query  382  -------AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRN  224
                    G G+ GWRRPF+THFTGCQPC G  N MY+   CA+ + +AL FAD+QVLR+
Sbjct  390  GGGVPGPDGGGQKGWRRPFVTHFTGCQPCGGAPNRMYTRRRCAEGIRRALAFADDQVLRS  449

Query  223  YGFMHRDLLDTASVVPLPYDFP  158
            YGF H   L + SV PLP+D+P
Sbjct  450  YGFRHAAPL-SDSVTPLPFDYP  470



>ref|XP_002449648.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
 gb|EES08636.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
Length=449

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 123/204 (60%), Gaps = 33/204 (16%)
 Frame = -3

Query  721  TCGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYY  542
            + GPA     P Y  WG TLR T   K   +SDDQS L YL+L  +E+WG+K Y+  DYY
Sbjct  256  SMGPA----SPEYARWGKTLRDTLSKKSDDQSDDQSALAYLLLMNRERWGDKTYLGIDYY  311

Query  541  FEGYWVEIVGKLDNITDMYLGIEKTAAGE-KLRRRHAEKVSESYAEKWKEHLRNA-----  380
            F+GY+ EIVGKLD I   Y+ +E+   GE  LRRRHAE+          EHLR A     
Sbjct  312  FQGYFAEIVGKLDAIAARYVAVERK--GEPALRRRHAER----------EHLRYAAARNA  359

Query  379  ----------GQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVL  230
                      G G+SGWRRPF+THFTGC PC G  N++YS E C D M +AL FAD+QVL
Sbjct  360  AVRAVVPGPDGGGQSGWRRPFVTHFTGCNPCGGKRNKIYSREICEDGMRRALGFADDQVL  419

Query  229  RNYGFMHRDLLDTASVVPLPYDFP  158
            R YGF H   L+  +V  LP+D+P
Sbjct  420  RAYGFRHAAPLND-TVRVLPFDYP  442



>ref|XP_008363070.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like, partial [Malus domestica]
Length=383

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 120/191 (63%), Gaps = 13/191 (7%)
 Frame = -3

Query  733  WISWTCGPAWAHSXPPYDHW-GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYV  557
            WI  T GP      P Y+ W  N+L    K K    SDDQ GLIYL++ +QE W NK YV
Sbjct  200  WI--TMGP----QTPDYERWMQNSL---IKGKQISNSDDQXGLIYLLITQQEGWANKTYV  250

Query  556  ESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG  377
            E DYY  GYW+ IV  LD IT  Y+ IE+    + LRRRHAEKVS+ Y     +H+++ G
Sbjct  251  EGDYYQHGYWL-IVDGLDTITKRYMEIEREV--DMLRRRHAEKVSQFYGTMRDQHVKDKG  307

Query  376  QGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
                  RRPF THFT CQPC+G H+  Y+ E C + M + LNFADNQVLR + F+H DLL
Sbjct  308  YWXDDLRRPFTTHFTXCQPCNGQHSSAYTWEACWNGMQRGLNFADNQVLRRFAFVHPDLL  367

Query  196  DTASVVPLPYD  164
            +++ V PLP+D
Sbjct  368  NSSFVSPLPFD  378



>ref|XP_003570475.1| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=417

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 117/187 (63%), Gaps = 10/187 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P Y  WG  L +TFKDK F ESDDQS L+YL+ ++   W  K+++E +YYF
Sbjct  235  AWAAMGPDSPDYQRWGALLTKTFKDKAFNESDDQSALVYLLQQDGSPWRQKVFLEHEYYF  294

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            EGYW+EIV +L NI+     +E+ AA E  +RR   +      +      R A     GW
Sbjct  295  EGYWLEIVPRLGNISKRCEAMERQAAPEMRKRRAEREARRGRGD------RAAASRVEGW  348

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVV  179
            RRPF+THFTGCQPCSG  NE YSGE+C + M +ALNFAD+QVLR YGF H   L +  V 
Sbjct  349  RRPFVTHFTGCQPCSGHRNEDYSGESCDEGMRRALNFADDQVLRAYGFRHAGPL-SDDVT  407

Query  178  PLPYDFP  158
            PLP+ +P
Sbjct  408  PLPFGYP  414



>ref|XP_003575986.2| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=479

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 120/203 (59%), Gaps = 15/203 (7%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P YD WG  L    K K   +SDDQS L+YL++K + KWG K Y++ DY+F
Sbjct  279  AWAAMSPTSPDYDEWGKILMDNLKWKSSNDSDDQSALVYLLMKNRRKWGRKTYLDHDYFF  338

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAA----GEKLRRRHAEKVSESYAEKWKEHLRN----  383
            +GYW EIV +LD +   YL  E+ AA       LRRRHAE     YA      +      
Sbjct  339  QGYWAEIVDRLDGVAVRYLAAERRAARPGTSALLRRRHAEAEHALYAAARNAVVGRAVPG  398

Query  382  -AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHR  206
             AG G++GWRRPFITHF GCQPC G  N ++   +CA+ + +ALNFAD+QVLR YGF H 
Sbjct  399  PAGGGQTGWRRPFITHFAGCQPCGGTPNVIFPNGSCAEGVRRALNFADDQVLRAYGFRHA  458

Query  205  DLLDTASVVPLPYDFPN*TSPIR  137
              L    V PLP+ +P   SP R
Sbjct  459  GPLSDV-VQPLPFGYPR--SPAR  478



>gb|ADE76992.1| unknown [Picea sitchensis]
Length=477

 Score =   174 bits (441),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 122/187 (65%), Gaps = 11/187 (6%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y   G  L +   D+ F  SDDQS L+YL++KE++KW ++IY+E  YY  GYWV+IVG
Sbjct  294  PLYISSGKLLSKVLSDRAFNASDDQSALVYLLIKEKDKWADRIYIEHSYYLNGYWVDIVG  353

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRR  353
              +NIT+ Y  +EK      L +RHAEK++  YAE  + ++R+     S         RR
Sbjct  354  TYENITEKYEAMEKE--NPMLNKRHAEKMNRDYAEMREHYIRSDKNFYSDNDDIMVRRRR  411

Query  352  PFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  173
            PF+THFTGCQPCSGDHN++Y GE C   M +ALNFAD+QVL++YGF H D L ++ V P+
Sbjct  412  PFVTHFTGCQPCSGDHNKIYKGENCWKGMERALNFADDQVLKHYGFRH-DNLQSSHVNPI  470

Query  172  -PYDFPN  155
              + FP+
Sbjct  471  QSFYFPS  477


 Score = 42.7 bits (99),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNC+W+M+FM+ W++MGPQ P   S GK
Sbjct  274  RNCEWSMEFMERWSAMGPQSPLYISSGK  301



>gb|EMS46901.1| Galactomannan galactosyltransferase 1 [Triticum urartu]
Length=316

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 107/180 (59%), Gaps = 14/180 (8%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P Y  WG TL+ T  DK   ESDDQS L YL+LK  +KWG + Y+E+ YYF
Sbjct  125  AWASMGPASPQYARWGKTLKATLSDKPDAESDDQSALAYLLLKNPKKWGARTYLENQYYF  184

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAE----------KVSESYAEKWKEHL  389
            +GYW EIV KLD + + Y   E+   G  LRRRHAE            +    +      
Sbjct  185  QGYWAEIVDKLDGVAERYRAAERR-FGPALRRRHAEGEHALYAAARNAALRKKDGGVPGP  243

Query  388  RNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  209
               GQ  S WRRPF+THFTGC PC G  NE+YS E+CA+ M +ALN AD+QVLR YGF H
Sbjct  244  DGGGQKASAWRRPFVTHFTGCNPCGGRANEIYSNESCAEGMRRALNLADDQVLRAYGFRH  303



>ref|XP_008679453.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64905.1| hypothetical protein ZEAMMB73_022035 [Zea mays]
Length=441

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 116/203 (57%), Gaps = 31/203 (15%)
 Frame = -3

Query  721  TCGPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYY  542
            + GPA     P Y  WG TLR T   K   +SDDQS L YL+L  +E+WG K Y+  DYY
Sbjct  248  SMGPA----SPEYARWGKTLRDTLSKKFDDQSDDQSALAYLLLTNRERWGKKTYLGIDYY  303

Query  541  FEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNA------  380
            F+GY+ EIV KLD +   Y   E+      LRRRHAE+          EHLR A      
Sbjct  304  FQGYFAEIVDKLDGVAARYEAAERKG-DPALRRRHAER----------EHLRYAAARNAA  352

Query  379  ---------GQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLR  227
                     G G+SGWRRPF+THFTGC PC G  N +Y+ E C D M +AL FAD+QVLR
Sbjct  353  VRAVVPGPDGGGQSGWRRPFVTHFTGCNPCGGKRNSIYTREICEDGMRRALGFADDQVLR  412

Query  226  NYGFMHRDLLDTASVVPLPYDFP  158
             YGF H   L+  SV  LP+D+P
Sbjct  413  AYGFRHAAPLND-SVRALPFDYP  434



>ref|XP_004980585.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=312

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 114/191 (60%), Gaps = 10/191 (5%)
 Frame = -3

Query  715  GPAWAHSXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFE  536
            GPA+    P Y  WG  ++    D+    + DQS L YL++  +E+WG K Y+ +DYYF+
Sbjct  122  GPAY----PDYAAWGKKVKGALTDRDSDVACDQSALAYLLITGRERWGEKTYLGTDYYFQ  177

Query  535  GYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNA-----GQG  371
            GY+ EIVGKL  +   Y   E+ A    LRRRHAE+    YA      +R A     G G
Sbjct  178  GYFAEIVGKLAGVAARYKAAERGAGHAGLRRRHAEREHLRYAAARNAAVRAAVPGPDGGG  237

Query  370  RSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  191
            +SGWRRP ITHFTGC PC G  N MYS E C   M +AL FAD+QVLR YGF H   L+ 
Sbjct  238  QSGWRRPLITHFTGCNPCGGRRNPMYSRELCEGGMRRALGFADDQVLRAYGFRHAGPLND  297

Query  190  ASVVPLPYDFP  158
             +V+ LP+D+P
Sbjct  298  -TVLQLPFDYP  307



>gb|ABK25085.1| unknown [Picea sitchensis]
Length=479

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 4/176 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ +   L     D+   ESDDQS LIYL++KE++KW  KIY+E++Y+F+GYW++IVG
Sbjct  308  PLYEPFAKILSDVLPDRALTESDDQSALIYLMIKEKKKWAGKIYIENEYFFQGYWLDIVG  367

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NIT +Y  +E  A    LRRR+AEK +  YA K    L+    G    RRPF+THFT
Sbjct  368  SFENITKIYDAME--AKHPDLRRRYAEKSARLYAGKRDRSLKEIWAGILQ-RRPFVTHFT  424

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  164
            GCQPCSG+HN +Y  E C + M ++L+FAD+QVLR YGF  R  L +  V P+ ++
Sbjct  425  GCQPCSGNHNPIYKAEDCWNGMARSLDFADDQVLRIYGF-RRHQLQSVVVSPIHFN  479



>gb|AHC98115.1| putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus radiata]
Length=480

 Score =   167 bits (423),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P YD +   L     D+   ESDDQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG
Sbjct  308  PLYDSFAKILSDVLPDRPVTESDDQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVG  367

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NI+  Y  +E  A   +L RR+AEK +  YA K + +L+    G    RRPF+THF 
Sbjct  368  TFENISKRYEAME--AEHTELSRRYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFA  424

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPY  167
            GCQPCSG+HN +Y  E C + + ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  425  GCQPCSGNHNPIYKAEDCQNGLQRSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478


 Score = 42.7 bits (99),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNC+W+MDFM+ W+ MGP+ P   S  K
Sbjct  288  RNCEWSMDFMERWSVMGPESPLYDSFAK  315



>tpg|DAA64590.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus taeda]
Length=480

 Score =   165 bits (418),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y+ +   L     D+   ESDDQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG
Sbjct  308  PLYESFAKILSDVLPDRPVTESDDQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVG  367

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
              +NI+  Y  +E  A   +L RR+AEK +  YA K + +L+    G    RRPF+THF 
Sbjct  368  TFENISKRYEAME--AEHTELSRRYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFA  424

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPY  167
            GCQPCSG+HN +Y  E C + + ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  425  GCQPCSGNHNPIYKAEDCQNGLQRSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478


 Score = 43.5 bits (101),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNC+W+MDFM+ W+ MGP+ P   S  K
Sbjct  288  RNCEWSMDFMERWSVMGPESPLYESFAK  315



>ref|XP_008795673.1| PREDICTED: glycosyltransferase 6-like [Phoenix dactylifera]
Length=516

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 5/179 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  W   L      K   +SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G
Sbjct  340  PNYKKWTKLLHSEISGKDSGDSDDQSALVHLLVKDIKRWGNKVYLENSYDLHGYWEAIIG  399

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHL-RNAGQGRS--GWRRPFIT  341
            +LDNIT+ Y  +EK    ++LRRRHAEK +  +    + +L R  G G +    RRPF+T
Sbjct  400  RLDNITERYKRLEKKE--KELRRRHAEKDTVGFGGTREWYLDREVGMGPAERKKRRPFVT  457

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  164
            HFTGCQPCS  HN  Y+ E+C + MH+ALNFAD QVLR YGF   D+ + +SV PLP+D
Sbjct  458  HFTGCQPCSAGHNPAYTWESCYEGMHRALNFADGQVLRAYGFGRPDINNISSVQPLPFD  516



>ref|XP_008679454.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64906.1| hypothetical protein ZEAMMB73_279475 [Zea mays]
Length=458

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 115/192 (60%), Gaps = 12/192 (6%)
 Frame = -3

Query  706  WAHSXPPY--DH--WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            WA   P Y  DH  WG  LR T  DK    + DQS L+YL+L   E+ G K +VE++Y+F
Sbjct  263  WARMGPAYPEDHARWGEVLRATLSDKDSDVACDQSALVYLLLNNWERPGKKTFVETEYFF  322

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRS--  365
            +GYW E+V +LD +   Y  +E+ + G  LRRRHAE+    YA      LR    G +  
Sbjct  323  QGYWKEVVDRLDGVAARYEAVERRSPG--LRRRHAEQEHLRYAGARNAALRGVVPGPAGG  380

Query  364  ---GWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
               GWRRP ITHF GCQPCSG  N MYS E+C D M  AL FAD+QVLR YGF H   L+
Sbjct  381  GEVGWRRPLITHFVGCQPCSGGRNPMYSRESCDDGMRHALGFADDQVLRAYGFRHAAPLN  440

Query  193  TASVVPLPYDFP  158
              SV  LP+D+P
Sbjct  441  D-SVRGLPFDYP  451



>ref|XP_004980586.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=450

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 118/205 (58%), Gaps = 25/205 (12%)
 Frame = -3

Query  715  GPAWAHSXPPYDHWGNTLRRTFKDKIFPE-SDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            GPA+    P +  WG  +R    DK      DDQS L+YL+L   E+ G K ++E++Y+F
Sbjct  260  GPAY----PEHARWGKVVRDALADKGDDAWCDDQSALVYLLLHNWERLGKKAFIETEYFF  315

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG----  371
            +GYW+EIV +LD +   Y  +E+ A    LRRRHAE+    YA       RNA       
Sbjct  316  QGYWLEIVDRLDGVAARYEAVERRAPA--LRRRHAEREHLRYAAA-----RNAAVSGAVP  368

Query  370  ------RSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  209
                    GWRRP ITHF GCQPCSG  N MYS E+C D M + L FADNQVLR YGF H
Sbjct  369  GPAGGGEKGWRRPLITHFVGCQPCSGGRNPMYSRESCEDGMRRTLGFADNQVLRAYGFRH  428

Query  208  RDLLDTASVVPLPYDFPN*TSPIRQ  134
               L+  SV PLP+D+P   +P R+
Sbjct  429  AAPLND-SVRPLPFDYP--AAPARR  450



>ref|XP_004980588.1| PREDICTED: galactomannan galactosyltransferase 1-like, partial 
[Setaria italica]
Length=367

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 115/196 (59%), Gaps = 13/196 (7%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P Y  WG TLR   + K   ESDDQS L+YL+ K   +WGN+  +E+ YYF
Sbjct  169  AWARMGPAFPEYAAWGKTLREELEGKPNDESDDQSALVYLLSKHPARWGNRTLLETGYYF  228

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRR--HAEKVSESYAEKWKEHLRN------  383
            +GYW EIV +LD +   Y  +E+   G     R  HAE+    YA      +        
Sbjct  229  QGYWAEIVDRLDGVAKRYEAVERGGRGGSSGLRRRHAEREHLRYAAARDAAVGRSGTVPG  288

Query  382  -AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHR  206
             AG G+ GWRRPF+THFTGCQPC G  +  Y+   CA+ + +AL FAD+QVLR YGF H 
Sbjct  289  PAGGGQKGWRRPFVTHFTGCQPCGGAPDRKYTRRRCAEGIRRALAFADDQVLRAYGFRHA  348

Query  205  DLLDTASVVPLPYDFP  158
              L + SVVPLP+D+P
Sbjct  349  APL-SDSVVPLPFDYP  363



>dbj|BAJ96459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 106/179 (59%), Gaps = 13/179 (7%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P Y  WG TL  T  DK   ESDDQS L YL+LK ++KWG + Y+E DYYF
Sbjct  286  AWASMGPASPDYARWGKTLMATLSDKPDAESDDQSALAYLLLKNRKKWGARTYLEHDYYF  345

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAE---------KVSESYAEKWKEHLR  386
            +GYW EIV KLD +        +   G  LRRRHAE         + +    +       
Sbjct  346  QGYWAEIVDKLDGVA-ARYRAAERRFGPALRRRHAEGEHALYAAARSAALRKKDGGVPGP  404

Query  385  NAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  209
            + G  R+ WRRPF+THFTGC PC G  NE+YS ETCAD M +ALN AD+QVLR YGF H
Sbjct  405  DGGGQRASWRRPFVTHFTGCNPCGGKPNEIYSNETCADGMRRALNLADDQVLRVYGFRH  463



>ref|XP_009406736.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 116/196 (59%), Gaps = 14/196 (7%)
 Frame = -3

Query  709  AWAHSXPPYDH---WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P   H   WG  L    + K+   +DDQS L++L+ KEQ +W +K+++ES Y  
Sbjct  286  AWASMGPQTPHHGKWGRILDAEIRGKLTSFADDQSALVHLLAKEQRRWRDKVHLESAYDL  345

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHL------RNAG  377
             GYW  IVG+L+++   Y  +E+  A   LRRRHAEK + SY E    +L          
Sbjct  346  HGYWEPIVGRLEDVAAAYAEMERRDA--VLRRRHAEKEAGSYGETRSRYLDAAAGGGGEK  403

Query  376  QGRSGW---RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHR  206
                 W   RR F+THFTGCQPC GDHN  Y+ + C D M +ALNFAD+QVLR YGF H 
Sbjct  404  GSGKRWPRKRRSFVTHFTGCQPCGGDHNPAYTWQGCVDGMARALNFADDQVLRAYGFGHT  463

Query  205  DLLDTASVVPLPYDFP  158
            +L D+AS+  LP+ +P
Sbjct  464  NLNDSASIRSLPFGYP  479



>gb|EMT11268.1| Putative glycosyltransferase 7 [Aegilops tauschii]
Length=265

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 103/180 (57%), Gaps = 14/180 (8%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA    + P Y  WG TL+ T  DK   ESDDQS L YL+LK  +KWG + Y+E +YYF
Sbjct  74   AWASMGPASPEYARWGKTLKATLSDKPDAESDDQSALAYLLLKNPKKWGARTYLEHEYYF  133

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAE----------KVSESYAEKWKEHL  389
            +GYW EIV +LD +        +   G  LRRRHAE            +           
Sbjct  134  QGYWAEIVDRLDGVA-ARYRAAERRFGPALRRRHAEGEHALYAAARNAALRKKAGGVPGP  192

Query  388  RNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  209
               GQ  S WRRPF+THFTGC PC G  NE+YS E+CA+ M +ALN AD+QVLR YGF H
Sbjct  193  DGGGQKASYWRRPFVTHFTGCNPCGGRPNEIYSNESCAEGMRRALNLADDQVLRAYGFPH  252



>ref|XP_002450906.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
 gb|EES09894.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
Length=443

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 120/200 (60%), Gaps = 17/200 (9%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILK--EQEKWGNKIYVESDY  545
            AWA    + P Y  WG TLR   + K   ESDDQS L+YL+ +  E+ +W N  ++ES Y
Sbjct  242  AWARMGPASPEYARWGKTLREELEGKPNDESDDQSALVYLLSRHPERARWSNATFLESGY  301

Query  544  YFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG--  371
            YF+GYW EIV +LD +   Y  +E+   G  LRRRHAE+    YA   +E +R       
Sbjct  302  YFQGYWAEIVDRLDGVAARYEAVERGGVGRGLRRRHAEREHLLYAAARREAVRRRDGSGG  361

Query  370  ---------RSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYG  218
                     + GWRRPF+THFTGCQPC G  N MY+ + CA+ + +AL FAD+QVLR YG
Sbjct  362  GVPGPDGGGQKGWRRPFVTHFTGCQPCGGAPNRMYTRKRCAEGIRRALAFADDQVLRAYG  421

Query  217  FMHRDLLDTASVVPLPYDFP  158
            F H   L + SV PLP+D+P
Sbjct  422  FRHAAPL-SDSVAPLPFDYP  440



>ref|XP_008784727.1| PREDICTED: putative glycosyltransferase 7 [Phoenix dactylifera]
Length=436

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 119/201 (59%), Gaps = 28/201 (14%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P    ++ WG  L    K K  PESDDQS L++L++ E+++WG+++Y+E+DY  
Sbjct  236  AWARMGPQTTEFEAWGRILASKIKGKAAPESDDQSALLHLLVYEKDRWGDRVYLENDYDL  295

Query  538  EGYWVEIVGKLDNITDMYLGI-------------EKTAAGEKLRRRHAEKVSESYAEKWK  398
             GYW  ++G+L+  T+ YL +             + T A  ++R R+ ++  E+ A++W+
Sbjct  296  HGYWAAVLGRLEKSTEDYLAMERREPPLRRRHAEKSTGAHGEMRGRYLDR--EAAADEWE  353

Query  397  EHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYG  218
            +  R         R PF+THFTGCQPC G HN  YS E+C  AM +AL+ AD+QVLR YG
Sbjct  354  QRRR---------RLPFVTHFTGCQPCGGGHNPAYSRESCLAAMQRALDLADDQVLRAYG  404

Query  217  FMHRDLLDTASVVPLPYDFPN  155
            F   D      V PLPYDFP+
Sbjct  405  FRRVDGCG-GHVRPLPYDFPS  424



>ref|XP_010943187.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=537

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 5/181 (3%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P Y  W   L      K   +SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G
Sbjct  354  PNYRKWTKILLSEISGKDSGDSDDQSALVHLLVKDTKRWGNKVYLENSYDLHGYWEAIMG  413

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFIT  341
            +LDNIT+     +     ++LRRRHAEK + ++ E    HL +    G      RRPF+T
Sbjct  414  RLDNITER--YKKLEKKEKELRRRHAEKDTVAFGETRLRHLDHEVGVGPQEKKKRRPFVT  471

Query  340  HFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDF  161
            HFTGCQPC G +N  Y+ E+C + MH+ALNFAD+QVLR YGF   D+ D +SV  LP+D+
Sbjct  472  HFTGCQPCGGGYNPTYTWESCYEGMHRALNFADDQVLRAYGFGRPDINDISSVQQLPFDY  531

Query  160  P  158
            P
Sbjct  532  P  532



>ref|XP_004980587.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=447

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 112/197 (57%), Gaps = 23/197 (12%)
 Frame = -3

Query  715  GPAWAHSXPPYDHWGNTLRRTFKDKIFPE-SDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            GPA+    P +  W   +  +  DK      DDQS L+YL+L   E+ G K ++E+DY+ 
Sbjct  259  GPAF----PEHGQWAKVVLSSLADKGNSTWFDDQSALVYLLLYNWERLGKKAFIETDYFL  314

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGR---  368
              YW+++V +LD +T  Y  +E+      LRRRHAE+    YA       RNA       
Sbjct  315  MAYWLDVVDRLDGVTARYEAVERRMPW--LRRRHAEREHMRYAAA-----RNAAVSGAVP  367

Query  367  -------SGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  209
                    GWRRP ITHF GCQPC+G+ N MYS E+C D M +AL FAD+QVLR YGF H
Sbjct  368  GPAGGGYKGWRRPLITHFVGCQPCNGERNPMYSRESCDDGMRRALGFADDQVLRAYGFRH  427

Query  208  RDLLDTASVVPLPYDFP  158
               L+  SV PLP+D+P
Sbjct  428  AAPLND-SVRPLPFDYP  443



>ref|XP_010919073.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=436

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 115/191 (60%), Gaps = 10/191 (5%)
 Frame = -3

Query  709  AWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA      P +  WG TL    K K  P++DDQS L++L++ E+++W +++Y+E+DY  
Sbjct  244  AWARMGPQTPEFQAWGRTLASEIKGKTTPDADDQSALLHLLVYEKDRWADRVYLENDYDL  303

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG----  371
             GYW  ++G+L+N T+ YL +E+     +  RRHAEK + ++ E     L     G    
Sbjct  304  HGYWAAVMGRLENSTEDYLAMERREPPLR--RRHAEKFTRAHGEMRGRCLDREVAGDEWE  361

Query  370  RSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  191
            R   RRPF+ HFTGCQPC G HN  Y+ E+C  A+ +AL+ AD+QVLR YGF  R     
Sbjct  362  RRRRRRPFVAHFTGCQPCGGGHNPAYTWESCFAAIQRALDLADDQVLRAYGF-GRVNGSG  420

Query  190  ASVVPLPYDFP  158
              V PLPYDFP
Sbjct  421  GYVRPLPYDFP  431



>emb|CBI25835.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  421  ESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFAD  242
            ESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY+GE+C ++M KALNFAD
Sbjct  149  ESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMYAGESCWNSMQKALNFAD  208

Query  241  NQVLRNYGFMHRDLLDTAS  185
            NQVLRN+GF+H DLLD+++
Sbjct  209  NQVLRNFGFVHPDLLDSST  227



>dbj|BAK06777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   102 bits (253),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  295  GKVLTKYLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  347

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  348  ----------------------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCS  379

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQVL  YGF H+ L
Sbjct  380  KFGD----YPVERCLKQMDRAFNFGDNQVLHMYGFEHKSL  415


 Score = 40.8 bits (94),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++D++D WA MGP+ P     GK
Sbjct  269  RNCQWSLDYLDTWAPMGPKGPVRIEAGK  296



>gb|EMT04084.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=451

 Score =   102 bits (253),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  295  GKVLTKYLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  347

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  348  ----------------------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCS  379

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQVL  YGF H+ L
Sbjct  380  KFGD----YPVERCLKQMDRAFNFGDNQVLHMYGFEHKSL  415


 Score = 40.8 bits (94),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++D++D WA MGP+ P     GK
Sbjct  269  RNCQWSLDYLDTWAPMGPKGPVRIEAGK  296



>ref|XP_009379786.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379787.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 84/164 (51%), Gaps = 37/164 (23%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  D  G  L  + K +   E+DDQS LIYL+L +Q+KWGNK+++E+ YY  GYW  +V 
Sbjct  310  PVRDEAGKILTASLKGRPAFEADDQSALIYLLLSQQDKWGNKVFIENSYYLHGYWAGLVD  369

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + + Y                                 + G G   W  PF+THF 
Sbjct  370  RYEEMMEKY---------------------------------HPGLGDERW--PFVTHFV  394

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GC+PC G + + Y  E C  +M +A NFADNQ+LR YGF HR L
Sbjct  395  GCKPC-GSYGD-YPVERCLGSMERAFNFADNQILRIYGFAHRGL  436



>gb|EAY89653.1| hypothetical protein OsI_11184 [Oryza sativa Indica Group]
Length=436

 Score =   100 bits (249),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  E+EKWG+K+Y+E+ YY  GYW  +V       
Sbjct  279  GKVLTKYLKDRPVFEADDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILV-------  331

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PC 
Sbjct  332  ----------------------------DRYEEMLENYHPGLGDHRWPLVTHFVGCKPCG  363

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  364  KFGD----YPVERCLKQMERAFNFGDNQILQMYGFTHKSL  399


 Score = 42.0 bits (97),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++DF+D WA MGP+ P     GK
Sbjct  253  RNCQWSLDFLDTWAPMGPKGPVRIEAGK  280



>ref|XP_006649941.1| PREDICTED: putative glycosyltransferase 2-like [Oryza brachyantha]
Length=448

 Score =   100 bits (249),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  E+EKWG+K+Y+E+ YY  GYW  +V       
Sbjct  291  GKVLTKFLKDRPVFEADDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILV-------  343

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PC 
Sbjct  344  ----------------------------DRYEEMLENYHPGLGDHRWPLVTHFVGCKPCG  375

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  376  KFGD----YPVERCLKQMERAFNFGDNQILQMYGFTHKSL  411


 Score = 42.0 bits (97),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++DF+D WA MGP+ P     GK
Sbjct  265  RNCQWSLDFLDTWAPMGPKGPVRIEAGK  292



>gb|ABF95475.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ43011.1| hypothetical protein OsJ_27597 [Oryza sativa Japonica Group]
Length=448

 Score =   100 bits (249),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  E+EKWG+K+Y+E+ YY  GYW  +V       
Sbjct  291  GKVLTKYLKDRPVFEADDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILV-------  343

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PC 
Sbjct  344  ----------------------------DRYEEMLENYHPGLGDHRWPLVTHFVGCKPCG  375

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  376  KFGD----YPVERCLKQMERAFNFGDNQILQMYGFTHKSL  411


 Score = 42.0 bits (97),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++DF+D WA MGP+ P     GK
Sbjct  265  RNCQWSLDFLDTWAPMGPKGPVRIEAGK  292



>gb|EMS58373.1| Putative glycosyltransferase 2 [Triticum urartu]
Length=378

 Score =   101 bits (252),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  222  GKVLTKYLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  274

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  275  ----------------------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCS  306

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQVL  YGF H+ L
Sbjct  307  KFGD----YPVERCLKQMDRAFNFGDNQVLHMYGFEHKSL  342


 Score = 40.4 bits (93),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++D++D WA MGP+ P     GK
Sbjct  196  RNCQWSLDYLDTWAPMGPKGPVRIEAGK  223



>ref|NP_001049853.1| Os03g0300000 [Oryza sativa Japonica Group]
 dbj|BAF11767.1| Os03g0300000, partial [Oryza sativa Japonica Group]
Length=348

 Score =   100 bits (249),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  E+EKWG+K+Y+E+ YY  GYW  +V       
Sbjct  191  GKVLTKYLKDRPVFEADDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILV-------  243

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PC 
Sbjct  244  ----------------------------DRYEEMLENYHPGLGDHRWPLVTHFVGCKPCG  275

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  276  KFGD----YPVERCLKQMERAFNFGDNQILQMYGFTHKSL  311


 Score = 41.6 bits (96),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++DF+D WA MGP+ P     GK
Sbjct  165  RNCQWSLDFLDTWAPMGPKGPVRIEAGK  192



>ref|XP_004987031.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=437

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 95/197 (48%), Gaps = 43/197 (22%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            GI +G +I   C        AWA      P  D +G  L +   D+   E+DDQS L+YL
Sbjct  245  GINAGSFIIRNCRWSLDLLDAWARMGPRGPVRDRYGKVLGKALSDRASYEADDQSALVYL  304

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ ++ +WG K ++ES Y   G+WVEIV       D Y         E++RRRH      
Sbjct  305  LVTQRGRWGGKTFLESSYSLHGFWVEIV-------DRY---------EEMRRRH-RTTPV  347

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADN  239
            +  E+W                P +THF GC+PC G +   Y    C   M +ALNFAD+
Sbjct  348  AGGERW----------------PLVTHFVGCKPCGGQYAS-YDAARCRHGMERALNFADD  390

Query  238  QVLRNYGFMHRDLLDTA  188
            Q+LR YGF H  L  TA
Sbjct  391  QILRLYGFEHESLNTTA  407



>ref|XP_001761988.1| predicted protein [Physcomitrella patens]
 gb|EDQ73092.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 87/173 (50%), Gaps = 37/173 (21%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L +   D+   E+DDQSGL+YL++ ++E+WG+K+Y+ES YYF
Sbjct  196  AWAPMSPKGKIRDDVGKFLSKALPDRGKGEADDQSGLVYLMITDRERWGSKVYLESSYYF  255

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYW  +  K +++   Y                                +    G   W
Sbjct  256  QGYWKVLTEKFEDMMAKY--------------------------------KPGIYGDDRW  283

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+THF GC+ C G  N  Y+ + C   M +A+NFADNQVL  YGF+H+ L
Sbjct  284  --PFVTHFCGCEFCCGAINPEYTVDRCLTQMERAVNFADNQVLERYGFIHKSL  334



>ref|XP_001759108.1| predicted protein [Physcomitrella patens]
 gb|EDQ76177.1| predicted protein [Physcomitrella patens]
Length=411

 Score = 98.2 bits (243),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 74/144 (51%), Gaps = 28/144 (19%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            E+DDQS L+YL+   +E+WG+K+++E  Y   GYWV +V + + +  M LG  +   G  
Sbjct  271  EADDQSALVYLLATNKERWGSKVFLEHSYCLHGYWVMLVERFEEL--MELG-SRGGGG--  325

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                                      G   +R PF+THF GC+PC  D    Y+ + C  
Sbjct  326  -----------------------IDSGTDYYRWPFVTHFVGCKPCGRDGTSHYATDRCLK  362

Query  271  AMHKALNFADNQVLRNYGFMHRDL  200
             M +A NFADNQ+L +YGF H+ L
Sbjct  363  HMERAFNFADNQILEHYGFQHQTL  386


 Score = 42.0 bits (97),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW++D ++VWA MGP+ P     GK    +L G+
Sbjct  231  RNCQWSLDLLEVWAQMGPKGPVRIEAGKLLTASLAGR  267



>ref|XP_009414141.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=441

 Score = 98.2 bits (243),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L    KD+   E+DDQS ++YL++ ++++WG+K+Y+ES YY  GYW  +V       
Sbjct  282  GKVLTAFLKDRPVFEADDQSAMVYLLVTQRDRWGDKVYLESAYYLHGYWGILV-------  334

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  335  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  366

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  367  KFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  402


 Score = 40.8 bits (94),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++D +DVWA MGP+  T    GK
Sbjct  256  RNCQWSLDLLDVWAPMGPKGKTRTEAGK  283



>ref|XP_009385087.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 83/164 (51%), Gaps = 37/164 (23%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  D  G  L    K +   E+DDQS LIYL+L +Q+KWG+K+Y+E+ YY  GYW  +V 
Sbjct  301  PIRDEAGKILTANLKGRPAFEADDQSALIYLLLSQQDKWGDKVYIENSYYLHGYWAGLVD  360

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            +                               Y E  ++H  + G G   W  PF+THF 
Sbjct  361  R-------------------------------YEEMMEKH--HPGLGDERW--PFVTHFV  385

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H  L
Sbjct  386  GCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLRMYGFAHGSL  427



>ref|XP_010907157.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=452

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 86/173 (50%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L +QE+WGNK+Y+E+ YY 
Sbjct  287  AWAPMGPKGPIREEAGRILTANLKGRPAFEADDQSALIYLLLSQQERWGNKVYIENSYYL  346

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V + + + + Y                                 + G G   W
Sbjct  347  HGFWAGLVERYEEMMEKY---------------------------------HPGLGDERW  373

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  374  --PFVTHFVGCKPC-GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  422



>ref|XP_001765298.1| predicted protein [Physcomitrella patens]
 gb|EDQ70026.1| predicted protein, partial [Physcomitrella patens]
Length=311

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 92/179 (51%), Gaps = 38/179 (21%)
 Frame = -3

Query  709  AWAHSXP---PYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L +   D+   E+DDQSGL+YL++ ++E+WG+K+++ES YYF
Sbjct  167  AWAPMSPRGKIRDGAGKFLTKALPDRGDSEADDQSGLVYLMVTDRERWGSKVFLESSYYF  226

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYW  +  K +++ + Y                                +    G   W
Sbjct  227  QGYWKVLTEKFEDMMEKY--------------------------------QPGKYGDDRW  254

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASV  182
              PF+THF GC+ C G  N  Y+ + C   M +A+NFADNQV+  YGF+H+ +L +A V
Sbjct  255  --PFVTHFCGCEFCCGAINPEYTVDRCLTQMERAVNFADNQVIGRYGFIHK-MLKSAEV  310



>ref|XP_010678459.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 84/162 (52%), Gaps = 37/162 (23%)
 Frame = -3

Query  682  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  503
            D  G  L    K +   E+DDQS LIYL++ ++EKW NK+YVE+ YY  G+W+ +V K  
Sbjct  278  DEAGKLLTANLKGRPAFEADDQSALIYLLISQKEKWMNKVYVENSYYLHGFWLGLVDKY-  336

Query  502  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  323
                                       E  AEK+     + G G   W  PF+THF GC+
Sbjct  337  ---------------------------EEMAEKY-----HPGLGDERW--PFVTHFVGCK  362

Query  322  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
            PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  363  PC-GSYGD-YPVEKCLKSMERAFNFADNQVLKLYGFRHRGLL  402



>ref|XP_001781241.1| predicted protein [Physcomitrella patens]
 gb|EDQ53939.1| predicted protein, partial [Physcomitrella patens]
Length=309

 Score =   102 bits (254),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 86/173 (50%), Gaps = 37/173 (21%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L +   D+   E+DDQSG++YL++ ++E+WG+KI++E+ YYF
Sbjct  166  AWAPMSPKGKIRDGAGEFLTKALPDRGKGEADDQSGIVYLMITDRERWGSKIFLENSYYF  225

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYW  +  K                             E    K+K  L     G   W
Sbjct  226  QGYWRVLTDKF----------------------------EEMMAKYKPGL----YGDDRW  253

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+THF GC+ C G  N  Y+ + C   M +A+NFADNQV+  YGF H+ L
Sbjct  254  --PFVTHFCGCEFCCGSINPEYTRDQCLVHMERAINFADNQVIGRYGFRHKSL  304


 Score = 34.7 bits (78),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQ  696
            RNCQW+MDF+  WA M P+
Sbjct  155  RNCQWSMDFLHAWAPMSPK  173



>ref|XP_002465379.1| hypothetical protein SORBIDRAFT_01g037540 [Sorghum bicolor]
 gb|EER92377.1| hypothetical protein SORBIDRAFT_01g037540 [Sorghum bicolor]
Length=446

 Score =   101 bits (252),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 84/169 (50%), Gaps = 34/169 (20%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  + +G  +  T  D+   E+ DQS L+YL++ E+ +WG+K ++ES Y   G+WV IV 
Sbjct  279  PVREMYGRVIAGTLSDRQPYEACDQSALVYLLVTERRRWGDKTFLESSYCLSGFWVYIVD  338

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKV-SESYAEKWKEHLRNAGQGRSGWRRPFITHF  335
            KL                E++RRR +     E   E+W                P  THF
Sbjct  339  KL----------------EEMRRRDSTTTPPEPGHERW----------------PLTTHF  366

Query  334  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  188
             GC+PC GD +  Y    C  +M +ALNF D+Q+L  YGF H+ L  TA
Sbjct  367  MGCKPCGGD-DSTYDAAWCRRSMERALNFGDDQILNLYGFEHKTLNTTA  414


 Score = 35.4 bits (80),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGK  669
            RNCQW++D +D  A MGP+ P     G+
Sbjct  259  RNCQWSLDLLDALARMGPRGPVREMYGR  286



>ref|NP_001049886.1| Os03g0305800 [Oryza sativa Japonica Group]
 gb|ABF95525.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11800.1| Os03g0305800 [Oryza sativa Japonica Group]
 gb|EAY89695.1| hypothetical protein OsI_11231 [Oryza sativa Indica Group]
 gb|EAZ26651.1| hypothetical protein OsJ_10555 [Oryza sativa Japonica Group]
 dbj|BAG97093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 99/199 (50%), Gaps = 45/199 (23%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G +I   C        AWA   PP    D +G     T  ++   E+DDQS L++L
Sbjct  281  GLNAGSFIIRNCQWSLDLLDAWAPMGPPGPVRDMYGKIFAETLTNRPPYEADDQSALVFL  340

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ ++ +WG K+++E+ Y   G+W +IV       D Y         E++RR        
Sbjct  341  LVTQRHRWGAKVFLENSYNLHGFWADIV-------DRY---------EEMRR--------  376

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADN  239
                +W    R+ G G   W  P ITHF GC+PC GD +  Y GE C   M +A NFAD+
Sbjct  377  ----QW----RHPGLGDDRW--PLITHFVGCKPCGGD-DASYDGERCRRGMDRAFNFADD  425

Query  238  QVLRNYGFMHRDLLDTASV  182
            Q+L  YGF H   LDT +V
Sbjct  426  QILELYGFAHES-LDTMAV  443



>ref|XP_009420521.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 82/164 (50%), Gaps = 37/164 (23%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  D  G  L    + +   E+DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V 
Sbjct  298  PIRDEAGKILTANLQGRPAFEADDQSALIYLVLSQQDRWGDKIYIENSYYLHGYWAGLVD  357

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + D                              K H    G G   W  PF+THF 
Sbjct  358  RYEEMMD------------------------------KHH---PGLGDERW--PFVTHFV  382

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H  L
Sbjct  383  GCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLRMYGFAHGKL  424



>ref|XP_006399253.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
 gb|ESQ40706.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
Length=454

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++EKW  K+YVE+ YY 
Sbjct  283  AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYL  342

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K + + D Y                                 + G G   W
Sbjct  343  HGFWEGLVDKYEEMIDKY---------------------------------HPGLGDERW  369

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y+ E C  +M +A NFADNQVLR YGF HR LL
Sbjct  370  --PFVTHFVGCKPC-GSYAD-YAVERCLKSMERAYNFADNQVLRLYGFGHRGLL  419



>ref|XP_009393375.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393376.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 86/173 (50%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +Q++WG+KIY+E+ YY 
Sbjct  299  AWAPMGPKGPIRDEAGKMLTANLKGRPAFEADDQSALIYLLLSQQDRWGDKIYIENSYYL  358

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  359  HGYWAGLVDRYEEMMEKY---------------------------------HPGLGDERW  385

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+THF GC+PC G + + Y  + C  +M +A NFADNQVLR YGF H +L
Sbjct  386  --PFVTHFVGCKPC-GSYGD-YPVKRCLRSMERAFNFADNQVLRMYGFAHGNL  434



>ref|XP_010912249.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=451

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 83/164 (51%), Gaps = 37/164 (23%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL+L +Q++WG+K+Y+E+ Y+  G+W  +V 
Sbjct  294  PIREEAGRILTANLKGRPAFEADDQSALIYLLLSQQDRWGDKVYIENSYFLHGFWTGLVD  353

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + D Y                                 + G G   W  PF+THF 
Sbjct  354  RYEEMIDKY---------------------------------HPGLGDERW--PFVTHFV  378

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GC+PC G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  379  GCKPC-GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  420



>ref|XP_011075649.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=443

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 89/174 (51%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            +WA   P     D  G  L    K +   E+DDQS LIYL++  +++W +K+++E+ YY 
Sbjct  272  SWAPMGPKGRVRDEAGKILTANLKGRPTFEADDQSALIYLLISRKDEWMDKVFLENSYYL  331

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYWV +V       D Y                     E Y E++     + G G   W
Sbjct  332  HGYWVGLV-------DRY---------------------EEYIERY-----HPGLGDERW  358

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G  +  YS E C  +M KA NFADNQ+L++YGF HR LL
Sbjct  359  --PFVTHFVGCKPCGGYGD--YSLERCLQSMEKAFNFADNQLLKSYGFSHRGLL  408



>ref|NP_001047014.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAD25434.1| putative galactomannan galactosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF08928.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73308.1| hypothetical protein OsI_07488 [Oryza sativa Indica Group]
 gb|EEE57116.1| hypothetical protein OsJ_06989 [Oryza sativa Japonica Group]
Length=480

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L ++EKW NK+++E+ YY 
Sbjct  313  AWAPMGPKGFIRDEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMNKVFIENSYYL  372

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  373  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  397

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  398  RWPFVTHFVGCKPC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFAHKGL  448



>ref|XP_008783986.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
5 [Phoenix dactylifera]
Length=452

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 83/164 (51%), Gaps = 37/164 (23%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL+L +Q++WG+++Y+E+ YY  G+W  +V 
Sbjct  295  PIREEAGRILTANLKGRPAFEADDQSALIYLLLSQQDRWGDRVYIENSYYLHGFWTGLVE  354

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + D Y                                 + G G   W  PF+THF 
Sbjct  355  RYEEMMDKY---------------------------------HPGLGDERW--PFVTHFV  379

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GC+PC G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  380  GCKPC-GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  421



>gb|ACN27080.1| unknown [Zea mays]
Length=228

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY 
Sbjct  61   AWAPMGPKGFIRDQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYL  120

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  121  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  145

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  146  RWPFVTHFVGCKPC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  196



>ref|XP_004952632.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=475

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ YY 
Sbjct  308  AWAPMGPKGFIRDQAGKVLTANLKGRPAFEADDQSALIYLLLSQKEKWMDKVFIENSYYL  367

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  368  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  392

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  393  RWPFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVLRLYGFSHKGL  443



>ref|XP_008453679.1| PREDICTED: putative glycosyltransferase 3 [Cucumis melo]
Length=190

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W +K+++E+ YY 
Sbjct  17   AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYL  76

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V K + + + Y                                 + G G   W
Sbjct  77   HGYWAGLVDKYEEMIEKY---------------------------------HPGLGDERW  103

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  104  --PFVTHFVGCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  153



>ref|XP_004977544.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=453

 Score = 94.0 bits (232),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 73/145 (50%), Gaps = 37/145 (26%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            E+DDQS LI+L+L +++KW  K+ +E+++Y  G+W  +V +                   
Sbjct  315  EADDQSALIHLLLIQKDKWMEKVQIETEFYLHGFWTGLVDR-------------------  355

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                        Y +  +EH  + G G   W  PFITHF GC+ C     E Y  E C  
Sbjct  356  ------------YEQMMEEH--HPGLGDDRW--PFITHFVGCKTCG--RYEDYPLERCLR  397

Query  271  AMHKALNFADNQVLRNYGFMHRDLL  197
             M +A NFADNQVLR YGF HR L+
Sbjct  398  GMERAFNFADNQVLRLYGFQHRSLV  422


 Score = 40.8 bits (94),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW++D +D W  MGP+ P+    GK    +L G+
Sbjct  275  RNCQWSLDLLDAWVPMGPRGPSRVEAGKLLTASLSGR  311



>ref|XP_008788330.1| PREDICTED: putative glycosyltransferase 5 [Phoenix dactylifera]
Length=454

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 86/173 (50%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L +Q++WG+K+Y+E+ YY 
Sbjct  288  AWAPMGPKGPIREEAGRILTANLKGRPAFEADDQSALIYLLLSQQDRWGDKVYIENSYYL  347

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V + + + + Y                                 + G G   W
Sbjct  348  HGFWAGLVERYEEMMEKY---------------------------------HPGLGDERW  374

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  375  --PFVTHFVGCKPC-GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  423



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL++ ++E+W NK+++E+ YY 
Sbjct  284  AWAPMGPKGPIRDEAGKILTANLKGRPAFEADDQSALIYLLMSKKEEWMNKVFIENSYYL  343

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  344  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  370

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  371  --PFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVLKLYGFRHRGLL  420



>gb|EMT32015.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=170

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 83/168 (49%), Gaps = 36/168 (21%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  + +G        ++   E+DDQS L+YL+  E+ +WG+K+++ES Y+  G+W EIVG
Sbjct  6    PVRERYGRVFAEALSNRAAWEADDQSALVYLLATERGRWGDKVFLESSYHLHGFWEEIVG  65

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            +                 E++R R            W+      G G   W  P +THF 
Sbjct  66   RY----------------EEMRSR------------WR-----PGLGDHRW--PLVTHFV  90

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  188
            GC+PC G+    Y    C + M +ALNFAD+Q+L  YGF H  L  TA
Sbjct  91   GCKPC-GEPGATYEAAACREGMERALNFADDQILGLYGFQHESLGTTA  137



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL++ ++E+W NK+++E+ YY 
Sbjct  284  AWAPMGPKGPIRDEAGKILTANLKGRPAFEADDQSALIYLLMSKKEEWMNKVFIENSYYL  343

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  344  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  370

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  371  --PFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVLKLYGFRHRGLL  420



>ref|XP_008453680.1| PREDICTED: putative glycosyltransferase 3 [Cucumis melo]
Length=197

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W +K+++E+ YY 
Sbjct  24   AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYL  83

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  84   HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  110

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  111  --PFVTHFVGCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  160



>gb|KHN43518.1| Xyloglucan 6-xylosyltransferase [Glycine soja]
Length=430

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 89/195 (46%), Gaps = 50/195 (26%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA   P     D  G  L R  KD+   E+DDQS ++YL
Sbjct  240  GLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGKVLTRELKDRPVFEADDQSAMVYL  299

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            + KE+EKWG K+Y+E+ YY  GYW  +V                                
Sbjct  300  LAKEREKWGGKVYLENGYYLHGYWGILV--------------------------------  327

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFA  245
               ++++E + N   G    R P +THF GC+PC   GD    Y  E C   M +A NF 
Sbjct  328  ---DRYEEMIENYHPGFGDHRWPLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFG  380

Query  244  DNQVLRNYGFMHRDL  200
            DNQ+L  YGF H+ L
Sbjct  381  DNQILHIYGFTHKSL  395



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 37/167 (22%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  D  G  L    K +   E+DDQS LIY++L +++KW +K+YVE+ YY  G+W  +V 
Sbjct  297  PIRDEAGKVLTAYLKGRPAFEADDQSALIYILLSQKDKWIDKVYVENQYYLHGFWEGLVD  356

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K + + + Y                                 + G G   W  PF+THF 
Sbjct  357  KYEEMVEKY---------------------------------HPGLGDERW--PFVTHFV  381

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  191
            GC+PC G + + Y+ + C  +M +A NFADNQVL+ YGF HR LL T
Sbjct  382  GCKPC-GSYAD-YAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLST  426



>ref|XP_006838788.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
 gb|ERN01357.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
Length=439

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 81/160 (51%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L RT + +   E+DDQS ++YL++ ++EKWG+K+Y+ES YY  GYW  +V       
Sbjct  283  GKLLTRTLRGRPEFEADDQSAMVYLLITQREKWGDKVYLESAYYLHGYWGILV-------  335

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  336  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  367

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    YS E C   M +A NF DNQ+L+ YGFMH+ L
Sbjct  368  KFGD----YSVEKCLKQMDRAFNFGDNQILQMYGFMHKSL  403



>ref|XP_010030248.1| PREDICTED: putative glycosyltransferase 5 [Eucalyptus grandis]
 gb|KCW83656.1| hypothetical protein EUGRSUZ_B00540 [Eucalyptus grandis]
Length=449

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 87/174 (50%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL++ +++KW +K++VE+ YY 
Sbjct  280  AWAPMGPKGPIRDEAGKILTANLKGRPAFEADDQSALIYLLISQKDKWMDKVFVENSYYL  339

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW+ +V + + + + Y                                 + G G   W
Sbjct  340  HGYWLGLVERYEEMIEKY---------------------------------HPGLGDERW  366

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  367  --PFVTHFVGCKPC-GSYGD-YPVEKCLGSMERAFNFADNQVLKLYGFRHRGLL  416



>gb|KFK25153.1| hypothetical protein AALP_AA8G072800 [Arabis alpina]
Length=454

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++EKW  K+YVE+ YY 
Sbjct  286  AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYL  345

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K + + + Y                                 + G G   W
Sbjct  346  HGFWEGLVDKYEEMIEKY---------------------------------HPGLGDERW  372

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PFITHF GC+PC G + + Y+ E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  373  --PFITHFVGCKPC-GSYAD-YAVERCLKSMERAFNFADNQVLKLYGFGHRGLL  422



>gb|KHN48702.1| Putative glycosyltransferase 3 [Glycine soja]
Length=251

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 37/165 (22%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V 
Sbjct  89   PVREEAGKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVD  148

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + + Y                                 + G G   W  PF+THF 
Sbjct  149  RYEEMIEKY---------------------------------HPGLGDERW--PFVTHFV  173

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
            GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  174  GCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  216



>emb|CDX85826.1| BnaC06g23080D [Brassica napus]
 emb|CDX68187.1| BnaA07g22270D [Brassica napus]
Length=223

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 88/191 (46%), Gaps = 47/191 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++ W  K++VE+ YY 
Sbjct  52   AWAPMGPKGPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYL  111

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K + + + Y                                 + G G   W
Sbjct  112  HGFWEGLVDKYEEMMEKY---------------------------------HPGLGDERW  138

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-----  194
              PF+THF GC+PC    +  Y+ E C  +M +A NFADNQVL+ YGF HR LL      
Sbjct  139  --PFVTHFVGCKPCGSYAD--YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKR  194

Query  193  --TASVVPLPY  167
                +V PL +
Sbjct  195  IRNETVTPLEF  205



>ref|XP_002980080.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 ref|XP_002987476.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ11563.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ18950.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
Length=343

 Score = 97.4 bits (241),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 74/144 (51%), Gaps = 35/144 (24%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            ESDDQ   IYL+  ++  WG+++Y+E+ YY  GYW ++V                     
Sbjct  219  ESDDQGAFIYLLNADRAAWGSRVYLENAYYLNGYWKDLV---------------------  257

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                          E+++E  +N+  G    R PF+THFTGCQ CSG  N +Y+ E C  
Sbjct  258  --------------ERYEEFAKNSHPGFGDDRWPFVTHFTGCQICSGKINNVYTPEECRR  303

Query  271  AMHKALNFADNQVLRNYGFMHRDL  200
             M +AL FADNQ+L+  G++H  L
Sbjct  304  QMDRALFFADNQILQGIGYVHPSL  327


 Score = 35.8 bits (81),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW MD +D WA MG +      +GK     L G+
Sbjct  178  RNCQWTMDLLDTWAPMGFRGIVADRIGKVLTLALSGR  214



>ref|XP_010098280.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
 gb|EXB74784.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
Length=463

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 90/195 (46%), Gaps = 50/195 (26%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA   P     D  G  L R  K +   E+DDQS ++YL
Sbjct  266  GLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRDEAGKILTRELKGRPVFEADDQSAMVYL  325

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++KE++KWG K+Y+ES YY  GYW  +V + + + D Y                      
Sbjct  326  LMKERDKWGEKVYLESAYYLHGYWGILVDRYEEMIDNY----------------------  363

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFA  245
                       + G G   W  P +THF GC+PC   GD    Y  E C   M +A NF 
Sbjct  364  -----------HPGLGDHRW--PLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFG  406

Query  244  DNQVLRNYGFMHRDL  200
            DNQ+L+ YGF H+ L
Sbjct  407  DNQILQMYGFTHKSL  421



>ref|XP_008660215.1| PREDICTED: xyloglucan 6-xylosyltransferase-like isoform X1 [Zea 
mays]
 ref|XP_008660216.1| PREDICTED: xyloglucan 6-xylosyltransferase-like isoform X2 [Zea 
mays]
Length=440

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 94/198 (47%), Gaps = 46/198 (23%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXP--PYDH-WGNTLRRTFKDKIFPESDDQSGLIYL  599
            GI +G +I   C        AWA   P  P  + +G  L +   D+   E+DDQS L+YL
Sbjct  246  GINAGSFIIRNCQWSLDLLDAWARMGPRGPVRYEYGKVLGKALSDRPSYEADDQSALVYL  305

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ ++ +WG+K ++ES Y   G+W+ IV                                
Sbjct  306  LVTQRLRWGDKTFLESSYSLHGFWLGIV--------------------------------  333

Query  418  SYAEKWKEHLRNAGQGRSGWRR-PFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFAD  242
               ++++E  R+A   R G  R P +THF GC+PC G +   Y    C   M +ALNFAD
Sbjct  334  ---DRYEEMQRDASTPRDGGERWPLVTHFVGCKPCGGQYAS-YEASRCRTGMERALNFAD  389

Query  241  NQVLRNYGFMHRDLLDTA  188
            +Q+LR YGF H  L  TA
Sbjct  390  DQILRLYGFEHESLNTTA  407



>ref|XP_010497538.1| PREDICTED: putative glycosyltransferase 5, partial [Camelina 
sativa]
Length=182

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 88/191 (46%), Gaps = 47/191 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++ W  K++VE+ YY 
Sbjct  22   AWAPMGPKGPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYL  81

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V + + + + Y                                 + G G   W
Sbjct  82   HGFWEGLVDRYEEMVEKY---------------------------------HPGLGDERW  108

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-----  194
              PF+THF GC+PC    +  Y+ E C  +M +A NFADNQVL+ YGF HR LL      
Sbjct  109  --PFVTHFVGCKPCGSYAD--YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKR  164

Query  193  --TASVVPLPY  167
                +V PL +
Sbjct  165  IRNETVTPLEF  175



>ref|XP_010943718.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=453

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 83/164 (51%), Gaps = 37/164 (23%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL++ +Q++W +K+Y+E+ Y+  G+WV +V 
Sbjct  296  PVREEAGRILTANLKGRPAFEADDQSALIYLLISQQDRWSDKVYIENSYFLHGFWVGLVD  355

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K + + D                              K H    G G   W  PF+THF 
Sbjct  356  KYEEMMD------------------------------KHH---PGLGDERW--PFVTHFV  380

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            GC+PC G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  381  GCKPC-GSYGD-YPVERCLGSMERAFNFADNQVLRLYGFGHRGL  422



>ref|XP_004980167.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=460

 Score = 92.4 bits (228),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 73/145 (50%), Gaps = 37/145 (26%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            E+DDQS LI+L+L +++KW  K+ +E+++Y  G+W  +V +                   
Sbjct  322  EADDQSVLIHLLLIQKDKWMEKVQIETEFYLHGFWTGLVDR-------------------  362

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                        Y +  +EH  + G G   W  PFITHF GC+ C     E Y  E C  
Sbjct  363  ------------YEQMMEEH--HPGLGDDRW--PFITHFVGCKTCG--RYEDYPLERCLR  404

Query  271  AMHKALNFADNQVLRNYGFMHRDLL  197
             M +A NFADNQVLR YGF HR L+
Sbjct  405  GMERAFNFADNQVLRLYGFQHRSLV  429


 Score = 40.4 bits (93),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW++D +D W  MGP+ P+    GK    +L G+
Sbjct  282  RNCQWSLDLLDAWVPMGPRGPSRIEAGKLLTASLSGR  318



>gb|AFW88602.1| hypothetical protein ZEAMMB73_854435 [Zea mays]
Length=418

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 94/198 (47%), Gaps = 46/198 (23%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXP--PYDH-WGNTLRRTFKDKIFPESDDQSGLIYL  599
            GI +G +I   C        AWA   P  P  + +G  L +   D+   E+DDQS L+YL
Sbjct  224  GINAGSFIIRNCQWSLDLLDAWARMGPRGPVRYEYGKVLGKALSDRPSYEADDQSALVYL  283

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ ++ +WG+K ++ES Y   G+W+ IV                                
Sbjct  284  LVTQRLRWGDKTFLESSYSLHGFWLGIV--------------------------------  311

Query  418  SYAEKWKEHLRNAGQGRSGWRR-PFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFAD  242
               ++++E  R+A   R G  R P +THF GC+PC G +   Y    C   M +ALNFAD
Sbjct  312  ---DRYEEMQRDASTPRDGGERWPLVTHFVGCKPCGGQYAS-YEASRCRTGMERALNFAD  367

Query  241  NQVLRNYGFMHRDLLDTA  188
            +Q+LR YGF H  L  TA
Sbjct  368  DQILRLYGFEHESLNTTA  385



>gb|KEH31956.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=448

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 37/165 (22%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ YY  GYW  +V 
Sbjct  286  PVREEAGKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSYYLHGYWAGLVD  345

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + + Y                                 + G G   W  PF+THF 
Sbjct  346  RYEEMIEKY---------------------------------HPGLGDERW--PFVTHFV  370

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
            GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  371  GCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  413



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 84/165 (51%), Gaps = 37/165 (22%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  D  G  L    K +   E+DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V 
Sbjct  297  PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVD  356

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            K + + + Y                                 + G G   W  PF+THF 
Sbjct  357  KYEEMVEKY---------------------------------HPGLGDERW--PFVTHFV  381

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
            GC+PC G + + Y+ + C  +M +A NFADNQVL+ YGF HR LL
Sbjct  382  GCKPC-GSYAD-YAVDRCFKSMERAFNFADNQVLKLYGFSHRGLL  424



>ref|XP_002990216.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 ref|XP_002992472.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ06410.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ08776.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
Length=455

 Score =   103 bits (258),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 77/153 (50%), Gaps = 36/153 (24%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            ESDDQ   IYL+  ++  WG+K+Y+E+ Y+  GYW +IV K                   
Sbjct  329  ESDDQGAFIYLLNADRNTWGSKVYLENSYFLNGYWKDIVDKY------------------  370

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                      E Y E       + G G   W  PF+THFTGCQ CSG  N +Y+ E C  
Sbjct  371  ----------EGYVES-----SHPGFGDDRW--PFVTHFTGCQICSGKINNVYTAEECTA  413

Query  271  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  173
             M +AL  ADNQVL +YG+ H  L  TA +VP+
Sbjct  414  QMSRALTLADNQVLHSYGYAHPSLA-TAEIVPV  445


 Score = 28.9 bits (63),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 18/37 (49%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW +D  D  A MG +      +GK     L G+
Sbjct  288  RNCQWTLDLFDTLAPMGYRGVVGDRVGKVLTMALSGR  324



>ref|XP_001767288.1| predicted protein [Physcomitrella patens]
 gb|EDQ67969.1| predicted protein [Physcomitrella patens]
Length=347

 Score = 97.1 bits (240),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 83/173 (48%), Gaps = 37/173 (21%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L     D+   E+DDQS ++YL++ ++++WG+KI++ES +YF
Sbjct  180  AWAPMSPKGKIRDGAGEFLTLALPDRGKSEADDQSAIVYLMVTDRKRWGSKIFLESSFYF  239

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
            +GYW  + G+ + +   Y                                +    G   W
Sbjct  240  QGYWRHLSGRFEEMMAKY--------------------------------KPGLYGDDRW  267

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+TH+ GC+ CSG  N  Y+ + C   M + +NFADNQ++  YG  H+ L
Sbjct  268  --PFVTHYCGCEFCSGSINPEYTRDQCLMHMERGINFADNQIIERYGLRHKSL  318


 Score = 35.4 bits (80),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQ  696
            RNCQW+MDF+  WA M P+
Sbjct  169  RNCQWSMDFLHAWAPMSPK  187



>dbj|BAK00169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 86/175 (49%), Gaps = 40/175 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L  +   +   E+DDQS LI+L+L E+E+W  K+YVE++YY 
Sbjct  275  AWAPMGPKGRVREAAGKVLTASLTGRPAFEADDQSALIHLLLTEKERWMEKVYVENEYYL  334

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K                               Y E  ++H  + G G   W
Sbjct  335  HGFWAGLVDK-------------------------------YEEMMEKH--HPGLGDERW  361

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
              PFITHF GC+PC G + + Y  E C   M +A NFADNQVLR YGF HR L +
Sbjct  362  --PFITHFVGCKPC-GSYGD-YPVEQCLTGMERAFNFADNQVLRLYGFRHRSLTN  412



>ref|XP_006647332.1| PREDICTED: putative glycosyltransferase 5-like [Oryza brachyantha]
Length=481

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            +WA   P     D  G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ YY 
Sbjct  314  SWAPMGPKGFIRDEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMDKVFIENSYYL  373

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  374  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  398

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  399  RWPFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVLRLYGFAHKGL  449



>ref|XP_010040898.1| PREDICTED: xyloglucan 6-xylosyltransferase 2, partial [Eucalyptus 
grandis]
Length=179

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 82/175 (47%), Gaps = 44/175 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L R  KD+   E+DDQS ++YL+  +++KWG K+Y+ES YY 
Sbjct  7    AWAPMGPKGKIREDAGKILTRELKDRPVFEADDQSAMVYLLATQRDKWGEKVYLESAYYL  66

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V                                   ++++E + N   G    
Sbjct  67   HGYWGILV-----------------------------------DRYEEMIENYHPGLGDH  91

Query  358  RRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R P +THF GC+PC   GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  92   RWPLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  142



>ref|XP_011047184.1| PREDICTED: putative glycosyltransferase 5 [Populus euphratica]
Length=453

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 91/191 (48%), Gaps = 47/191 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W +K+Y+E+ YY 
Sbjct  282  AWAPMGPKGAIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYL  341

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  342  HGYWAGLVDRYEEMMEKY---------------------------------HPGLGDERW  368

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-----  194
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL      
Sbjct  369  --PFVTHFVGCKPC-GSYGD-YPVEQCMRSMERAFNFADNQVLKLYGFGHRGLLSPKIKR  424

Query  193  --TASVVPLPY  167
                +V PL Y
Sbjct  425  IRNETVTPLEY  435



>ref|XP_002453927.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
 gb|EES06903.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
Length=480

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY 
Sbjct  313  AWAPMGPKGFIRDQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYL  372

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  373  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  397

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  398  RWPFVTHFVGCKPC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  448



>gb|AFW71661.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY 
Sbjct  311  AWAPMGPKGFIRDQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYL  370

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  371  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  395

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  396  RWPFVTHFVGCKPC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  446



>ref|XP_003554517.1| PREDICTED: putative glycosyltransferase 2-like [Glycine max]
Length=455

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 89/195 (46%), Gaps = 50/195 (26%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA   P     D  G  L R  KD+   E+DDQS ++YL
Sbjct  265  GLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGKVLTRELKDRPVFEADDQSAMVYL  324

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            + KE+EKWG K+Y+E+ YY  GYW  +V                                
Sbjct  325  LAKEREKWGGKVYLENGYYLHGYWGILV--------------------------------  352

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFA  245
               ++++E + N   G    R P +THF GC+PC   GD    Y  E C   M +A NF 
Sbjct  353  ---DRYEEMIENYHPGFGDHRWPLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFG  405

Query  244  DNQVLRNYGFMHRDL  200
            DNQ+L  YGF H+ L
Sbjct  406  DNQILHIYGFTHKSL  420



>gb|KJB28609.1| hypothetical protein B456_005G060400 [Gossypium raimondii]
Length=447

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 91/195 (47%), Gaps = 50/195 (26%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA   P     +  G  L R  KD+   E+DDQS ++YL
Sbjct  254  GLNTGSFLLRNCQWSLDLLDAWAPMGPKGKVREEAGKILTRELKDRPVFEADDQSAIVYL  313

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++KE+ KWG K+Y+E+ YY  GYW  +V                                
Sbjct  314  LVKERAKWGEKVYLENAYYLHGYWGILV--------------------------------  341

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFA  245
               ++++E + N   G    R P +THF GC+PC   GD    YS E C   M +A NF 
Sbjct  342  ---DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGD----YSVERCLRQMDRAFNFG  394

Query  244  DNQVLRNYGFMHRDL  200
            DNQ+L+ YGF H+ L
Sbjct  395  DNQILQMYGFTHKSL  409



>ref|NP_001105849.1| putative glycosyltransferase [Zea mays]
 emb|CAJ57382.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY 
Sbjct  311  AWAPMGPKGFIRDQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYL  370

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  371  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  395

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  396  RWPFVTHFVGCKPC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  446



>gb|KCW44805.1| hypothetical protein EUGRSUZ_L01630 [Eucalyptus grandis]
Length=169

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L R  KD+   E+DDQS ++YL+  +++KWG K+Y+ES YY  GYW  +V       
Sbjct  12   GKILTRELKDRPVFEADDQSAMVYLLATQRDKWGEKVYLESAYYLHGYWGILV-------  64

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  65   ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  96

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  97   KFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  132



>ref|XP_010459505.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459506.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459508.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459509.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=472

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 87/174 (50%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L +++KW +K+YVE+ YY 
Sbjct  304  AWAPMGPKGPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYL  363

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K + + + Y                                 + G G   W
Sbjct  364  HGFWEGLVDKYEEMVEKY---------------------------------HPGLGDERW  390

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y+ + C  +M +A NFADNQVL+ YGF HR LL
Sbjct  391  --PFVTHFVGCKPC-GSYAD-YAVDRCFKSMERAFNFADNQVLKLYGFSHRGLL  440



>dbj|BAO02547.1| (1-6)-alpha-D-xylosyltransferase ortholog, partial [Nicotiana 
alata]
Length=303

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 80/163 (49%), Gaps = 41/163 (25%)
 Frame = -3

Query  682  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  503
            D  G  L R  K +   E+DDQS +IY++  ++EKWG+K+Y+ES YY  GYW  +V    
Sbjct  142  DEAGAVLTRELKGRPVFEADDQSAMIYILATQKEKWGDKVYLESAYYLHGYWGILV----  197

Query  502  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  323
                                           +K++E + N   G    R P +THF GC+
Sbjct  198  -------------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCK  226

Query  322  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            PC+  GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  227  PCAKFGD----YSVERCLKQMDRAFNFGDNQILQMYGFTHKSL  265



>ref|XP_009764347.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=455

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 84/174 (48%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    KD+   E+DDQS LIYL + +++KW  K++VE+ YY 
Sbjct  288  AWAPMGPKGPIRDEAGKILTANLKDRPAFEADDQSALIYLFVSQKDKWMQKVFVENSYYL  347

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  348  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  374

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL  YGF H+ LL
Sbjct  375  --PFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVLNLYGFRHKGLL  424



>emb|CDX96540.1| BnaA07g31510D [Brassica napus]
 emb|CDX73082.1| BnaC06g35300D [Brassica napus]
Length=222

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 85/182 (47%), Gaps = 44/182 (24%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  D  G  L    K +   E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V 
Sbjct  61   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  120

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + + Y                                 + G G   W  PF+THF 
Sbjct  121  RYEEMMEKY---------------------------------HPGLGDERW--PFVTHFV  145

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-------TASVVPL  173
            GC+PC    +  Y+ E C  +M +A NFADNQVL+ YGF HR LL          +V PL
Sbjct  146  GCKPCGSYAD--YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVAPL  203

Query  172  PY  167
             +
Sbjct  204  EF  205



>ref|XP_006440652.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|ESR53892.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|KDO55481.1| hypothetical protein CISIN_1g012705mg [Citrus sinensis]
Length=458

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 88/174 (51%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  +    K +   E+DDQS LIYL+L +++KW +K+++ES++Y 
Sbjct  289  AWAPYGPKGVIRDEAGKIMTAYLKGRPAFEADDQSALIYLLLTQKDKWIDKVFIESEFYL  348

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYWV +V + + + + Y                                 + G G   W
Sbjct  349  HGYWVGLVDRYEEMMEKY---------------------------------HPGLGDERW  375

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQV++ YGF HR LL
Sbjct  376  --PFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVIKLYGFGHRGLL  425



>ref|XP_006651307.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Oryza brachyantha]
Length=433

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 93/199 (47%), Gaps = 45/199 (23%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G +I   C        AWA   PP    D +G     T  ++   E+DDQS L++L
Sbjct  231  GLNAGSFIIRNCQWSLDLLDAWAPMGPPGPVRDMYGKIFAETLTNRPPYEADDQSALVFL  290

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ ++++WG K+++E+ Y   G+W +IV + ++I                          
Sbjct  291  LVTQRDRWGGKVFLENSYNLHGFWADIVDRYEDI--------------------------  324

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADN  239
                  +   R  G G   W  P ITHF GC+PC G  +  Y  E C   M +A NFAD+
Sbjct  325  ------RRQWRRPGLGDDRW--PLITHFVGCKPCGG-QDASYDVERCRRGMDRAFNFADD  375

Query  238  QVLRNYGFMHRDLLDTASV  182
            Q+L  YGF H   LDT +V
Sbjct  376  QILELYGFAHES-LDTMAV  393



>ref|XP_006494985.1| PREDICTED: putative glycosyltransferase 3-like [Citrus sinensis]
Length=458

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 88/174 (51%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  +    K +   E+DDQS LIYL+L +++KW +K+++ES++Y 
Sbjct  289  AWAPFGPKGVIRDEAGKIMTAYLKGRPAFEADDQSALIYLLLTQKDKWIDKVFIESEFYL  348

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYWV +V + + + + Y                                 + G G   W
Sbjct  349  HGYWVGLVDRYEEMMEKY---------------------------------HPGLGDERW  375

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQV++ YGF HR LL
Sbjct  376  --PFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVIKLYGFGHRGLL  425



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 86/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W +K+YVE+ YY 
Sbjct  287  AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYVENSYYL  346

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  347  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  373

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  374  --PFVTHFVGCKPC-GSYGD-YPVERCLGSMERAFNFADNQVLKLYGFRHRGLL  423



>gb|KJB50959.1| hypothetical protein B456_008G195000 [Gossypium raimondii]
Length=460

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 87/174 (50%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W +K+++E+ YY 
Sbjct  289  AWAPMGPKGPIREEAGRILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFIENQYYL  348

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  349  HGYWAGLVDRYEEMMEKY---------------------------------HPGLGDERW  375

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + YS E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  376  --PFVTHFVGCKPC-GSYGD-YSVERCLRSMQRAFNFADNQVLKLYGFRHRGLL  425



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 91/191 (48%), Gaps = 47/191 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W +K+Y+E+ YY 
Sbjct  286  AWAPMGPKGTIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYL  345

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  346  HGYWAGLVDRYEEMMEKY---------------------------------HPGLGDERW  372

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-----  194
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL      
Sbjct  373  --PFVTHFVGCKPC-GSYGD-YPVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKR  428

Query  193  --TASVVPLPY  167
                +V PL Y
Sbjct  429  IRNETVTPLEY  439



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 85/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY 
Sbjct  287  AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYL  346

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  347  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  373

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  374  --PFVTHFVGCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  423



>gb|EMT32465.1| Putative glycosyltransferase 3 [Aegilops tauschii]
Length=445

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 85/175 (49%), Gaps = 40/175 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L  +   +   E+DDQS LI+L+L E+E+W  K+YVE+ YY 
Sbjct  279  AWAPMGPKGRVREAAGKVLTASLTGRPAFEADDQSALIHLLLTEKERWMEKVYVENQYYL  338

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K                               Y E  ++H  + G G   W
Sbjct  339  HGFWAGLVDK-------------------------------YEEMMEKH--HPGLGDERW  365

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  194
              PFITHF GC+PC G + + Y  E C   M +A NFADNQVLR YGF HR L +
Sbjct  366  --PFITHFVGCKPC-GSYGD-YPVEQCLTGMERAFNFADNQVLRLYGFRHRSLTN  416



>ref|XP_004508717.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=446

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 87/182 (48%), Gaps = 44/182 (24%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL+L ++EKW  K+++E+ YY  GYW  +V 
Sbjct  284  PVREEAGKVLTANLKGRPAFEADDQSALIYLLLSKKEKWMGKVFLENSYYLHGYWAGLVD  343

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + + Y                                 + G G   W  PF+THF 
Sbjct  344  RYEEMIEKY---------------------------------HPGLGDERW--PFVTHFV  368

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-------TASVVPL  173
            GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL          +V PL
Sbjct  369  GCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPL  426

Query  172  PY  167
             +
Sbjct  427  EF  428



>ref|XP_009339134.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 85/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY 
Sbjct  288  AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYL  347

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  348  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  374

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  375  --PFVTHFVGCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_008374566.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=458

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 85/174 (49%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY 
Sbjct  286  AWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYL  345

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  346  HGYWAGLVDRYEEMIEKY---------------------------------HPGLGDERW  372

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  373  --PFVTHFVGCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  422



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 90/191 (47%), Gaps = 47/191 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++ +W +K+Y+E+ YY 
Sbjct  282  AWAPMGPKGAIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKAQWMDKVYIENQYYL  341

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V + + + + Y                                 + G G   W
Sbjct  342  HGYWAGLVDRYEEMMEKY---------------------------------HPGLGDERW  368

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-----  194
              PF+THF GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL      
Sbjct  369  --PFVTHFVGCKPC-GSYGD-YPVEQCMRSMERAFNFADNQVLKLYGFGHRGLLSPKIKR  424

Query  193  --TASVVPLPY  167
                +V PL Y
Sbjct  425  IRNETVTPLEY  435



>ref|XP_009338860.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 82/165 (50%), Gaps = 37/165 (22%)
 Frame = -3

Query  691  PPYDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVG  512
            P  +  G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V 
Sbjct  297  PIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVD  356

Query  511  KLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  332
            + + + + Y                                 + G G   W  PF+THF 
Sbjct  357  RYEEMIEKY---------------------------------HPGLGDERW--PFVTHFV  381

Query  331  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
            GC+PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  382  GCKPC-GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  424



>dbj|BAK03947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++EKW +K+Y+E+ YY 
Sbjct  311  AWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSALIYLLLSQKEKWMDKVYIENSYYL  370

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  371  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  395

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  + C  +M +A NFADNQVLR YGF H+ L
Sbjct  396  RWPFVTHFVGCKPC-GSYGD-YPVDRCLKSMERAFNFADNQVLRLYGFAHKGL  446



>ref|XP_002465378.1| hypothetical protein SORBIDRAFT_01g037530 [Sorghum bicolor]
 gb|EER92376.1| hypothetical protein SORBIDRAFT_01g037530 [Sorghum bicolor]
Length=446

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 90/197 (46%), Gaps = 42/197 (21%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXP--PYDH-WGNTLRRTFKDKIFPESDDQSGLIYL  599
            GI +G +I   C        AWA   P  P  + +G  L +   D+   E+DDQS L+YL
Sbjct  250  GINAGSFIIRNCQWSLDLLDAWARMGPRGPVRYEYGKVLGKALSDRPSYEADDQSALVYL  309

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ E+ +WG+K ++E  Y   G+W+ IV +                 E +RR        
Sbjct  310  LVTERGRWGDKTFLEGSYSLHGFWLAIVDRY----------------EDMRRDATATPGG  353

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADN  239
               E+W                P +THF GC+PC G +   Y    C   M +ALNFAD+
Sbjct  354  GGGERW----------------PLVTHFVGCKPCGGQYAS-YEASRCRRGMERALNFADD  396

Query  238  QVLRNYGFMHRDLLDTA  188
            Q+LR YGF H  L  TA
Sbjct  397  QILRLYGFEHESLNTTA  413



>ref|XP_004494368.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=467

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 90/195 (46%), Gaps = 50/195 (26%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA   P     D  G  L +  KD+   E+DDQS ++YL
Sbjct  274  GLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGKILTKELKDRPVFEADDQSAMVYL  333

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            + KE+EKWG K+Y+E+ YY  GYW  +V                                
Sbjct  334  LAKEKEKWGGKVYLENGYYLHGYWGILV--------------------------------  361

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFA  245
               ++++E + N   G    R P +THF GC+PC   GD    Y  E C   M +A NF 
Sbjct  362  ---DRYEEMIENYHPGFGDHRWPLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFG  414

Query  244  DNQVLRNYGFMHRDL  200
            DNQVL+ YGF H+ L
Sbjct  415  DNQVLQIYGFTHKSL  429



>gb|AFK30382.1| galactosyltransferase A [Triticum aestivum]
Length=478

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     +  G  L    K +   E+DDQS LIYL+L ++EKW +K+Y+E+ YY 
Sbjct  311  AWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSALIYLLLSQKEKWMDKVYIENSYYL  370

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V                                   +K++E + N   G    
Sbjct  371  HGFWAGLV-----------------------------------DKYEEMMENHHPGLGDE  395

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R PF+THF GC+PC G + + Y  + C  +M +A NFADNQVLR YGF H+ L
Sbjct  396  RWPFVTHFVGCKPC-GSYGD-YPVDRCLKSMERAFNFADNQVLRLYGFAHKGL  446



>ref|XP_010230173.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Brachypodium 
distachyon]
Length=436

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 91/198 (46%), Gaps = 47/198 (24%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAH---SXPPYDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA      P  D +G        ++   E+DDQS ++YL
Sbjct  243  GVNAGSFVIRNCQWSLDLLDAWARMGPRGPVRDKYGKIFGDALSNRGAYEADDQSAIVYL  302

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            ++ E+ KWG+K+++ES Y   G+WV IV K                              
Sbjct  303  LVTERAKWGDKVFLESSYLLHGFWVSIVDKY-----------------------------  333

Query  418  SYAEKWKEHLRNAGQGRSGWRR-PFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFAD  242
                   E +R+ G+   G  R P +THF GC+PCSG+    Y    C   M +ALNFAD
Sbjct  334  -------EEMRSKGRPGLGDERWPLVTHFVGCKPCSGE-GATYEAARCRRGMERALNFAD  385

Query  241  NQVLRNYGFMHRDLLDTA  188
            +Q+L+ YGF H  L  TA
Sbjct  386  DQILKLYGFQHESLNTTA  403



>ref|XP_007163097.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 ref|XP_007163098.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 gb|ESW35091.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 gb|ESW35092.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
Length=448

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 90/195 (46%), Gaps = 50/195 (26%)
 Frame = -3

Query  751  GIASGPWISWTCG------PAWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYL  599
            G+ +G ++   C        AWA   P     D  G  L R  KD+   E+DDQS ++YL
Sbjct  264  GLNTGSFLLRNCQWSLDILDAWAPMGPKGRVRDEAGKVLTRELKDRPVFEADDQSAMVYL  323

Query  598  ILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSE  419
            + +E++KWG+K+Y+E+ YY  GYW  +V                                
Sbjct  324  LARERDKWGDKVYLENGYYLHGYWGILV--------------------------------  351

Query  418  SYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFA  245
               +K++E + N   G    R P +THF GC+PC   GD    Y  E C   M +A NF 
Sbjct  352  ---DKYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFG  404

Query  244  DNQVLRNYGFMHRDL  200
            DNQ+L+ YGF H  L
Sbjct  405  DNQILQIYGFTHTSL  419



>gb|KDP27794.1| hypothetical protein JCGZ_18874 [Jatropha curcas]
Length=463

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 83/175 (47%), Gaps = 44/175 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L R  KD+   E+DDQS ++YL+  +++KWG+K+Y+ES YY 
Sbjct  290  AWAPMGPKGKIRDEAGKVLTRELKDRPVFEADDQSAMVYLLATQRDKWGDKVYLESAYYL  349

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             GYW  +V                                   ++++E + N   G    
Sbjct  350  HGYWGILV-----------------------------------DRYEEMIENYHPGLGDH  374

Query  358  RRPFITHFTGCQPCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            R P +THF GC+PC   GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  375  RWPLVTHFVGCKPCGKFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  425



>ref|XP_010537379.1| PREDICTED: putative glycosyltransferase 5 [Tarenaya hassleriana]
Length=455

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 91/191 (48%), Gaps = 47/191 (25%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIY++L +++KW  K++VE+ YY 
Sbjct  287  AWAPMGPKGPIRDEAGKILTANLKGRPAFEADDQSALIYILLSQKDKWMEKVFVENQYYL  346

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V + + + + Y                                 + G G   W
Sbjct  347  HGFWEGLVDRYEEMIEKY---------------------------------HPGLGDERW  373

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD-----  194
              PF+THF GC+PC G + + Y+ E C  +M +A NFADNQVL+ YGF HR LL      
Sbjct  374  --PFVTHFVGCKPC-GSYAD-YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKR  429

Query  193  --TASVVPLPY  167
                +V PL Y
Sbjct  430  IRNETVTPLEY  440



>ref|XP_008662460.1| PREDICTED: putative glycosyltransferase 3 [Zea mays]
 gb|AFW56034.1| hypothetical protein ZEAMMB73_202735 [Zea mays]
Length=456

 Score = 90.5 bits (223),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 76/150 (51%), Gaps = 38/150 (25%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            ++DDQS LI+L+L ++E+W +K++VE+++Y  G+W  +V                     
Sbjct  320  DADDQSALIHLLLVQKERWMDKVHVETEFYLHGFWTGLV---------------------  358

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                          +++++ + +   G    R PFITHF GC+ C     E Y  + C  
Sbjct  359  --------------DRYEQMMEDNHPGLGDDRWPFITHFVGCKTCG--RYEDYPLDRCIR  402

Query  271  AMHKALNFADNQVLRNYGFMHRDLLDTASV  182
             M +A NFADNQVLR YGF HR  L TA V
Sbjct  403  GMERAFNFADNQVLRLYGFRHRS-LTTAKV  431


 Score = 40.4 bits (93),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW++D +D W  MGP+ P+    GK    +L G+
Sbjct  280  RNCQWSLDLLDAWVPMGPRGPSRVEAGKLLTASLTGR  316



>gb|EYU45549.1| hypothetical protein MIMGU_mgv1a027105mg [Erythranthe guttata]
Length=460

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 79/158 (50%), Gaps = 36/158 (23%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L R  KD+   E+DDQS ++Y++  ++EKWG+K+Y+E+ Y+  GYW  +V K + + 
Sbjct  305  GEILTRELKDRPVFEADDQSAMVYILATQKEKWGDKVYLENWYFLHGYWGILVDKFEEMI  364

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
            + Y                                 + G G   W  P +THF GC+PC 
Sbjct  365  ENY---------------------------------HPGLGDHRW--PLVTHFVGCKPC-  388

Query  313  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
            G   + YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  389  GKFKDYYSVEKCLKQMDRAFNFGDNQILQMYGFTHKSL  426



>ref|XP_008662468.1| PREDICTED: putative glycosyltransferase 3 [Zea mays]
 gb|AFW56046.1| hypothetical protein ZEAMMB73_358929 [Zea mays]
Length=456

 Score = 90.5 bits (223),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 76/150 (51%), Gaps = 38/150 (25%)
 Frame = -3

Query  631  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  452
            ++DDQS LI+L+L ++E+W +K++VE+++Y  G+W  +V                     
Sbjct  320  DADDQSALIHLLLVQKERWMDKVHVETEFYLHGFWTGLV---------------------  358

Query  451  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  272
                          +++++ + +   G    R PFITHF GC+ C     E Y  + C  
Sbjct  359  --------------DRYEQMMEDNHPGLGDDRWPFITHFVGCKTCG--RYEDYPLDRCIR  402

Query  271  AMHKALNFADNQVLRNYGFMHRDLLDTASV  182
             M +A NFADNQVLR YGF HR  L TA V
Sbjct  403  GMERAFNFADNQVLRLYGFRHRS-LTTAKV  431


 Score = 40.8 bits (94),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQXPTIRSLGKHSPENLQGQ  642
            RNCQW++D +D W  MGP+ P+    GK    +L G+
Sbjct  280  RNCQWSLDLLDAWVPMGPRGPSRVEAGKLLTASLTGR  316



>ref|XP_006356974.1| PREDICTED: putative glycosyltransferase 2-like [Solanum tuberosum]
Length=464

 Score =   100 bits (248),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L R  KD+   E+DDQS ++Y++  ++E WG+K+Y+E+ YY  GYW  +V       
Sbjct  307  GALLTRELKDRPVFEADDQSAMVYILATQKEIWGDKVYLENAYYLHGYWGILV-------  359

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        +K++E + N   G    R P +THF GC+PC+
Sbjct  360  ----------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCKPCA  391

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  392  KFGD----YSVERCLKQMDRAFNFGDNQILQMYGFTHKSL  427


 Score = 31.2 bits (69),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQ  696
            RN QWA+D +DV A MGP+
Sbjct  281  RNTQWALDLLDVLAPMGPK  299



>ref|XP_003558113.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Brachypodium 
distachyon]
Length=445

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  289  GRVLTKHLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  341

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  342  ----------------------------DRYEEMLENYKPGLGDHRWPLVTHFVGCKPCS  373

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    Y  E C   M +A NF DNQVL+ YGF H+ L
Sbjct  374  KFGD----YPVERCLKQMDRAFNFGDNQVLQMYGFEHKSL  409



>ref|XP_001767750.1| predicted protein [Physcomitrella patens]
 gb|EDQ67501.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 80/158 (51%), Gaps = 33/158 (21%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L  T   +   E+DDQS L+YL+   +EKWG+K+++E  Y   GYWV +V +L+ + 
Sbjct  257  GKLLTATLAGRPEFEADDQSALVYLLAMNKEKWGSKVFLEHSYCLHGYWVMLVERLEEL-  315

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
             M LG      GEK                            + +R PF+THF GC+PC 
Sbjct  316  -MELG---PRGGEK----------------------------NSFRWPFVTHFVGCKPCG  343

Query  313  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
             D    Y+ + C   M +A NFADNQ+L +YGF H+ L
Sbjct  344  RDGTSHYATDRCLKHMERAFNFADNQILEHYGFHHQTL  381



>gb|EAY82266.1| hypothetical protein OsI_37474 [Oryza sativa Indica Group]
Length=463

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 82/173 (47%), Gaps = 40/173 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L  +   +   E+DDQS LI+++L ++E+W +K+YVE  Y+ 
Sbjct  297  AWAPMGPKGRVRDEAGKVLTASLTGRPAFEADDQSALIHILLTQKERWMDKVYVEDKYFL  356

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K                               Y E  + H  + G G   W
Sbjct  357  HGFWAGLVDK-------------------------------YEEMMERH--HPGLGDERW  383

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              PF+THF GC+PC G  +  Y  E C   M +A NFADNQVLR YGF HR L
Sbjct  384  --PFVTHFVGCKPCGGYGD--YPRERCLGGMERAFNFADNQVLRLYGFRHRSL  432



>emb|CDY26738.1| BnaA06g12840D [Brassica napus]
Length=482

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 84/174 (48%), Gaps = 40/174 (23%)
 Frame = -3

Query  709  AWAHSXPP---YDHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYF  539
            AWA   P     D  G  L    K +   E+DDQS LIYL+L ++EKW  K+YVE+ YY 
Sbjct  314  AWAPMGPKGPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYL  373

Query  538  EGYWVEIVGKLDNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGW  359
             G+W  +V K + + + Y                                 + G G   W
Sbjct  374  HGFWEGLVDKYEEMIEKY---------------------------------HPGLGDERW  400

Query  358  RRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  197
              PF+THF GC+PC G + + Y+ E C   M +A NFADNQVL+ YGF H  LL
Sbjct  401  --PFVTHFVGCKPC-GSYAD-YAEERCFKGMERAFNFADNQVLKLYGFSHMGLL  450



>ref|XP_004229187.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Solanum lycopersicum]
Length=464

 Score = 99.8 bits (247),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  673  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  494
            G  L R  KD+   E+DDQS ++Y++  ++E WG+K+Y+E+ YY  GYW  +V       
Sbjct  307  GALLTRELKDRPVFEADDQSAMVYILATQKEIWGDKVYLENAYYLHGYWGILV-------  359

Query  493  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  314
                                        +K++E + N   G    R P +THF GC+PC+
Sbjct  360  ----------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCKPCA  391

Query  313  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  200
              GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  392  KFGD----YSVERCLKQMDRAFNFGDNQILQMYGFTHKSL  427


 Score = 31.2 bits (69),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -2

Query  752  RNCQWAMDFMDVWASMGPQ  696
            RN QWA+D +DV A MGP+
Sbjct  281  RNTQWALDLLDVLAPMGPK  299



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050