BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF016B15

Length=792
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03876.1|  unnamed protein product                                394   6e-136   Coffea canephora [robusta coffee]
ref|XP_011073788.1|  PREDICTED: 60S ribosomal protein L13a-4            392   2e-135   Sesamum indicum [beniseed]
ref|XP_009789164.1|  PREDICTED: 60S ribosomal protein L13a-1            392   3e-135   Nicotiana sylvestris
ref|XP_009622553.1|  PREDICTED: 60S ribosomal protein L13a-4-like       391   6e-135   Nicotiana tomentosiformis
ref|XP_006349931.1|  PREDICTED: 60S ribosomal protein L13a-4-like       391   1e-134   Solanum tuberosum [potatoes]
gb|EYU32659.1|  hypothetical protein MIMGU_mgv1a013922mg                391   1e-134   Erythranthe guttata [common monkey flower]
ref|XP_009795999.1|  PREDICTED: 60S ribosomal protein L13a-4-like       391   1e-134   Nicotiana sylvestris
ref|XP_009596414.1|  PREDICTED: 60S ribosomal protein L13a-4            390   1e-134   Nicotiana tomentosiformis
ref|NP_001275476.1|  60S ribosomal protein L13a-4-like                  390   2e-134   Solanum tuberosum [potatoes]
ref|XP_004252998.1|  PREDICTED: 60S ribosomal protein L13a-4            390   3e-134   Solanum lycopersicum
ref|XP_010277234.1|  PREDICTED: 60S ribosomal protein L13a-4            389   3e-134   Nelumbo nucifera [Indian lotus]
gb|EYU31410.1|  hypothetical protein MIMGU_mgv1a013934mg                389   3e-134   Erythranthe guttata [common monkey flower]
ref|XP_004239861.1|  PREDICTED: 60S ribosomal protein L13a-4-like       389   4e-134   Solanum lycopersicum
ref|XP_002267491.1|  PREDICTED: 60S ribosomal protein L13a-4            389   4e-134   Vitis vinifera
ref|XP_010279449.1|  PREDICTED: 60S ribosomal protein L13a-4-like       389   5e-134   Nelumbo nucifera [Indian lotus]
ref|XP_009625303.1|  PREDICTED: 60S ribosomal protein L13a-4-like       389   5e-134   Nicotiana tomentosiformis
ref|XP_009765513.1|  PREDICTED: 60S ribosomal protein L13a-4            389   8e-134   Nicotiana sylvestris
ref|XP_011091425.1|  PREDICTED: 60S ribosomal protein L13a-4-like       388   1e-133   Sesamum indicum [beniseed]
gb|AHE13806.1|  ribosomal protein L13a                                  388   1e-133   Solanum torvum [berenjena cimarrona]
ref|XP_010920859.1|  PREDICTED: 60S ribosomal protein L13a-4-like       388   2e-133   Elaeis guineensis
ref|XP_006298559.1|  hypothetical protein CARUB_v10014643mg             387   2e-133   Capsella rubella
gb|ADR71263.1|  60S ribosomal protein L13aA                             387   2e-133   Hevea brasiliensis [jebe]
ref|XP_010488596.1|  PREDICTED: 60S ribosomal protein L13a-2            387   3e-133   Camelina sativa [gold-of-pleasure]
ref|XP_007223449.1|  hypothetical protein PRUPE_ppa011551mg             387   3e-133   Prunus persica
gb|KHG07795.1|  60S ribosomal L13a-4 -like protein                      387   5e-133   Gossypium arboreum [tree cotton]
ref|XP_010466918.1|  PREDICTED: 60S ribosomal protein L13a-2-like       386   6e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010937848.1|  PREDICTED: 60S ribosomal protein L13a-4            386   7e-133   Elaeis guineensis
gb|ACJ02350.1|  60S ribosomal protein L13A                              386   8e-133   Vernicia fordii [tung oil tree]
ref|NP_189127.1|  60S ribosomal protein L13a-2                          385   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793237.1|  PREDICTED: 60S ribosomal protein L13a-4            385   1e-132   Phoenix dactylifera
ref|XP_002518107.1|  60S ribosomal protein L13a, putative               385   1e-132   Ricinus communis
ref|XP_010524687.1|  PREDICTED: 60S ribosomal protein L13a-1            385   2e-132   Tarenaya hassleriana [spider flower]
ref|XP_010069656.1|  PREDICTED: 60S ribosomal protein L13a-2            385   2e-132   Eucalyptus grandis [rose gum]
ref|XP_009136093.1|  PREDICTED: 60S ribosomal protein L13a-2            385   2e-132   Brassica rapa
ref|XP_010245584.1|  PREDICTED: 60S ribosomal protein L13a-4-like       385   2e-132   Nelumbo nucifera [Indian lotus]
gb|AAL87341.1|  putative 60S ribosomal protein                          385   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439646.1|  PREDICTED: 60S ribosomal protein L13a-4            385   3e-132   Camelina sativa [gold-of-pleasure]
ref|XP_004247847.1|  PREDICTED: 60S ribosomal protein L13a-4            385   3e-132   Solanum lycopersicum
ref|XP_009112682.1|  PREDICTED: 60S ribosomal protein L13a-2-like       384   3e-132   Brassica rapa
gb|KJB30129.1|  hypothetical protein B456_005G130900                    384   3e-132   Gossypium raimondii
ref|XP_010552053.1|  PREDICTED: 60S ribosomal protein L13a-2-like       384   4e-132   Tarenaya hassleriana [spider flower]
ref|XP_009392721.1|  PREDICTED: 60S ribosomal protein L13a-4-like       384   4e-132   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY52083.1|  BnaCnng21840D                                          384   4e-132   Brassica napus [oilseed rape]
ref|XP_004154636.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    385   5e-132   
ref|XP_006407868.1|  hypothetical protein EUTSA_v10021532mg             384   5e-132   Eutrema salsugineum [saltwater cress]
ref|XP_009374600.1|  PREDICTED: 60S ribosomal protein L13a-4            384   6e-132   Pyrus x bretschneideri [bai li]
ref|XP_002883564.1|  60S ribosomal protein L13A                         384   7e-132   Arabidopsis lyrata subsp. lyrata
gb|KHG08426.1|  60S ribosomal L13a-4 -like protein                      384   7e-132   Gossypium arboreum [tree cotton]
ref|XP_009404653.1|  PREDICTED: 60S ribosomal protein L13a-4-like       383   9e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268901.1|  PREDICTED: 60S ribosomal protein L13a-4            383   9e-132   Vitis vinifera
ref|XP_008356990.1|  PREDICTED: 60S ribosomal protein L13a-4            383   1e-131   Malus domestica [apple tree]
ref|XP_010482144.1|  PREDICTED: 60S ribosomal protein L13a-4-like       383   1e-131   Camelina sativa [gold-of-pleasure]
gb|KDP39375.1|  hypothetical protein JCGZ_01132                         383   1e-131   Jatropha curcas
ref|XP_009102457.1|  PREDICTED: 60S ribosomal protein L13a-2-like       383   1e-131   Brassica rapa
ref|XP_002865669.1|  60S ribosomal protein L13A                         383   1e-131   
ref|XP_006281111.1|  hypothetical protein CARUB_v10027141mg             383   1e-131   Capsella rubella
ref|XP_010440660.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    383   1e-131   Camelina sativa [gold-of-pleasure]
ref|NP_187367.1|  60S ribosomal protein L13a-1                          382   2e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KHG26825.1|  60S ribosomal L13a-4 -like protein                      382   2e-131   Gossypium arboreum [tree cotton]
ref|XP_006418685.1|  hypothetical protein EUTSA_v10002667mg             382   2e-131   Eutrema salsugineum [saltwater cress]
ref|XP_006298567.1|  hypothetical protein CARUB_v10014649mg             382   2e-131   Capsella rubella
ref|XP_004138959.1|  PREDICTED: 60S ribosomal protein L13a-4-like       382   2e-131   
ref|XP_004154637.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    382   3e-131   
ref|XP_009421391.1|  PREDICTED: 60S ribosomal protein L13a-4            382   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009111853.1|  PREDICTED: 60S ribosomal protein L13a-4            382   4e-131   Brassica rapa
ref|XP_008789105.1|  PREDICTED: 60S ribosomal protein L13a-4-like       382   4e-131   Phoenix dactylifera
ref|XP_009403869.1|  PREDICTED: 60S ribosomal protein L13a-4-like       382   4e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923627.1|  PREDICTED: 60S ribosomal protein L13a-2-like       383   4e-131   Elaeis guineensis
ref|XP_010448678.1|  PREDICTED: 60S ribosomal protein L13a-1            382   4e-131   Camelina sativa [gold-of-pleasure]
ref|XP_004133995.1|  PREDICTED: 60S ribosomal protein L13a-2-like       382   5e-131   Cucumis sativus [cucumbers]
ref|NP_199687.1|  60S ribosomal protein L13a-4                          382   5e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38165.1|  hypothetical protein AALP_AA3G077500                    381   5e-131   Arabis alpina [alpine rockcress]
gb|KJB72096.1|  hypothetical protein B456_011G159000                    381   5e-131   Gossypium raimondii
ref|XP_007034382.1|  Ribosomal protein L13 family protein isoform 1     381   6e-131   
emb|CDY33947.1|  BnaA02g30400D                                          381   7e-131   Brassica napus [oilseed rape]
ref|XP_008348430.1|  PREDICTED: 60S ribosomal protein L13a-4            381   7e-131   Malus domestica [apple tree]
ref|XP_006420899.1|  hypothetical protein CICLE_v10005900mg             381   8e-131   Citrus clementina [clementine]
ref|XP_010464292.1|  PREDICTED: 60S ribosomal protein L13a-1-like       381   9e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010937601.1|  PREDICTED: 60S ribosomal protein L13a-2-like       380   1e-130   Elaeis guineensis
ref|XP_010532891.1|  PREDICTED: 60S ribosomal protein L13a-2-like       380   1e-130   Tarenaya hassleriana [spider flower]
ref|XP_006395114.1|  hypothetical protein EUTSA_v10004924mg             380   1e-130   Eutrema salsugineum [saltwater cress]
ref|XP_009129745.1|  PREDICTED: 60S ribosomal protein L13a-4-like       380   1e-130   Brassica rapa
ref|XP_010110069.1|  60S ribosomal protein L13a-3                       380   2e-130   Morus notabilis
ref|XP_004288082.1|  PREDICTED: 60S ribosomal protein L13a-4            380   2e-130   Fragaria vesca subsp. vesca
ref|XP_010069043.1|  PREDICTED: 60S ribosomal protein L13a-3            380   2e-130   Eucalyptus grandis [rose gum]
ref|XP_011045655.1|  PREDICTED: 60S ribosomal protein L13a-2            380   2e-130   Populus euphratica
ref|XP_008786013.1|  PREDICTED: 60S ribosomal protein L13a-4-like       380   2e-130   Phoenix dactylifera
gb|KHG16481.1|  60S ribosomal L13a-4 -like protein                      380   3e-130   Gossypium arboreum [tree cotton]
ref|XP_009151676.1|  PREDICTED: 60S ribosomal protein L13a-4            380   3e-130   Brassica rapa
ref|XP_007049776.1|  Ribosomal protein L13 family protein               379   3e-130   Theobroma cacao [chocolate]
ref|XP_006369799.1|  60S ribosomal protein L13a-2                       379   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_009405822.1|  PREDICTED: 60S ribosomal protein L13a-4-like       379   4e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_193053.1|  60S ribosomal protein L13a-3                          379   5e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297119.1|  PREDICTED: 60S ribosomal protein L13a-4-like       379   5e-130   Fragaria vesca subsp. vesca
gb|KFK39804.1|  hypothetical protein AALP_AA3G290300                    379   6e-130   Arabis alpina [alpine rockcress]
ref|XP_002863167.1|  predicted protein                                  379   7e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_002521095.1|  60S ribosomal protein L13a, putative               378   1e-129   Ricinus communis
gb|KFK39801.1|  hypothetical protein AALP_AA3G289800                    378   1e-129   Arabis alpina [alpine rockcress]
gb|AFK44939.1|  unknown                                                 378   1e-129   Lotus japonicus
ref|NP_001030654.1|  60S ribosomal protein L13a-1                       378   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284504.1|  hypothetical protein CARUB_v10005705mg             378   1e-129   
ref|XP_006840139.1|  hypothetical protein AMTR_s00089p00040540          378   1e-129   Amborella trichopoda
gb|KJB42469.1|  hypothetical protein B456_007G154600                    378   2e-129   Gossypium raimondii
ref|XP_010023711.1|  PREDICTED: 60S ribosomal protein L13a-4-like       377   2e-129   Eucalyptus grandis [rose gum]
ref|XP_002882511.1|  structural constituent of ribosome                 377   4e-129   
gb|EPS58218.1|  hypothetical protein M569_16597                         377   4e-129   Genlisea aurea
gb|KJB10146.1|  hypothetical protein B456_001G186700                    376   5e-129   Gossypium raimondii
ref|XP_006650608.1|  PREDICTED: 60S ribosomal protein L13a-4-like       376   6e-129   Oryza brachyantha
gb|KDO61166.1|  hypothetical protein CISIN_1g028623mg                   375   1e-128   Citrus sinensis [apfelsine]
gb|KHF97469.1|  60S ribosomal L13a-4 -like protein                      375   1e-128   Gossypium arboreum [tree cotton]
ref|XP_010527234.1|  PREDICTED: 60S ribosomal protein L13a-2-like       375   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_002323772.1|  ribosomal protein L13a                             375   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_006479280.1|  PREDICTED: 60S ribosomal protein L13a-4-like       374   3e-128   Citrus sinensis [apfelsine]
ref|XP_003559332.1|  PREDICTED: 60S ribosomal protein L13a-4            374   4e-128   Brachypodium distachyon [annual false brome]
ref|XP_008805147.1|  PREDICTED: 60S ribosomal protein L13a-2-like       373   1e-127   Phoenix dactylifera
ref|NP_001130808.1|  uncharacterized protein LOC100191912               373   1e-127   Zea mays [maize]
gb|KHG00254.1|  60S ribosomal L13a-4 -like protein                      372   4e-127   Gossypium arboreum [tree cotton]
ref|NP_001235102.1|  uncharacterized protein LOC100499978               371   6e-127   Glycine max [soybeans]
ref|XP_010435310.1|  PREDICTED: 60S ribosomal protein L13a-3-like       371   8e-127   Camelina sativa [gold-of-pleasure]
gb|ACF79169.1|  unknown                                                 371   8e-127   Zea mays [maize]
ref|XP_011041875.1|  PREDICTED: 60S ribosomal protein L13a-1-like       370   1e-126   Populus euphratica
ref|XP_010513787.1|  PREDICTED: 60S ribosomal protein L13a-2-like       370   1e-126   Camelina sativa [gold-of-pleasure]
ref|NP_001276138.1|  60S ribosomal protein L13a-4-like                  370   1e-126   
ref|XP_002466431.1|  hypothetical protein SORBIDRAFT_01g007690          370   2e-126   Sorghum bicolor [broomcorn]
ref|NP_001051314.1|  Os03g0756000                                       370   2e-126   
ref|XP_006586250.1|  PREDICTED: 60S ribosomal protein L13a-4-like       369   3e-126   Glycine max [soybeans]
ref|XP_007200528.1|  hypothetical protein PRUPE_ppa011553mg             369   4e-126   Prunus persica
ref|XP_004499225.1|  PREDICTED: 60S ribosomal protein L13a-4-like       369   4e-126   Cicer arietinum [garbanzo]
ref|NP_001281205.1|  60S ribosomal protein L13a                         369   4e-126   Zea mays [maize]
gb|KDP26388.1|  hypothetical protein JCGZ_17546                         369   5e-126   Jatropha curcas
ref|XP_004981725.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    369   6e-126   Setaria italica
ref|XP_010547080.1|  PREDICTED: 60S ribosomal protein L13a-1            368   8e-126   Tarenaya hassleriana [spider flower]
pdb|3J61|O  Chain O, Localization Of The Large Subunit Ribosomal ...    368   1e-125   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007140600.1|  hypothetical protein PHAVU_008G125900g             367   1e-125   Phaseolus vulgaris [French bean]
ref|XP_003616742.1|  60S ribosomal protein L13A                         367   3e-125   Medicago truncatula
gb|ACG36118.1|  60S ribosomal protein L13a                              367   3e-125   Zea mays [maize]
ref|XP_002439183.1|  hypothetical protein SORBIDRAFT_09g001930          366   4e-125   Sorghum bicolor [broomcorn]
gb|ACG33474.1|  60S ribosomal protein L13a                              366   7e-125   Zea mays [maize]
ref|XP_006443602.1|  hypothetical protein CICLE_v10023466mg             372   8e-125   
gb|KCW58066.1|  hypothetical protein EUGRSUZ_H00799                     367   9e-125   Eucalyptus grandis [rose gum]
gb|AFK34830.1|  unknown                                                 365   1e-124   Medicago truncatula
ref|XP_011024678.1|  PREDICTED: 60S ribosomal protein L13a-4-like       365   1e-124   Populus euphratica
ref|XP_003546257.1|  PREDICTED: 60S ribosomal protein L13a-4-like       365   1e-124   Glycine max [soybeans]
ref|XP_007147486.1|  hypothetical protein PHAVU_006G128500g             365   2e-124   Phaseolus vulgaris [French bean]
gb|KHN07182.1|  60S ribosomal protein L13a-1                            365   2e-124   Glycine soja [wild soybean]
gb|AAR89618.1|  60S ribosomal protein L13a                              364   6e-124   Capsicum annuum
ref|NP_001236202.1|  uncharacterized protein LOC100527190               363   8e-124   Glycine max [soybeans]
ref|XP_008235481.1|  PREDICTED: 60S ribosomal protein L13a-1-like       363   9e-124   Prunus mume [ume]
gb|KHN31417.1|  60S ribosomal protein L13a-4                            363   1e-123   Glycine soja [wild soybean]
ref|NP_001058724.1|  Os07g0109500                                       363   1e-123   
ref|XP_010685006.1|  PREDICTED: 60S ribosomal protein L13a-2            363   1e-123   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002301785.2|  ribosomal protein L13a                             362   2e-123   
ref|XP_010228462.1|  PREDICTED: 60S ribosomal protein L13a-4-like       362   2e-123   Brachypodium distachyon [annual false brome]
gb|ABQ57364.1|  ribosomal protein L13A                                  361   7e-123   Lupinus luteus
gb|ACG48503.1|  60S ribosomal protein L13a                              360   1e-122   Zea mays [maize]
ref|XP_008365936.1|  PREDICTED: 60S ribosomal protein L13a-1            360   2e-122   
gb|EAZ38446.1|  hypothetical protein OsJ_22825                          358   5e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009334926.1|  PREDICTED: 60S ribosomal protein L13a-1-like       358   1e-121   Pyrus x bretschneideri [bai li]
gb|ACJ83838.1|  unknown                                                 356   5e-121   Medicago truncatula
gb|ACG37566.1|  60S ribosomal protein L13a                              355   3e-120   Zea mays [maize]
sp|O49885.1|RL13A_LUPLU  RecName: Full=60S ribosomal protein L13a       353   8e-120   Lupinus luteus
ref|XP_003589380.1|  60S ribosomal protein L13a                         353   1e-119   Medicago truncatula
sp|O65055.1|RL13A_PICMA  RecName: Full=60S ribosomal protein L13a       350   2e-118   Picea mariana [black spruce]
ref|XP_006657401.1|  PREDICTED: 60S ribosomal protein L13a-3-like       349   2e-118   Oryza brachyantha
ref|XP_004981724.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    350   5e-118   
dbj|BAK07924.1|  predicted protein                                      349   1e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52180.1|  60S ribosomal protein L13a-4                            341   5e-115   Triticum urartu
gb|EMT05694.1|  60S ribosomal protein L13a-4                            341   1e-114   
ref|XP_001774253.1|  predicted protein                                  337   1e-113   
ref|XP_001763759.1|  predicted protein                                  337   1e-113   
ref|XP_001765352.1|  predicted protein                                  337   2e-113   
gb|KGN66498.1|  hypothetical protein Csa_1G615170                       337   2e-113   Cucumis sativus [cucumbers]
gb|ABK22228.1|  unknown                                                 336   3e-113   Picea sitchensis
ref|XP_001765905.1|  predicted protein                                  336   4e-113   
ref|XP_001773626.1|  predicted protein                                  333   5e-112   
ref|XP_002964465.1|  hypothetical protein SELMODRAFT_166650             319   2e-106   Selaginella moellendorffii
ref|XP_007223448.1|  hypothetical protein PRUPE_ppa011551mg             317   5e-106   
ref|XP_006855707.1|  hypothetical protein AMTR_s00044p00144180          315   2e-105   Amborella trichopoda
gb|KJB72097.1|  hypothetical protein B456_011G159000                    314   6e-105   Gossypium raimondii
gb|AIC33046.1|  60S ribosomal protein L13a                              313   8e-105   Panax ginseng [Asiatic ginseng]
gb|KCW57253.1|  hypothetical protein EUGRSUZ_H00057                     312   4e-104   Eucalyptus grandis [rose gum]
gb|KCW58067.1|  hypothetical protein EUGRSUZ_H00799                     310   1e-103   Eucalyptus grandis [rose gum]
ref|XP_004955326.1|  PREDICTED: 60S ribosomal protein L13a-3-like       311   2e-103   Setaria italica
gb|KJB22645.1|  hypothetical protein B456_004G058600                    307   2e-102   Gossypium raimondii
gb|KDO65929.1|  hypothetical protein CISIN_1g028649mg                   305   2e-101   Citrus sinensis [apfelsine]
gb|ACN36734.1|  unknown                                                 302   3e-100   Zea mays [maize]
ref|XP_008382629.1|  PREDICTED: 60S ribosomal protein L13a-1            288   4e-95    
gb|AAX92709.1|  60S ribosomal protein L13a                              269   3e-87    Picea abies
emb|CBI37325.3|  unnamed protein product                                265   3e-86    Vitis vinifera
gb|KHN23001.1|  60S ribosomal protein L13a-4                            264   9e-86    Glycine soja [wild soybean]
emb|CDO99456.1|  unnamed protein product                                263   3e-85    Coffea canephora [robusta coffee]
emb|CBI17324.3|  unnamed protein product                                256   9e-83    Vitis vinifera
ref|XP_002953387.1|  component of cytosolic 80S ribosome and 60S ...    257   2e-82    Volvox carteri f. nagariensis
ref|XP_005849945.1|  hypothetical protein CHLNCDRAFT_17540              255   1e-81    Chlorella variabilis
gb|AFK39539.1|  unknown                                                 253   1e-81    Lotus japonicus
ref|XP_001692909.1|  ribosomal protein L13a, component of cytosol...    255   1e-81    Chlamydomonas reinhardtii
ref|XP_004168353.1|  PREDICTED: 60S ribosomal protein L13a-3-like       251   7e-81    
gb|KDO65930.1|  hypothetical protein CISIN_1g028649mg                   250   2e-80    Citrus sinensis [apfelsine]
ref|XP_005643971.1|  ribosomal protein L13a component of cytosoli...    252   2e-80    Coccomyxa subellipsoidea C-169
sp|P93099.1|RL13A_CYAPA  RecName: Full=60S ribosomal protein L13a       249   3e-79    Cyanophora paradoxa
ref|XP_001630812.1|  predicted protein                                  247   2e-78    Nematostella vectensis
ref|XP_010661466.1|  PREDICTED: 60S ribosomal protein L13a-2-like       248   9e-78    Vitis vinifera
ref|XP_004349662.1|  ribosomal protein L13, putative                    244   4e-77    Acanthamoeba castellanii str. Neff
ref|XP_008067417.1|  PREDICTED: 60S ribosomal protein L13a              241   6e-76    Carlito syrichta
gb|AAX48846.1|  L13a                                                    241   8e-76    Suberites domuncula
gb|ETE70282.1|  60S ribosomal protein L13a                              241   1e-75    Ophiophagus hannah
ref|XP_004011713.1|  PREDICTED: 60S ribosomal protein L13a-like         240   2e-75    Ovis aries [domestic sheep]
ref|XP_007431701.1|  PREDICTED: 60S ribosomal protein L13a-like         239   3e-75    Python bivittatus
ref|XP_002507247.1|  predicted protein                                  239   3e-75    Micromonas commoda
ref|XP_006160205.1|  PREDICTED: 60S ribosomal protein L13a              239   4e-75    Tupaia chinensis
ref|XP_006905092.1|  PREDICTED: 60S ribosomal protein L13a isofor...    239   4e-75    Pteropus alecto
ref|XP_006905093.1|  PREDICTED: 60S ribosomal protein L13a isofor...    239   4e-75    Pteropus alecto
ref|XP_004472671.1|  PREDICTED: 60S ribosomal protein L13a isoform 2    239   5e-75    Dasypus novemcinctus
ref|NP_001070466.1|  60S ribosomal protein L13a                         239   6e-75    Bos taurus [bovine]
gb|ELR49590.1|  60S ribosomal protein L13a                              238   6e-75    Bos mutus
ref|NP_001016486.1|  ribosomal protein L13a                             239   8e-75    Xenopus tropicalis [western clawed frog]
ref|XP_002723961.2|  PREDICTED: 60S ribosomal protein L13a              238   9e-75    Oryctolagus cuniculus [domestic rabbit]
ref|XP_001491926.1|  PREDICTED: 60S ribosomal protein L13a              238   1e-74    Equus caballus [domestic horse]
gb|EWM30220.1|  60s ribosomal protein l13a                              238   1e-74    Nannochloropsis gaditana
ref|XP_004694340.1|  PREDICTED: 60S ribosomal protein L13a isofor...    238   2e-74    Condylura cristata
ref|XP_003465562.1|  PREDICTED: 60S ribosomal protein L13a isofor...    238   2e-74    Cavia porcellus [guinea pig]
ref|XP_006898790.1|  PREDICTED: 60S ribosomal protein L13a              239   2e-74    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008843288.1|  PREDICTED: 60S ribosomal protein L13a              237   3e-74    Nannospalax galili
ref|XP_003226237.1|  PREDICTED: 60S ribosomal protein L13a              237   3e-74    Anolis carolinensis [Carolina anole]
ref|XP_002762391.1|  PREDICTED: 60S ribosomal protein L13a isofor...    237   3e-74    Callithrix jacchus [common marmoset]
ref|XP_004597042.1|  PREDICTED: 60S ribosomal protein L13a isofor...    237   3e-74    Ochotona princeps [southern American pika]
ref|XP_004672300.1|  PREDICTED: 60S ribosomal protein L13a isofor...    237   3e-74    Jaculus jaculus
ref|NP_001080130.1|  ribosomal protein L13a                             238   4e-74    Xenopus laevis [clawed frog]
ref|NP_001125810.1|  60S ribosomal protein L13a                         236   4e-74    Pongo abelii [orang utan]
ref|XP_001507007.1|  PREDICTED: 60S ribosomal protein L13a              236   4e-74    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_003384047.1|  PREDICTED: 60S ribosomal protein L13a-like         236   4e-74    Amphimedon queenslandica
ref|XP_005879589.1|  PREDICTED: 60S ribosomal protein L13a              236   4e-74    
ref|XP_004409938.1|  PREDICTED: 60S ribosomal protein L13a              236   4e-74    Odobenus rosmarus divergens
ref|XP_011287982.1|  PREDICTED: 60S ribosomal protein L13a              236   4e-74    Felis catus [cat]
ref|NP_036555.1|  60S ribosomal protein L13a isoform 1                  236   5e-74    Homo sapiens [man]
ref|XP_004619892.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   5e-74    Sorex araneus [Eurasian shrew]
gb|EFB23940.1|  hypothetical protein PANDA_006273                       236   5e-74    Ailuropoda melanoleuca
ref|XP_004767370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   5e-74    Mustela putorius furo [black ferret]
ref|NP_001291802.1|  ribosomal protein L13a                             236   5e-74    Ailuropoda melanoleuca
ref|XP_004381707.1|  PREDICTED: 60S ribosomal protein L13a              236   6e-74    Trichechus manatus latirostris
ref|XP_010584802.1|  PREDICTED: 60S ribosomal protein L13a              236   6e-74    Loxodonta africana [African bush elephant]
gb|AAH04900.2|  RPL13A protein                                          236   6e-74    Homo sapiens [man]
ref|XP_008152577.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   6e-74    Eptesicus fuscus
ref|XP_005088148.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   6e-74    Mesocricetus auratus [Syrian golden hamster]
gb|EPQ15989.1|  60S ribosomal protein L13a                              236   6e-74    Myotis brandtii
ref|XP_005412929.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   7e-74    Chinchilla lanigera
ref|XP_008152578.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   7e-74    Eptesicus fuscus
ref|XP_007941028.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   7e-74    Orycteropus afer afer
ref|XP_004710493.1|  PREDICTED: 60S ribosomal protein L13a              236   7e-74    Echinops telfairi [lesser hedgehog tenrec]
sp|Q4R8Z2.3|RL13A_MACFA  RecName: Full=60S ribosomal protein L13a       236   7e-74    Macaca fascicularis [crab eating macaque]
ref|NP_001230997.1|  ribosomal protein L13a isoform 1                   236   8e-74    Sus scrofa [pigs]
ref|XP_007531370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   8e-74    Erinaceus europaeus [common hedgehog]
ref|NP_001230998.1|  ribosomal protein L13a isoform 2                   236   8e-74    Sus scrofa [pigs]
ref|XP_005001821.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   8e-74    
ref|NP_001182348.1|  ribosomal protein L13a                             236   8e-74    Macaca mulatta [rhesus macaque]
ref|XP_006868260.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   9e-74    Chrysochloris asiatica
ref|XP_005589974.1|  PREDICTED: 60S ribosomal protein L13a isofor...    235   9e-74    Macaca fascicularis [crab eating macaque]
ref|XP_004440337.1|  PREDICTED: 60S ribosomal protein L13a isoform 1    236   9e-74    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_002112893.1|  expressed hypothetical protein                     236   9e-74    Trichoplax adhaerens
gb|EHH59787.1|  hypothetical protein EGM_09978                          235   9e-74    Macaca fascicularis [crab eating macaque]
ref|XP_004646507.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   9e-74    Octodon degus
ref|XP_006173859.1|  PREDICTED: 60S ribosomal protein L13a isofor...    236   9e-74    Camelus ferus
ref|XP_005336734.1|  PREDICTED: 60S ribosomal protein L13a isofor...    235   1e-73    Ictidomys tridecemlineatus
ref|XP_004271087.1|  PREDICTED: 60S ribosomal protein L13a              235   1e-73    Orcinus orca [Orca]
ref|XP_006173860.1|  PREDICTED: 60S ribosomal protein L13a isofor...    235   1e-73    
gb|EHB05652.1|  60S ribosomal protein L13a                              235   1e-73    Heterocephalus glaber [naked mole rat]
ref|XP_005336733.1|  PREDICTED: 60S ribosomal protein L13a isofor...    235   1e-73    Ictidomys tridecemlineatus
ref|XP_003453268.1|  PREDICTED: 60S ribosomal protein L13a-like         235   2e-73    Oreochromis niloticus
ref|XP_003801534.1|  PREDICTED: 60S ribosomal protein L13a              235   2e-73    Otolemur garnettii
ref|XP_007172851.1|  PREDICTED: 60S ribosomal protein L13a-like         235   2e-73    
ref|XP_006986315.1|  PREDICTED: 60S ribosomal protein L13a              234   3e-73    Peromyscus maniculatus bairdii
gb|ESA01198.1|  hypothetical protein GLOINDRAFT_334214                  234   3e-73    
ref|XP_008573628.1|  PREDICTED: 60S ribosomal protein L13a isofor...    235   3e-73    Galeopterus variegatus [Malayan flying lemur]
gb|EHH30267.1|  hypothetical protein EGK_10889                          234   3e-73    Macaca mulatta [rhesus macaque]
ref|XP_004625632.1|  PREDICTED: 60S ribosomal protein L13a-like         234   4e-73    
gb|AAQ13495.1|AF109186_1  FWP004                                        234   4e-73    Homo sapiens [man]
ref|XP_003940403.1|  PREDICTED: 60S ribosomal protein L13a isofor...    234   4e-73    Saimiri boliviensis boliviensis
dbj|BAD96467.1|  ribosomal protein L13a variant                         234   4e-73    Homo sapiens [man]
ref|XP_010639023.1|  PREDICTED: 60S ribosomal protein L13a              234   4e-73    Fukomys damarensis [Damara mole rat]
gb|ABW23219.1|  ribosomal protein rpl13a                                234   4e-73    
ref|XP_004540518.1|  PREDICTED: 60S ribosomal protein L13a-like         234   5e-73    
sp|P35427.2|RL13A_RAT  RecName: Full=60S ribosomal protein L13a         234   5e-73    
ref|NP_001051312.2|  Os03g0755700                                       233   5e-73    
ref|XP_007463424.1|  PREDICTED: 60S ribosomal protein L13a isofor...    234   5e-73    
gb|KFM61542.1|  60S ribosomal protein L13a                              233   6e-73    
ref|XP_003508699.2|  PREDICTED: 60S ribosomal protein L13a isofor...    235   7e-73    
ref|XP_004579204.1|  PREDICTED: 60S ribosomal protein L13a-like         233   7e-73    
ref|XP_005366879.1|  PREDICTED: 60S ribosomal protein L13a              233   9e-73    
gb|EPZ33870.1|  60S ribosomal protein L13a                              233   9e-73    
ref|NP_775462.2|  60S ribosomal protein L13a                            233   1e-72    
ref|XP_005589973.1|  PREDICTED: 60S ribosomal protein L13a isofor...    235   1e-72    
gb|EUB62915.1|  60S ribosomal protein L13a                              233   1e-72    
ref|XP_002741044.1|  PREDICTED: 60S ribosomal protein L13a-like i...    233   1e-72    
emb|CAA35908.1|  tum- transplantation antigen P198                      233   1e-72    
ref|XP_007531368.1|  PREDICTED: 60S ribosomal protein L13a isofor...    233   1e-72    
ref|XP_007531369.1|  PREDICTED: 60S ribosomal protein L13a isofor...    233   1e-72    
ref|NP_033464.2|  60S ribosomal protein L13a                            232   2e-72    
ref|XP_003054822.1|  predicted protein                                  232   2e-72    
gb|KFH71578.1|  60S ribosomal protein L16-B                             232   2e-72    
ref|XP_002436282.1|  ribosomal protein L13A, putative                   232   2e-72    
ref|XP_003962761.1|  PREDICTED: 60S ribosomal protein L13a-like         233   2e-72    
pdb|2ZKR|JJ  Chain j, Structure Of A Mammalian Ribosomal 60s Subu...    232   2e-72    
ref|XP_004624823.1|  PREDICTED: 60S ribosomal protein L13a-like         232   3e-72    
sp|Q9XSU0.2|RL13A_CANFA  RecName: Full=60S ribosomal protein L13a       232   3e-72    
gb|ABY28364.1|  ribosomal protein L13A                                  232   3e-72    
emb|CDS32619.1|  ribosomal protein rpl13a                               231   4e-72    
emb|CAK04157.1|  ribosomal protein L13a                                 231   4e-72    
ref|XP_004640903.1|  PREDICTED: 60S ribosomal protein L13a-like         231   4e-72    
emb|CCQ18645.1|  60S ribosomal protein L13a                             231   5e-72    
ref|XP_005801332.1|  PREDICTED: 60S ribosomal protein L13a-like         231   5e-72    
ref|XP_007574193.1|  PREDICTED: 60S ribosomal protein L13a              231   6e-72    
ref|XP_007623352.1|  PREDICTED: 60S ribosomal protein L13a isofor...    234   6e-72    
emb|CDQ71669.1|  unnamed protein product                                231   7e-72    
gb|AAR01666.1|  putative ribosomal protein L13a                         229   8e-72    
gb|ACN10380.1|  60S ribosomal protein L13a                              230   1e-71    
ref|XP_004881622.1|  PREDICTED: 60S ribosomal protein L13a-like         230   1e-71    
ref|XP_005884578.1|  PREDICTED: 60S ribosomal protein L13a-like         230   1e-71    
ref|XP_010733236.1|  PREDICTED: 60S ribosomal protein L13a              231   1e-71    
gb|ACH85355.1|  ribosomal protein L13a                                  230   1e-71    
ref|XP_004054617.1|  PREDICTED: 60S ribosomal protein L13a-like         230   1e-71    
gb|AHA44488.1|  60S ribosomal-like protein                              230   1e-71    
ref|XP_008398128.1|  PREDICTED: 60S ribosomal protein L13a              230   2e-71    
gb|ABX75375.1|  60S ribosomal protein L13A                              230   2e-71    
gb|ACH48187.1|  60S ribosomal protein L13a                              229   2e-71    
ref|XP_004082291.2|  PREDICTED: 60S ribosomal protein L13a              230   2e-71    
emb|CCD82603.1|  putative 60s ribosomal protein L13a                    229   3e-71    
ref|XP_001749344.1|  hypothetical protein                               229   3e-71    
ref|XP_003038672.1|  60S ribosomal protein L16                          229   3e-71    
gb|AAW27674.1|  SJCHGC04249 protein                                     229   3e-71    
gb|ACN09948.1|  60S ribosomal protein L13a                              230   5e-71    
ref|XP_011112396.1|  hypothetical protein H072_6613                     228   5e-71    
ref|XP_006096329.1|  PREDICTED: 60S ribosomal protein L13a-like         229   5e-71    
gb|ABZ04228.1|  ribosomal protein rpl13a                                228   6e-71    
ref|XP_002480444.1|  60S ribosomal protein L16                          228   6e-71    
ref|NP_997949.1|  60S ribosomal protein L13a                            228   7e-71    
gb|ERE70104.1|  fms-related tyrosine kinase 3 ligand-like isoform 1     236   9e-71    
gb|AGH70161.1|  60S ribosomal protein L13a                              228   9e-71    
ref|XP_002144062.1|  60S ribosomal protein L16                          228   1e-70    
gb|ACH85339.1|  ribosomal protein L13a                                  228   1e-70    
ref|XP_011125712.1|  hypothetical protein AOL_s00169g53                 227   1e-70    
gb|ACI67868.1|  60S ribosomal protein L13a                              228   1e-70    
gb|KEZ46607.1|  hypothetical protein SAPIO_CDS0424                      227   2e-70    
emb|CEG78600.1|  Putative 60S ribosomal protein L16                     227   2e-70    
ref|XP_011394488.1|  60S ribosomal protein L16                          228   2e-70    
ref|XP_007244661.1|  PREDICTED: 60S ribosomal protein L13a-like         227   2e-70    
ref|XP_011394487.1|  60S ribosomal protein L16, variant                 227   2e-70    
emb|CEG67074.1|  Putative 60S ribosomal protein L16                     227   2e-70    
gb|KFH65594.1|  large subunit ribosomal protein L13Ae                   231   2e-70    
ref|XP_003348078.1|  60S ribosomal protein L16                          227   2e-70    
gb|AAZ38985.1|  60S ribosomal protein L13a                              226   2e-70    
ref|XP_004226142.1|  PREDICTED: 60S ribosomal protein L13a-like         227   2e-70    
emb|CEJ03799.1|  Putative 60S ribosomal protein L16                     227   3e-70    
ref|XP_009848042.1|  hypothetical protein NEUTE1DRAFT_115903            226   3e-70    
ref|XP_001555732.1|  60S ribosomal protein L16                          226   3e-70    
gb|ESZ92305.1|  60S ribosomal protein L16                               226   3e-70    
gb|EIE78513.1|  60S ribosomal protein L16                               226   3e-70    
ref|XP_005833834.1|  large subunit ribosomal protein L13Ae_2, cyt...    225   4e-70    
ref|XP_011397206.1|  60S ribosomal protein L13a-1                       226   4e-70    
ref|XP_002590758.1|  hypothetical protein BRAFLDRAFT_280074             226   4e-70    
gb|EIE90993.1|  60S ribosomal protein L16                               226   5e-70    
ref|XP_002558631.1|  Pc13g01870                                         226   5e-70    
gb|EQL04215.1|  Ribosomal protein L13, eukaryotic/archaeal              226   6e-70    
gb|ERE70103.1|  fms-related tyrosine kinase 3 ligand-like isoform 1     233   6e-70    
emb|CDM33337.1|  60S ribosomal protein L16                              226   7e-70    
ref|XP_006766010.1|  PREDICTED: 60S ribosomal protein L13a              227   9e-70    
ref|XP_001093017.1|  PREDICTED: 60S ribosomal protein L13a-like         225   1e-69    
ref|XP_006824379.1|  PREDICTED: 60S ribosomal protein L13a-like i...    225   1e-69    
gb|EKV08153.1|  Ribosomal protein L16a                                  225   1e-69    
ref|XP_568413.1|  structural constituent of ribosome                    225   1e-69    
gb|ACO14619.1|  60S ribosomal protein L13A                              225   1e-69    
ref|XP_002472416.1|  60S ribosomal protein L13a                         225   1e-69    
gb|ERT00595.1|  60S ribosomal protein L16                               225   1e-69    
emb|CEJ00501.1|  Putative 60S ribosomal protein L16                     225   1e-69    
ref|XP_750349.2|  ribosomal protein L16a                                225   1e-69    
ref|XP_003649454.1|  60S ribosomal protein L16                          225   1e-69    
gb|EIE79164.1|  60S ribosomal protein L16                               224   2e-69    
ref|XP_007298090.1|  60S ribosomal protein L13a                         224   2e-69    
gb|EDP55936.1|  ribosomal protein L16a                                  224   2e-69    
ref|XP_005986102.1|  PREDICTED: 60S ribosomal protein L13a-like         224   2e-69    
ref|XP_007379121.1|  ribosomal protein L16a                             224   2e-69    
gb|AFR98459.1|  large subunit ribosomal protein L13                     224   2e-69    
gb|KIR59162.1|  ribosomal protein L13                                   224   2e-69    
gb|KGB79094.1|  60S ribosomal protein L13/L16                           224   2e-69    
gb|EPE08609.1|  60s ribosomal protein l16                               225   2e-69    
ref|XP_007279305.1|  60s ribosomal protein l16                          224   2e-69    
ref|XP_001911222.1|  hypothetical protein                               224   2e-69    
gb|EHK49489.1|  hypothetical protein TRIATDRAFT_297491                  224   2e-69    
gb|KIO08197.1|  hypothetical protein M404DRAFT_133675                   224   2e-69    
ref|XP_006014996.1|  PREDICTED: 60S ribosomal protein L13a-like         224   2e-69    
gb|KGB33955.1|  60S ribosomal protein L13a                              224   2e-69    
ref|XP_008602497.1|  60S ribosomal protein L16                          224   3e-69    
gb|EPT03925.1|  hypothetical protein FOMPIDRAFT_1022092                 224   3e-69    
gb|EHK19473.1|  hypothetical protein TRIVIDRAFT_111666                  224   3e-69    
ref|XP_007372042.1|  60S large subunit ribosomal protein                224   3e-69    
ref|XP_007820698.1|  hypothetical protein MAA_04996                     224   3e-69    
ref|XP_008861430.1|  ribosomal protein L13                              224   3e-69    
gb|KIW01173.1|  60S ribosomal protein L16                               224   4e-69    
ref|XP_005955448.1|  PREDICTED: 60S ribosomal protein L13a isofor...    224   4e-69    
gb|ADC97464.1|  putative 60S ribosomal protein L13a                     224   4e-69    
gb|ABW90393.1|  putative ribosomal protein L13a                         224   4e-69    
gb|AGL33439.1|  60S ribosomal protein L13a                              224   4e-69    
ref|XP_001269562.1|  60S ribosomal protein L16                          224   4e-69    
ref|XP_007053692.1|  PREDICTED: 60S ribosomal protein L13a-like         225   4e-69    
gb|EMD42236.1|  hypothetical protein CERSUDRAFT_79830                   223   4e-69    
emb|CCE29838.1|  probable ribosomal protein l13a                        224   4e-69    
ref|XP_001225089.1|  60S ribosomal protein L16                          223   5e-69    
emb|CCM05160.1|  predicted protein                                      223   5e-69    
ref|XP_004092948.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    224   5e-69    
gb|EER45034.1|  60S ribosomal protein L13a                              223   5e-69    
ref|XP_003197368.1|  structural constituent of ribosome                 223   5e-69    
emb|CCX05052.1|  Similar to 60S ribosomal protein L16; acc. no. Q...    223   6e-69    
dbj|BAF98661.1|  ribosomal protein L13a                                 223   6e-69    
ref|XP_007836334.1|  60S ribosomal protein L16                          223   6e-69    
emb|CBN08625.1|  small nucleolar RNA, C/D box 32A                       223   6e-69    
ref|XP_008000485.1|  PREDICTED: 60S ribosomal protein L13a-like i...    224   6e-69    
ref|XP_008031827.1|  60S ribosomal protein L13a                         223   6e-69    
ref|NP_001232687.1|  putative ribosomal protein L13A                    223   6e-69    
ref|XP_001609803.1|  ribosomal protein L13                              223   6e-69    
gb|ERG86236.1|  60s ribosomal protein l13a                              223   6e-69    
ref|XP_003280356.1|  PREDICTED: 60S ribosomal protein L13a-like i...    223   6e-69    
ref|XP_001265069.1|  60S ribosomal protein L16                          223   6e-69    
ref|NP_001187674.1|  60S ribosomal protein l13a                         223   7e-69    
ref|XP_011344385.1|  PREDICTED: 60S ribosomal protein L13a              223   7e-69    
ref|XP_009035047.1|  hypothetical protein AURANDRAFT_58864              223   7e-69    
ref|XP_003661900.1|  hypothetical protein MYCTH_2314728                 223   7e-69    
ref|XP_006631346.1|  PREDICTED: 60S ribosomal protein L13a-like         223   8e-69    
gb|AFM88003.1|  60S ribosomal protein L13a                              223   8e-69    
gb|ACO11694.1|  60S ribosomal protein L13A                              223   8e-69    
ref|XP_007336962.1|  60S ribosomal protein L13a                         223   9e-69    
ref|XP_008213727.1|  PREDICTED: 60S ribosomal protein L13a              223   9e-69    
ref|XP_007359836.1|  60S ribosomal protein L13a                         223   9e-69    
dbj|GAN10069.1|  60S ribosomal protein L16                              223   9e-69    
ref|XP_003257882.1|  PREDICTED: 60S ribosomal protein L13a-like         223   9e-69    
ref|XP_010877924.1|  PREDICTED: 60S ribosomal protein L13a              223   1e-68    
sp|Q91487.1|RL13A_SALTR  RecName: Full=60S ribosomal protein L13a...    222   1e-68    
emb|CCF47368.1|  60S ribosomal protein L16                              222   1e-68    
ref|XP_006454409.1|  ribosomal protein L13                              222   1e-68    
gb|ELR10067.1|  60S ribosomal protein L16                               223   1e-68    
ref|XP_007265503.1|  ribosomal protein L16a                             222   1e-68    
ref|XP_009822374.1|  ribosomal protein L13                              223   1e-68    
ref|XP_005586136.1|  PREDICTED: 60S ribosomal protein L13a-like         222   1e-68    
ref|XP_001816941.1|  60S ribosomal protein L16                          222   1e-68    
ref|XP_007289379.1|  60S ribosomal protein L13                          222   1e-68    
gb|EFX00180.1|  60S ribosomal protein l16                               222   1e-68    
ref|XP_006969355.1|  ribosomal protein L16, L13 family                  222   2e-68    
gb|KEY64902.1|  hypothetical protein S7711_03894                        222   2e-68    
gb|EPB90589.1|  60S ribosomal protein L16                               222   2e-68    
ref|XP_001591799.1|  60S ribosomal protein L16                          222   2e-68    
ref|XP_007763383.1|  ribosomal protein L16a                             222   2e-68    
dbj|GAA83388.1|  serine palmitoyltransferase 2                          222   2e-68    
gb|KIY47036.1|  60S ribosomal protein L13a                              222   2e-68    
gb|EPS27763.1|  hypothetical protein PDE_02707                          222   2e-68    
ref|XP_007892973.1|  PREDICTED: 60S ribosomal protein L13a              222   2e-68    
ref|XP_005534139.1|  PREDICTED: 60S ribosomal protein L13a-like         222   2e-68    
gb|AFJ24771.1|  60S ribosomal protein L13a                              222   2e-68    
gb|KIM85315.1|  hypothetical protein PILCRDRAFT_817318                  222   2e-68    
gb|AFM86006.1|  60S ribosomal protein L13a                              222   2e-68    
gb|EYE99359.1|  ribosomal protein L13                                   222   2e-68    
ref|XP_005538418.1|  60S ribosomal protein L13A                         222   2e-68    
gb|AFM87541.1|  60S ribosomal protein L13a                              222   2e-68    
ref|XP_007778809.1|  60S ribosomal protein L16                          222   2e-68    
emb|CEG62724.1|  Putative 60S ribosomal protein L16                     222   2e-68    
gb|KIM67235.1|  hypothetical protein SCLCIDRAFT_1210745                 221   2e-68    
gb|EKG17306.1|  Ribosomal protein L13 eukaryotic/archaeal               221   2e-68    
gb|KDQ12852.1|  hypothetical protein BOTBODRAFT_34000                   221   3e-68    
ref|XP_007390595.1|  hypothetical protein PHACADRAFT_247592             221   3e-68    
gb|ADC97465.1|  putative 60S ribosomal protein L13a                     221   3e-68    
ref|XP_001398840.1|  60S ribosomal protein L16                          221   3e-68    
gb|KIK91012.1|  hypothetical protein PAXRUDRAFT_831191                  221   3e-68    
ref|XP_007916510.1|  putative 60s ribosomal protein l16 protein         221   3e-68    
ref|XP_007842224.1|  ribosomal protein l13a                             221   3e-68    
ref|XP_001828792.1|  60S ribosomal protein L16                          221   3e-68    
gb|KIL70745.1|  hypothetical protein M378DRAFT_183340                   221   3e-68    
ref|XP_007594433.1|  ribosomal protein L13                              221   3e-68    
gb|KIK28465.1|  hypothetical protein PISMIDRAFT_673469                  221   3e-68    
emb|CCI10404.1|  unnamed protein product                                221   4e-68    
emb|CEP16619.1|  hypothetical protein                                   221   4e-68    
ref|XP_003784550.1|  PREDICTED: 60S ribosomal protein L13a-like i...    221   4e-68    
ref|XP_011494133.1|  PREDICTED: 60S ribosomal protein L13a              221   4e-68    
gb|KIP12424.1|  hypothetical protein PHLGIDRAFT_17577                   221   4e-68    
gb|KID91699.1|  60S ribosomal protein L16                               221   5e-68    
ref|XP_002396666.1|  hypothetical protein MPER_03052                    221   5e-68    
ref|XP_002625192.1|  60S ribosomal protein L16                          221   5e-68    
gb|KFH42461.1|  60S ribosomal protein-like protein                      221   5e-68    
gb|ACG26447.1|  60S ribosomal protein L13a-2                            221   5e-68    
gb|EPB90135.1|  60S ribosomal protein L16                               221   6e-68    
ref|XP_004830849.1|  60S ribosomal protein L13, putative                221   6e-68    
ref|XP_002542528.1|  60S ribosomal protein L16                          221   6e-68    
ref|XP_003047678.1|  60S ribosomal protein L16                          221   6e-68    
ref|XP_011438200.1|  PREDICTED: 60S ribosomal protein L13a-like         221   7e-68    
gb|KFY17505.1|  hypothetical protein V491_04976                         221   7e-68    
gb|KFY13303.1|  hypothetical protein V492_03363                         221   7e-68    
gb|KFO26211.1|  60S ribosomal protein L13a                              231   7e-68    
emb|CCA69106.1|  probable ribosomal protein L13a                        220   7e-68    
gb|KJA29151.1|  hypothetical protein HYPSUDRAFT_175798                  220   8e-68    
ref|XP_007791101.1|  putative 60s ribosomal protein l16 protein         220   8e-68    
gb|KIJ21668.1|  hypothetical protein PAXINDRAFT_64692                   220   8e-68    
gb|KDQ30707.1|  hypothetical protein PLEOSDRAFT_1053876                 220   8e-68    
ref|XP_009222620.1|  60S ribosomal protein L16                          220   9e-68    
ref|XP_002836976.1|  60S ribosomal protein L16                          220   9e-68    



>emb|CDP03876.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   394 bits (1012),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNH DTI+ LE KRKERAQA YERRKQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHADTIRELEAKRKERAQATYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR+KAEKAAEE+LG+QLDILSSVKY
Sbjct  181  RLRIKAEKAAEEKLGSQLDILSSVKY  206



>ref|XP_011073788.1| PREDICTED: 60S ribosomal protein L13a-4 [Sesamum indicum]
Length=206

 Score =   392 bits (1008),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQATYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  181  KLRVKAEKVAEEKLGAQLDIIAPIKY  206



>ref|XP_009789164.1| PREDICTED: 60S ribosomal protein L13a-1 [Nicotiana sylvestris]
Length=206

 Score =   392 bits (1007),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LENKRKERAQA YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRDLENKRKERAQATYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_009622553.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   391 bits (1005),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARRVV+DARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVIDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   391 bits (1004),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIAPIKY  206



>gb|EYU32659.1| hypothetical protein MIMGU_mgv1a013922mg [Erythranthe guttata]
Length=206

 Score =   391 bits (1004),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPFDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  Y RRKQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQTTYLRRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG+QLDI++ +KY
Sbjct  181  KLRLKAEKIAEEKLGSQLDIIAPIKY  206



>ref|XP_009795999.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana sylvestris]
Length=206

 Score =   391 bits (1004),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARRVVVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|XP_009596414.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana tomentosiformis]
Length=206

 Score =   390 bits (1003),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL I++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAIIAPIKY  206



>ref|NP_001275476.1| 60S ribosomal protein L13a-4-like [Solanum tuberosum]
 gb|ABA46790.1| 60S ribosomal protein L13a-like protein [Solanum tuberosum]
Length=206

 Score =   390 bits (1003),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
Length=206

 Score =   390 bits (1001),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_010277234.1| PREDICTED: 60S ribosomal protein L13a-4 [Nelumbo nucifera]
Length=206

 Score =   389 bits (1000),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIKVLE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTIKVLEKKRKERAQVAYERRKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QLDIL+ +KY
Sbjct  181  KLRVKAEKAAEEQLGPQLDILAPIKY  206



>gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Erythranthe guttata]
Length=206

 Score =   389 bits (1000),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRK+RAQA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEQKRKDRAQATYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  181  KLRVKAEKIAEEKLGAQLDIIAPIKY  206



>ref|XP_004239861.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum]
Length=206

 Score =   389 bits (1000),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
Length=206

 Score =   389 bits (1000),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAGRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+L TQLDIL++VKY
Sbjct  181  KLRVKAEKVAEEKLSTQLDILAAVKY  206



>ref|XP_010279449.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   389 bits (999),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAAL RLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALGRLKAYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGW+HYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWSHYDTIKELEKKRKERAQVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG+QLDILS VKY
Sbjct  181  KLRVKAEKAAEEQLGSQLDILSPVKY  206



>ref|XP_009625303.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   389 bits (999),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LENKRKERAQ  YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRDLENKRKERAQVTYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRV+AEKAAEE+LG QL +++ +KY
Sbjct  181  KLRVRAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_009765513.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana sylvestris]
Length=206

 Score =   389 bits (998),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWN+YDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNYYDTIKELENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL I++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAIIAPIKY  206



>ref|XP_011091425.1| PREDICTED: 60S ribosomal protein L13a-4-like [Sesamum indicum]
Length=206

 Score =   388 bits (997),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRK+RAQA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKDRAQATYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG QLDI++ +KY
Sbjct  181  KLRLKAEKVAEEKLGAQLDIIAPIKY  206



>gb|AHE13806.1| ribosomal protein L13a [Solanum torvum]
Length=206

 Score =   388 bits (996),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI A+R+VVDARHHMLGRL+SI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSIIAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVFEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKDLENKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL I++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAIIAPIKY  206



>ref|XP_010920859.1| PREDICTED: 60S ribosomal protein L13a-4-like [Elaeis guineensis]
Length=206

 Score =   388 bits (996),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGW+HYDTIK LE KRK+RAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWSHYDTIKELEAKRKQRAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEKAAEE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEKAAEEKLGSQLDILAPLKY  206



>ref|XP_006298559.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
 gb|EOA31457.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
Length=206

 Score =   387 bits (995),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLASIKY  206



>gb|ADR71263.1| 60S ribosomal protein L13aA [Hevea brasiliensis]
Length=206

 Score =   387 bits (995),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERAQVAYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLDI+S +KY
Sbjct  181  KLRVKAEKVAEEKLGSQLDIISPIKY  206



>ref|XP_010488596.1| PREDICTED: 60S ribosomal protein L13a-2 [Camelina sativa]
Length=206

 Score =   387 bits (994),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLTSIKY  206



>ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 ref|XP_008224495.1| PREDICTED: 60S ribosomal protein L13a-4 [Prunus mume]
 gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=206

 Score =   387 bits (994),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQLAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QL+I++ +KY
Sbjct  181  KLRVKAEKVAEEKLGPQLEIIAPIKY  206



>gb|KHG07795.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   387 bits (993),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAA+LARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAASLARLKAYEGIPAPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LGTQL+++S +KY
Sbjct  181  KLRVKAEKVAEEKLGTQLEVISPIKY  206



>ref|XP_010466918.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   386 bits (992),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+Q D+L+S+KY
Sbjct  181  KLRAKAEKVAEEKLGSQFDVLTSIKY  206



>ref|XP_010937848.1| PREDICTED: 60S ribosomal protein L13a-4 [Elaeis guineensis]
Length=206

 Score =   386 bits (992),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGW+HYDTIK LE KRK+RAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWSHYDTIKELEAKRKQRAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEKVAEEKLGSQLDILAPLKY  206



>gb|ACJ02350.1| 60S ribosomal protein L13A [Vernicia fordii]
Length=206

 Score =   386 bits (991),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKIVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKER+Q  YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKALEKKRKERSQLNYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD++S +KY
Sbjct  181  KLRVKAEKTAEEKLGSQLDVISPIKY  206



>ref|NP_189127.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 sp|Q9LRX8.1|R13A2_ARATH RecName: Full=60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 dbj|BAB02893.1| 60S ribosomal protein L13A-like [Arabidopsis thaliana]
 gb|AAN12937.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AEE76951.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
Length=206

 Score =   385 bits (990),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLASIKY  206



>ref|XP_008793237.1| PREDICTED: 60S ribosomal protein L13a-4 [Phoenix dactylifera]
Length=206

 Score =   385 bits (990),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYD++
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDRM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWN+YDTIK LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNYYDTIKELEAKRKQRSQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEKTAEEKLGSQLDILAPLKY  206



>ref|XP_002518107.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF44240.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   385 bits (990),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERAQVAYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLD+++ +KY
Sbjct  181  KLRVKAEKIAEEKLGPQLDVIAPIKY  206



>ref|XP_010524687.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   385 bits (989),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGHLSSEVGWNHYDTIKELEKKRKERSQAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QLD+L+ VKY
Sbjct  181  KLRAKAEKTAEEKLGAQLDVLAPVKY  206



>ref|XP_010069656.1| PREDICTED: 60S ribosomal protein L13a-2 [Eucalyptus grandis]
 gb|KCW58065.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=206

 Score =   385 bits (989),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQAVYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+Q+DIL++VKY
Sbjct  181  KLRVKAEKVAEEKLGSQVDILATVKY  206



>ref|XP_009136093.1| PREDICTED: 60S ribosomal protein L13a-2 [Brassica rapa]
 emb|CDY15113.1| BnaC03g44740D [Brassica napus]
 emb|CDX93039.1| BnaA03g37610D [Brassica napus]
Length=206

 Score =   385 bits (989),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C++RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RF+RKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFMRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL+
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLS  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ +KY
Sbjct  181  KLRTKAEKVAEEKLGSQLDVLAPIKY  206



>ref|XP_010245584.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   385 bits (989),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGW+HYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWSHYDTIKELERKRKERAQVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAE +LG QLDILS VKY
Sbjct  181  KLRVKAEKAAEVQLGPQLDILSPVKY  206



>gb|AAL87341.1| putative 60S ribosomal protein [Arabidopsis thaliana]
Length=206

 Score =   385 bits (988),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLASIKY  206



>ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
 ref|XP_010442327.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
Length=206

 Score =   385 bits (988),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLD+L+ VKY
Sbjct  181  KLRVKAEKVAEEKLGAQLDVLAPVKY  206



>ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
 ref|XP_006360354.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   385 bits (988),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI A+R+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRL+AGHKYCLLGKLSSEVGWNHYDTI+ LENKRKERAQ  YERRKQL 
Sbjct  121  KRMVIPDALKVLRLRAGHKYCLLGKLSSEVGWNHYDTIRDLENKRKERAQVTYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_009112682.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
 emb|CDY39786.1| BnaA09g10380D [Brassica napus]
 emb|CDY03292.1| BnaC09g10560D [Brassica napus]
Length=206

 Score =   384 bits (987),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKE++QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKEKSQAVYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ +KY
Sbjct  181  KLRTKAEKVAEEKLGSQLDVLAPIKY  206



>gb|KJB30129.1| hypothetical protein B456_005G130900 [Gossypium raimondii]
Length=206

 Score =   384 bits (987),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEISMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LGTQL+++S +KY
Sbjct  181  KLRVKAEKVAEEKLGTQLEVISPIKY  206



>ref|XP_010552053.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   384 bits (987),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERSQAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KA+K AEE+LG+QLD+LS VKY
Sbjct  181  KLRAKAQKTAEEKLGSQLDVLSPVKY  206



>ref|XP_009392721.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   384 bits (987),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+KVLE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKVLEEKRKERAKVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KL++KAEKA EE+LG+QLDIL+ +KY
Sbjct  181  KLKLKAEKAVEEKLGSQLDILAPLKY  206



>emb|CDY52083.1| BnaCnng21840D [Brassica napus]
 emb|CDX77383.1| BnaA07g05210D [Brassica napus]
Length=206

 Score =   384 bits (987),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QLD+L+ +KY
Sbjct  181  KLRTKAEKVAEEKLGAQLDVLAPIKY  206



>ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 1 [Cucumis 
sativus]
Length=241

 Score =   385 bits (989),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  755  KMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY  576
            KMVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY
Sbjct  33   KMVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKY  92

Query  575  HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK  396
             RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK
Sbjct  93   MRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDK  152

Query  395  VKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQL  216
            +KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL
Sbjct  153  MKRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQL  212

Query  215  TKLRVKAEKAAEERLGTQLDILSSVKY  135
             KLR+KAEK AEE+LG QL++++ +KY
Sbjct  213  NKLRIKAEKVAEEKLGPQLEVIAPIKY  239



>ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
 gb|ESQ49321.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
Length=206

 Score =   384 bits (986),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPY+K+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYNKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_009374600.1| PREDICTED: 60S ribosomal protein L13a-4 [Pyrus x bretschneideri]
Length=206

 Score =   384 bits (986),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QL+I++ +KY
Sbjct  181  KLRVKAEKVAEEKLGPQLEIIAPIKY  206



>ref|XP_002883564.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59823.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   384 bits (985),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LGTQLD+LS +KY
Sbjct  181  KLRAKAEKVAEEKLGTQLDVLSPIKY  206



>gb|KHG08426.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB37827.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
 gb|KJB37828.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
Length=206

 Score =   384 bits (985),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QL++++ +KY
Sbjct  181  KLRVKAEKVAEEKLGAQLEVIAPIKY  206



>ref|XP_009404653.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   383 bits (984),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+KVLE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKVLEAKRKERAKVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG QLDIL+ +KY
Sbjct  181  KLRLKAEKTAEEKLGPQLDILAPLKY  206



>ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
 emb|CAN63603.1| hypothetical protein VITISV_006449 [Vitis vinifera]
Length=206

 Score =   383 bits (984),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERA+ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELEKKRKERAELAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAA ++LG+QLD+++ +KY
Sbjct  181  KLRVKAEKAAVDKLGSQLDVIAPIKY  206



>ref|XP_008356990.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
 ref|XP_009348407.1| PREDICTED: 60S ribosomal protein L13a-4-like [Pyrus x bretschneideri]
Length=206

 Score =   383 bits (984),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK+AEE+LG QL+I++ +KY
Sbjct  181  KLRVKAEKSAEEKLGPQLEIIAPIKY  206



>ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like [Camelina sativa]
Length=206

 Score =   383 bits (984),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGH YCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHNYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLD+L+ VKY
Sbjct  181  KLRVKAEKVAEEKLGAQLDVLAPVKY  206



>gb|KDP39375.1| hypothetical protein JCGZ_01132 [Jatropha curcas]
Length=206

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS +AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASTIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERAQ  YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERAQLTYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD+++ +KY
Sbjct  181  KLRVKAEKIAEEKLGSQLDVITPIKY  206



>ref|XP_009102457.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
Length=206

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AE++LG QLD+L+ +KY
Sbjct  181  KLRTKAEKVAEQKLGAQLDVLAPIKY  206



>ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct  181  KLRVKAEKVAEEKLGAQLDILAPVKY  206



>ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
 gb|EOA14009.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
Length=206

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQ+ 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERAQVVYERKKQIN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct  181  KLRVKAEKVAEEKLGAQLDILAPVKY  206



>ref|XP_010440660.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L13a-3-like 
[Camelina sativa]
Length=206

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHM GRLAS LAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGRLASSLAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQATYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KL+ KAEK AEE+LG+QLDIL+ VKY
Sbjct  181  KLKTKAEKVAEEKLGSQLDILAPVKY  206



>ref|NP_187367.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 sp|Q9SFU1.1|R13A1_ARATH RecName: Full=60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AAF20235.1|AC012395_22 putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAG40393.1|AF325041_1 AT3g07110 [Arabidopsis thaliana]
 gb|AAL09790.1| AT3g07110/T1B9_24 [Arabidopsis thaliana]
 gb|AAL32871.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAM47908.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AEE74499.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=206

 Score =   382 bits (982),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQA YER+KQL+
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQAVYERKKQLS  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPVKY  206



>gb|KHG26825.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   382 bits (982),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLV  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QL++++ +KY
Sbjct  181  KLRVKAEKVAEEKLGAQLEVIAPIKY  206



>ref|XP_006418685.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
 gb|ESQ37121.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
Length=206

 Score =   382 bits (982),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK A+E+LG+QLD+L+ +KY
Sbjct  181  KLRTKAEKVADEKLGSQLDVLAPIKY  206



>ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
 gb|EOA31465.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
Length=206

 Score =   382 bits (982),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQL 
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_004139040.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_008450411.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008457247.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008458460.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 gb|KGN61467.1| hypothetical protein Csa_2G138710 [Cucumis sativus]
Length=206

 Score =   382 bits (982),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG QL++++ +KY
Sbjct  181  KLRIKAEKVAEEKLGPQLEVIAPIKY  206



>ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154638.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 3 [Cucumis 
sativus]
Length=208

 Score =   382 bits (982),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG QL++++ +KY
Sbjct  181  KLRIKAEKVAEEKLGPQLEVIAPIKY  206



>ref|XP_009421391.1| PREDICTED: 60S ribosomal protein L13a-4 [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   382 bits (981),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+K LE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKELEAKRKERAKVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG+QLDI++ +KY
Sbjct  181  KLRLKAEKTAEEKLGSQLDIIAPLKY  206



>ref|XP_009111853.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
 emb|CDY00046.1| BnaC09g02550D [Brassica napus]
 emb|CDX86281.1| BnaA06g29980D [Brassica napus]
Length=206

 Score =   382 bits (980),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QL+IL+ VKY
Sbjct  181  KLRAKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_008789105.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   382 bits (980),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVLVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK Y+GVPPPYD++
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYDGVPPPYDRM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKQRSQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEKA EE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEKAVEEKLGSQLDILAPLKY  206



>ref|XP_009403869.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   382 bits (980),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+KVLE KRKERA  AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKVLEAKRKERAAVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEKAA ++LG+QLDIL+ +KY
Sbjct  181  KLRLKAEKAAGDKLGSQLDILAPLKY  206



>ref|XP_010923627.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=246

 Score =   383 bits (984),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -2

Query  761  AAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  582
            AA+MVSGSGIC RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM
Sbjct  38   AAEMVSGSGICTRRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  97

Query  581  KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY  402
            K+ RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPY
Sbjct  98   KFLRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPY  157

Query  401  DKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRK  222
            DK KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW+HYD I+ LE+KRK+R+Q AYERRK
Sbjct  158  DKTKRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSHYDIIRELEDKRKQRSQVAYERRK  217

Query  221  QLTKLRVKAEKAAEERLGTQLDILSSVKY  135
            QL +LR+KAEKAAEE+LG+QL+IL+ +KY
Sbjct  218  QLARLRMKAEKAAEEKLGSQLNILAPLKY  246



>ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
 ref|XP_010486252.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
Length=206

 Score =   382 bits (980),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLGSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQL 
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_004169511.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_008438365.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis melo]
 gb|KGN56740.1| hypothetical protein Csa_3G131930 [Cucumis sativus]
Length=206

 Score =   382 bits (980),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYE++KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYEKKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK A+E+LG QL +++ +KY
Sbjct  181  KLRVKAEKVADEKLGPQLQVIAPIKY  206



>ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
Length=206

 Score =   382 bits (980),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPTPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERA   YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAHVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct  181  KLRVKAEKVAEEKLGAQLDILAPVKY  206



>gb|KFK38165.1| hypothetical protein AALP_AA3G077500 [Arabis alpina]
Length=206

 Score =   381 bits (979),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C++RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGAQLDVLAPVKY  206



>gb|KJB72096.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=206

 Score =   381 bits (979),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QL++++ +KY
Sbjct  181  KLRVKAEKVAEEKLGAQLEVIAPIKY  206



>ref|XP_007034382.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 ref|XP_007034383.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05308.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05309.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
Length=206

 Score =   381 bits (979),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA++VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  181  KLRVKAEKAAEEKLGAQLAVIAPIKY  206



>emb|CDY33947.1| BnaA02g30400D [Brassica napus]
 emb|CDY05663.1| BnaC02g38740D [Brassica napus]
 emb|CDX85362.1| BnaC07g26730D [Brassica napus]
Length=206

 Score =   381 bits (979),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QL+IL+ VKY
Sbjct  181  KLRAKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_008348430.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
Length=206

 Score =   381 bits (979),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG  L+I++ +KY
Sbjct  181  KLRVKAEKVAEEKLGPHLEIIAPIKY  206



>ref|XP_006420899.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 ref|XP_006493807.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|ESR34139.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 gb|KDO61167.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=206

 Score =   381 bits (978),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVP PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPAPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNYYDTIKELEKKRKERAQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEERLG QL+I++ +KY
Sbjct  181  KLRVKAEKAAEERLGPQLEIIAPIKY  206



>ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like [Camelina sativa]
Length=206

 Score =   381 bits (978),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RV VDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVAVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQL 
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_010937601.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=206

 Score =   380 bits (977),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMK+ 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKFL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW+HYDTI+ LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSHYDTIRELEEKRKQRSQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR KAEK AEE+LG+QLDIL+ +KY
Sbjct  181  RLRQKAEKTAEEKLGSQLDILAPLKY  206



>ref|XP_010532891.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   380 bits (977),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIKELEKKRKERSQALYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QL++L+ V+Y
Sbjct  181  KLRAKAEKVAEEKLGPQLNVLAPVRY  206



>ref|XP_006395114.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
 gb|ESQ32400.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
Length=206

 Score =   380 bits (977),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QL+IL+ VKY
Sbjct  181  KLRVKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_009129745.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brassica rapa]
Length=206

 Score =   380 bits (977),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG Q++IL+ VKY
Sbjct  181  KLRAKAEKVAEEKLGAQIEILAPVKY  206



>ref|XP_010110069.1| 60S ribosomal protein L13a-3 [Morus notabilis]
 gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis]
Length=206

 Score =   380 bits (976),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEELCISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEKAAEE+LG+Q+DIL+ VKY
Sbjct  181  KLRTKAEKAAEEKLGSQVDILAPVKY  206



>ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
 ref|XP_004288083.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
Length=206

 Score =   380 bits (976),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKER+Q AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERSQIAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG  L+I++ +KY
Sbjct  181  KLRVKAEKVAEEKLGPHLEIIAPIKY  206



>ref|XP_010069043.1| PREDICTED: 60S ribosomal protein L13a-3 [Eucalyptus grandis]
 gb|KCW57252.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=206

 Score =   380 bits (975),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK +EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKER+Q  YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERSQLLYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG Q++I++ +KY
Sbjct  181  KLRVKAEKAAEEKLGAQMEIIAPIKY  206



>ref|XP_011045655.1| PREDICTED: 60S ribosomal protein L13a-2 [Populus euphratica]
Length=206

 Score =   380 bits (975),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELEMKRKERAQLIYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  181  KLRVKAEKTAEEKLGPQLDIIAPLKY  206



>ref|XP_008786013.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   380 bits (975),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW++YDTI+ LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSYYDTIRELEEKRKQRSQVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LRVKAEKAAEE+LG+QL IL+ +KY
Sbjct  181  RLRVKAEKAAEEKLGSQLSILAPLKY  206



>gb|KHG16481.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB22644.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=206

 Score =   380 bits (975),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKTAEEKLGSQLDILAPVKY  206



>ref|XP_009151676.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
Length=206

 Score =   380 bits (975),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPPKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QL+IL+ VKY
Sbjct  181  KLRAKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobroma cacao]
 gb|EOX93933.1| Ribosomal protein L13 family protein [Theobroma cacao]
Length=206

 Score =   379 bits (974),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MV GSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVCGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKAAEEKLGSQLDILAPVKY  206



>ref|XP_006369799.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
 gb|ABK93590.1| unknown [Populus trichocarpa]
 gb|ERP66368.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
Length=206

 Score =   379 bits (974),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+R+VVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRIVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELEMKRKERAQLIYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  181  KLRVKAEKTAEEKLGPQLDIIAPLKY  206



>ref|XP_009405822.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   379 bits (973),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CAR VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARCVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+K LE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKELEAKRKERAKVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEKAAEE+LG+QLDIL  + Y
Sbjct  181  KLRLKAEKAAEEKLGSQLDILLPLNY  206



>ref|NP_193053.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 sp|Q9SVR0.1|R13A3_ARATH RecName: Full=60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 emb|CAB41927.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 emb|CAB78359.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 gb|AAK97733.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AAL31131.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AEE83240.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
Length=206

 Score =   379 bits (973),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVMYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEERLG+QLD+L+ VKY
Sbjct  181  KLRTKAEKVAEERLGSQLDVLAPVKY  206



>ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   379 bits (973),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKER+Q AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERSQIAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG  L I++ +KY
Sbjct  181  KLRVKAEKVAEEKLGPHLKIIAPIKY  206



>gb|KFK39804.1| hypothetical protein AALP_AA3G290300 [Arabis alpina]
Length=206

 Score =   379 bits (972),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLK++EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKMFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKE++Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKEKSQVVYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ +KY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPIKY  206



>ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39426.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   379 bits (972),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASTTAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKE++Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKEKSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF41246.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   378 bits (970),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI+ LE K+KERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIRELEKKKKERAQVMYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKA+K+AEE+LG+QLDIL+ V Y
Sbjct  181  KLRVKAQKSAEEKLGSQLDILAPVTY  206



>gb|KFK39801.1| hypothetical protein AALP_AA3G289800 [Arabis alpina]
Length=206

 Score =   378 bits (970),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVD RHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLL +LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLNRLSSEVGWNHYDTIKELEAKRKERSQVMYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG QLD+L+ VKY
Sbjct  181  KLRTKAEKVAEEKLGPQLDVLAPVKY  206



>gb|AFK44939.1| unknown [Lotus japonicus]
Length=206

 Score =   378 bits (970),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKVYEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGAAALERLKVYEGIPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI+ LE KRK++AQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGKLSSEVGWNYYDTIRELEKKRKDKAQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK A+E+LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKVADEKLGSQLDILAPVKY  206



>ref|NP_001030654.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AEE74500.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=207

 Score =   378 bits (970),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 196/207 (95%), Gaps = 1/207 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV-LENKRKERAQAAYERRKQL  216
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK  LENKRKERAQA YER+KQL
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQAVYERKKQL  180

Query  215  TKLRVKAEKAAEERLGTQLDILSSVKY  135
            +KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  SKLRAKAEKVAEEKLGSQLDVLAPVKY  207



>ref|XP_006284504.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
 gb|EOA17402.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
Length=217

 Score =   378 bits (971),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHM GRLAS +AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  12   MVSGSGICAKRVVVDARHHMGGRLASSIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  71

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  72   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  131

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  132  KRMVIPDALKVLRLQSGHKYCLLGQLSSEVGWNHYDTIKELETKRKERSQVMYERKKQLN  191

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE LG+QLDIL+ VKY
Sbjct  192  KLRNKAEKVAEENLGSQLDILAPVKY  217



>ref|XP_006840139.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
 gb|ERN01814.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
Length=206

 Score =   378 bits (970),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+ VVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRK RAQ AYERRK+L 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTIKELEEKRKARAQVAYERRKELA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK+AE++LG +L+IL+ +KY
Sbjct  181  KLRVKAEKSAEQQLGPKLEILAPLKY  206



>gb|KJB42469.1| hypothetical protein B456_007G154600 [Gossypium raimondii]
Length=206

 Score =   378 bits (970),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRL  GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ AYER+K+L 
Sbjct  121  KRMVIPDALKVLRLLKGHKYCLLGRLSSEVGWNHYDTIKELEKKRKERAQVAYERKKELN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKAAEEKLGSQLDILAPVKY  206



>ref|XP_010023711.1| PREDICTED: 60S ribosomal protein L13a-4-like [Eucalyptus grandis]
 gb|KCW60057.1| hypothetical protein EUGRSUZ_H02787 [Eucalyptus grandis]
Length=206

 Score =   377 bits (969),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQRVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERAQLVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKA EE+LG  ++I++ + Y
Sbjct  181  KLRVKAEKAVEEKLGPHMEIIAPITY  206



>ref|XP_002882511.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58770.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV-LENKRKERAQAAYERRKQL  216
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK  LENKRKERAQ  YER+KQL
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQVVYERKKQL  180

Query  215  TKLRVKAEKAAEERLGTQLDILSSVKY  135
             KLR KAEK AEE+LG+QL++L+ VKY
Sbjct  181  NKLRAKAEKVAEEKLGSQLEVLAPVKY  207



>gb|EPS58218.1| hypothetical protein M569_16597 [Genlisea aurea]
Length=206

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+R VVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRFVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRK+R+Q+ YE++KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRDLEKKRKDRSQSVYEKKKQLK  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR +AEK AE +LG QLDIL+ +KY
Sbjct  181  KLRARAEKTAEAKLGAQLDILTPIKY  206



>gb|KJB10146.1| hypothetical protein B456_001G186700 [Gossypium raimondii]
Length=206

 Score =   376 bits (966),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P P+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPAPFDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ +YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVSYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD+L  VKY
Sbjct  181  KLRVKAEKTAEEKLGSQLDLLDPVKY  206



>ref|XP_006650608.1| PREDICTED: 60S ribosomal protein L13a-4-like [Oryza brachyantha]
Length=206

 Score =   376 bits (966),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CARRVVVDARHHMLGRL+S++AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLSSVIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI+ LE KRKE+A+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKLAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL+IL+ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLEILAPIKY  206



>gb|KDO61166.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=205

 Score =   375 bits (964),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 1/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVP PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPAPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIKV   KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNYYDTIKV-SKKRKERAQVAYERRKQLA  179

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEERLG QL+I++ +KY
Sbjct  180  KLRVKAEKAAEERLGPQLEIIAPIKY  205



>gb|KHF97469.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   375 bits (964),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P P+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPAPFDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHK+CLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKHCLLGRLSSEVGWNHYDTIRELEKKRKERAQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD+L  VKY
Sbjct  181  KLRVKAEKTAEEKLGSQLDVLDPVKY  206



>ref|XP_010527234.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   375 bits (962),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEIKRKERSQALYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AE+ LG+Q+ +L+ VKY
Sbjct  181  KLRAKAEKVAEDILGSQIAVLAPVKY  206



>ref|XP_002323772.1| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK95932.1| unknown [Populus trichocarpa]
 gb|EEF03905.1| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   375 bits (962),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELETKRKERAQLVYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG Q +I++ +KY
Sbjct  181  KLRLKAEKTAEEKLGPQQEIIAPLKY  206



>ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|KDO65928.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=206

 Score =   374 bits (961),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI+ LE KRKER+Q AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRELEKKRKERSQVAYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLDIL+ VKY
Sbjct  181  KLRAKAEKVAEEKLGSQLDILAPVKY  206



>ref|XP_003559332.1| PREDICTED: 60S ribosomal protein L13a-4 [Brachypodium distachyon]
Length=206

 Score =   374 bits (960),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWN+ DTI+ LE KRKE+A+ AY+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGQLSKEVGWNYADTIRELEEKRKEKAKVAYDRRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LGTQL+IL+ +KY
Sbjct  181  KLRVKAEKTAEEKLGTQLEILAPIKY  206



>ref|XP_008805147.1| PREDICTED: 60S ribosomal protein L13a-2-like [Phoenix dactylifera]
Length=206

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+HYDTIK LE KRK+R+Q AYE RKQL 
Sbjct  121  KRMVIPDALKVLRLQTGHKYCLLGRLSKEVGWSHYDTIKELEEKRKQRSQVAYEGRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR KAEK  EE+LG+QLDIL  +KY
Sbjct  181  RLRQKAEKTTEEKLGSQLDILGPLKY  206



>ref|NP_001130808.1| uncharacterized protein LOC100191912 [Zea mays]
 gb|ACG24933.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG+QL+IL+ +KY
Sbjct  181  KLRVKAEKAAEEKLGSQLEILAPIKY  206



>gb|KHG00254.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   372 bits (954),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKSYEGVPSPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRL  GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ  YER+K+L 
Sbjct  121  KRMVIPDALKVLRLLKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVTYERKKELN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKA+E +LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKASEAKLGSQLDILAPVKY  206



>ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycine max]
 gb|ACU14471.1| unknown [Glycine max]
Length=206

 Score =   371 bits (953),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+A   YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKEKAAVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRVKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_010435310.1| PREDICTED: 60S ribosomal protein L13a-3-like [Camelina sativa]
Length=206

 Score =   371 bits (952),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHM G LAS LAKELLNGQ+VVVVRCEEICLSGGLVR +MKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGLLASSLAKELLNGQKVVVVRCEEICLSGGLVRLRMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+R MIPHKTKRGAAALARLKV+EG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRSMIPHKTKRGAAALARLKVFEGIPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDA KVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDAFKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQATYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLDI + V Y
Sbjct  181  KLRTKAEKVAEEKLGSQLDIFAPVMY  206



>gb|ACF79169.1| unknown [Zea mays]
 tpg|DAA51453.1| TPA: ribosomal protein L13A-like protein [Zea mays]
Length=206

 Score =   371 bits (952),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG+QL+IL+ +KY
Sbjct  181  KLRVKAEKAAEEKLGSQLEILAPIKY  206



>ref|XP_011041875.1| PREDICTED: 60S ribosomal protein L13a-1-like [Populus euphratica]
Length=206

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKR NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYD+ 
Sbjct  61   RFLRKRTNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELEKKRKERAQLVYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG Q +I++ +KY
Sbjct  181  KLRLKAEKTAEEKLGPQQEIIAPLKY  206



>ref|XP_010513787.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEKAAEE+LG+QLD+L+S+KY
Sbjct  181  KLRAKAEKAAEEKLGSQLDVLTSIKY  206



>ref|NP_001276138.1| 60S ribosomal protein L13a-4-like [Glycine max]
 gb|ACU20583.1| unknown [Glycine max]
Length=206

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPY K+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYGKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+AQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTIRELEKKRKEKAQLVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AE++LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKVAEDKLGSQLDILAPVKY  206



>ref|XP_002466431.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
 gb|AAM47582.1| putative 60S ribosomal protein [Sorghum bicolor]
 gb|EER93429.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
Length=206

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  181  KLRVKAEKTAEEKLGSQLEILAPIKY  206



>ref|NP_001051314.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|AAR01683.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
 gb|ABF98951.1| 60S ribosomal protein L13a-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13228.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|EAY91906.1| hypothetical protein OsI_13588 [Oryza sativa Indica Group]
 gb|EAZ28629.1| hypothetical protein OsJ_12636 [Oryza sativa Japonica Group]
 dbj|BAG96308.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01442.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI+ LE KRKE+A+ AY+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKVAYDRRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL+IL+ +KY
Sbjct  181  KLRVKAEKAAEEKLGPQLEILAPIKY  206



>ref|XP_006586250.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
 gb|KHN07181.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=206

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI+ LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKERAQLCYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+Q++IL+ VKY
Sbjct  181  KLRVKAEKVAEEKLGSQIEILAPVKY  206



>ref|XP_007200528.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
 gb|EMJ01727.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
Length=206

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVD RHHMLGRLAS++AK+LLNGQR+ VVRC+EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRCDEIAISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIPHKTKRGA ALARLK YEG+PPPYDK 
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIPHKTKRGAEALARLKAYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNH+DTIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHFDTIKALEEKRKERAQLAYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK+AEE+LG+QLDIL+SV Y
Sbjct  181  KLRLKAEKSAEEKLGSQLDILASVTY  206



>ref|XP_004499225.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
 ref|XP_004499231.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
Length=206

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q AYER+KQL+
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQLAYERKKQLS  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK  +E+L  QL++L+ VKY
Sbjct  181  KLRAKAEKIVDEKLAPQLEVLAPVKY  206



>ref|NP_001281205.1| 60S ribosomal protein L13a [Zea mays]
 gb|ACN25827.1| unknown [Zea mays]
 gb|AFW67581.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAE  AEE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEATAEEKLGSQLDILTPIKY  206



>gb|KDP26388.1| hypothetical protein JCGZ_17546 [Jatropha curcas]
Length=206

 Score =   369 bits (947),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA++VVVDARHHMLGRLAS++AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASVVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR P+KI WRT+RGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKIFWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERSQILYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAE+ AEE+LG+QL++L+ VKY
Sbjct  181  KLRLKAERVAEEKLGSQLEVLAPVKY  206



>ref|XP_004981725.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X2 [Setaria 
italica]
Length=206

 Score =   369 bits (946),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  181  KLRVKAEKTAEEKLGSQLEILAPIKY  206



>ref|XP_010547080.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   368 bits (945),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKL  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLG LSSEVGWNHYDTIK LE KRKE++QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGHLSSEVGWNHYDTIKELEKKRKEKSQAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  181  KLRAKAEKTAEEKLGSQLDVLAPVKY  206



>pdb|3J61|O Chain O, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50984.1| ribosomal protein L13a [Triticum aestivum]
 dbj|BAJ92402.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50837.1| 60S ribosomal protein L13a-4 [Triticum urartu]
 gb|EMT20078.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=206

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKT RG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH+YCLLG+LS EVGWN+ DTI+ LE KRKE+A+ +Y+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTIRELEEKRKEKAKVSYDRRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LGTQL+IL+ +KY
Sbjct  181  KLRVKAEKAAEEKLGTQLEILAPIKY  206



>ref|XP_007140600.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
 gb|AGV54439.1| 60S ribosomal protein L13a [Phaseolus vulgaris]
 gb|ESW12594.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
Length=206

 Score =   367 bits (943),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AAL RLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALDRLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI+ LE KRK+RA   YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGKLSSEVGWNYYDTIRELEKKRKDRALLCYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+Q++IL+ VKY
Sbjct  181  KLRVKAEKVAEEKLGSQIEILAPVKY  206



>ref|XP_003616742.1| 60S ribosomal protein L13A [Medicago truncatula]
 gb|AES99700.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   367 bits (941),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHK+CLLG+LS+EVGWN+YD IK LENKRKER+Q AYE++KQ+ 
Sbjct  121  KRMVVPDALKVLRLQKGHKFCLLGQLSAEVGWNYYDIIKELENKRKERSQLAYEKKKQIN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK  +E+LG++L +L+ VKY
Sbjct  181  KLRVKAEKIVDEKLGSELQVLAPVKY  206



>gb|ACG36118.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   367 bits (941),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+VIPDALKVLRLQ GHKYCLLG+L  EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELXKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAE  AEE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEATAEEKLGSQLDILTPIKY  206



>ref|XP_002439183.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
 gb|EES17613.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
Length=206

 Score =   366 bits (940),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+ A+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGLSAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  181  KLRVKAEKTAEEKLGSQLEILAPIKY  206



>gb|ACG33474.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   366 bits (939),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSH PIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHRPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAE  AEE+LG+QLDIL+ +KY
Sbjct  181  KLRLKAEATAEEKLGSQLDILTPIKY  206



>ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
 gb|ESR56842.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
Length=382

 Score =   372 bits (956),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  177  MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  236

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  237  RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  296

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI+ LE KRKER+Q AYER+KQL 
Sbjct  297  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRELEKKRKERSQVAYERKKQLN  356

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AEE+LG+QLDIL+ VKY
Sbjct  357  KLRAKAEKVAEEKLGSQLDILAPVKY  382



>gb|KCW58066.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=240

 Score =   367 bits (942),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 196/240 (82%), Gaps = 34/240 (14%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALK----------------------------------VLRLQAGHKYCLLGKL  315
            KRMVIPDALK                                  VLRLQ GHKYCLLG+L
Sbjct  121  KRMVIPDALKYVSCFHLCCVHFGTVFSVVAYVNLMCNLHCDLYRVLRLQKGHKYCLLGRL  180

Query  314  SSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  135
            SSEVGWNHYDTI+ LE KRKERAQA YER+KQLTKLRVKAEK AEE+LG+Q+DIL++VKY
Sbjct  181  SSEVGWNHYDTIRELEKKRKERAQAVYERKKQLTKLRVKAEKVAEEKLGSQVDILATVKY  240



>gb|AFK34830.1| unknown [Medicago truncatula]
Length=206

 Score =   365 bits (938),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKP+HGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPNHGPIHFRAPSKIFWRTLRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHK+CLLG+LS+EVGWN+YD IK LENKRKER+Q AYE++KQ+ 
Sbjct  121  KRMVVPDALKVLRLQKGHKFCLLGQLSAEVGWNYYDIIKELENKRKERSQLAYEKKKQIN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK  +E+LG++L +L+ VKY
Sbjct  181  KLRVKAEKIVDEKLGSELQVLAPVKY  206



>ref|XP_011024678.1| PREDICTED: 60S ribosomal protein L13a-4-like [Populus euphratica]
Length=206

 Score =   365 bits (938),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+ VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTK+G AALARL+ YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKGEAALARLRAYEGIPPPYDKK  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI+ LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIRELEEKRKERSQVRYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAE  AEE+LG Q+DIL+ VKY
Sbjct  181  KLRAKAEATAEEKLGPQVDILAPVKY  206



>ref|XP_003546257.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
Length=206

 Score =   365 bits (937),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVAVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC+LG+LS EVGW++YDTI+ LE KRKE+A+  Y R+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSPEVGWSYYDTIRELEKKRKEKAELVYARKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD+L++VKY
Sbjct  181  KLRVKAEKVAEEKLGSQLDVLAAVKY  206



>ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
 gb|ESW19480.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
Length=206

 Score =   365 bits (936),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AAL RLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALDRLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRK++A   YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKDKAGLVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK A+E+LG+QLDIL+ VKY
Sbjct  181  KLRVKAEKVADEKLGSQLDILAPVKY  206



>gb|KHN07182.1| 60S ribosomal protein L13a-1 [Glycine soja]
Length=206

 Score =   365 bits (936),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI+ LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKERAQLCYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AE++LG+Q++IL+ VKY
Sbjct  181  KLREKAEKVAEKKLGSQIEILAPVKY  206



>gb|AAR89618.1| 60S ribosomal protein L13a [Capsicum annuum]
Length=220

 Score =   364 bits (934),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/188 (94%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LE+KRKERAQ  YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELEDKRKERAQVTYERRKQLA  180

Query  212  KLRVKAEK  189
            KLRVKAE+
Sbjct  181  KLRVKAER  188



>ref|NP_001236202.1| uncharacterized protein LOC100527190 [Glycine max]
 gb|ACU16241.1| unknown [Glycine max]
Length=206

 Score =   363 bits (932),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI+ LE KRK+RAQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKDRAQLCYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK AE++LG+Q++IL+ VKY
Sbjct  181  KLREKAEKVAEKKLGSQIEILAPVKY  206



>ref|XP_008235481.1| PREDICTED: 60S ribosomal protein L13a-1-like [Prunus mume]
Length=206

 Score =   363 bits (932),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGIC +RVVVD RHHMLGRLAS++AK+LLNGQR+ VVR +EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICLKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRSDEIAISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIPHKTKRGA ALARLK YEG+PPPYDK 
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIPHKTKRGAEALARLKAYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNH+DTIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHFDTIKALEEKRKERAQLAYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK+AEERLG+QL+IL+SV Y
Sbjct  181  KLRLKAEKSAEERLGSQLEILASVTY  206



>gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=204

 Score =   363 bits (931),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 191/206 (93%), Gaps = 2/206 (1%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLAS   KELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLAS--EKELLNGQKVAVVRCEEICISGGLVRQKMKYL  58

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  59   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  118

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+AQ  YER+KQL 
Sbjct  119  KRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTIRELEKKRKEKAQLVYERKKQLN  178

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AE++LG+QLDIL+ VKY
Sbjct  179  KLRVKAEKVAEDKLGSQLDILAPVKY  204



>ref|NP_001058724.1| Os07g0109500 [Oryza sativa Japonica Group]
 dbj|BAC79560.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAD30642.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF20638.1| Os07g0109500 [Oryza sativa Japonica Group]
 gb|EAZ02520.1| hypothetical protein OsI_24624 [Oryza sativa Indica Group]
 dbj|BAG88872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   363 bits (931),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQLT
Sbjct  121  KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LRVKAEKAAEE+LG+Q+DIL+ +KY
Sbjct  181  RLRVKAEKAAEEKLGSQIDILAPIKY  206



>ref|XP_010685006.1| PREDICTED: 60S ribosomal protein L13a-2 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   363 bits (931),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+ A+RVVVDARHHM GRLASI+AKELL GQRVVV RCE I LSGGLVRQKMKY 
Sbjct  1    MVSGSGVMAKRVVVDARHHMCGRLASIVAKELLTGQRVVVTRCEAIALSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+V+PDALKVLRLQ GHKYCLLG+LS EVGWNHYDTI+ LE KRKER++A YER+KQL 
Sbjct  121  KRVVVPDALKVLRLQKGHKYCLLGRLSKEVGWNHYDTIRELEEKRKERSKAVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LRVKAEK AEE+LG+QL+IL+ VKY
Sbjct  181  RLRVKAEKTAEEKLGSQLEILAPVKY  206



>ref|XP_002301785.2| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK92693.1| unknown [Populus trichocarpa]
 gb|ABK94779.1| unknown [Populus trichocarpa]
 gb|EEE81058.2| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   362 bits (930),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+ V+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVLVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTK+G AALARLK YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKGEAALARLKAYEGIPPPYDKK  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYD I+ LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDIIRELEEKRKERSQVRYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAE  AEE+LG Q+DIL+ VKY
Sbjct  181  KLRAKAEVTAEEKLGPQVDILAPVKY  206



>ref|XP_010228462.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brachypodium distachyon]
Length=206

 Score =   362 bits (929),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEISVSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK YEGVPPP+D+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAYEGVPPPFDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQAGHKYC LG+LS EVGWN+ DTI+ LE KRKE+A+ +Y+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCQLGELSKEVGWNYQDTIRELEEKRKEKAKVSYDRRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG+QLDIL+ +KY
Sbjct  181  KLRVKAEKAAEEKLGSQLDILAPIKY  206



>gb|ABQ57364.1| ribosomal protein L13A [Lupinus luteus]
Length=206

 Score =   361 bits (926),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+V+PDALK LRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRLVVPDALKGLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAE+ A+E+LG+QLDIL+ VKY
Sbjct  181  KLRVKAEQVAQEKLGSQLDILAPVKY  206



>gb|ACG48503.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   360 bits (924),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            K MVIPDALKVLRLQ GHKYCLLG+L  EVGWN +D I+ LE KRKE+A+ AYER+KQL 
Sbjct  121  KXMVIPDALKVLRLQPGHKYCLLGELXKEVGWNXHDXIRELEEKRKEKAKVAYERKKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEKAAEE+LG QL+I + +KY
Sbjct  181  KLRVKAEKAAEEKLGXQLEIXAPIKY  206



>ref|XP_008365936.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=206

 Score =   360 bits (923),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+P PYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPXPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQLT
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTIKELENKRKERAQLXYERKKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK+AEE++G+QL++LSSV Y
Sbjct  181  KLRLKAEKSAEEKIGSQLELLSSVTY  206



>gb|EAZ38446.1| hypothetical protein OsJ_22825 [Oryza sativa Japonica Group]
Length=206

 Score =   358 bits (920),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVP PYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPLPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQLT
Sbjct  121  KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LRVKAEKAAEE+LG+Q+DIL+ +KY
Sbjct  181  RLRVKAEKAAEEKLGSQIDILAPIKY  206



>ref|XP_009334926.1| PREDICTED: 60S ribosomal protein L13a-1-like [Pyrus x bretschneideri]
Length=206

 Score =   358 bits (918),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVD  HHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGHHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRM +PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ AYER+K+LT
Sbjct  121  KRMAVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTIKELENKRKERAQLAYERKKRLT  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+K+EK+AEE++G+QL++LSSV Y
Sbjct  181  KLRLKSEKSAEEKIGSQLELLSSVTY  206



>gb|ACJ83838.1| unknown [Medicago truncatula]
 gb|AFK37771.1| unknown [Medicago truncatula]
 gb|KEH22805.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   356 bits (914),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALAR+KVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARMKVYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYC LG+LS+EVGWN+  TIK LE KRKERA AAYE++KQ+ 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCSLGQLSAEVGWNYAGTIKELETKRKERAFAAYEKKKQIN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK  +E+L  QL+IL+ VKY
Sbjct  181  KLRAKAEKIVDEKLAPQLEILAPVKY  206



>gb|ACG37566.1| 60S ribosomal protein L13a [Zea mays]
Length=222

 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R  VDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRXXVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILS  147
            KLR+KAE  AEE+LG+QL I S
Sbjct  181  KLRLKAEATAEEKLGSQLAISS  202



>sp|O49885.1|RL13A_LUPLU RecName: Full=60S ribosomal protein L13a [Lupinus luteus]
 emb|CAA11283.1| ribosomal protein L13a [Lupinus luteus]
Length=205

 Score =   353 bits (906),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIH  APSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct  61   RFLRKRMNTKPSHGPIHC-APSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ  119

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KR+V+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q  YER+KQL 
Sbjct  120  KRLVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLN  179

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAE+ A+E+LG+QLDIL+ VKY
Sbjct  180  KLRVKAEQVAQEKLGSQLDILAPVKY  205



>ref|XP_003589380.1| 60S ribosomal protein L13a [Medicago truncatula]
 gb|ACJ85949.1| unknown [Medicago truncatula]
 gb|AES59631.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
 gb|AFK44083.1| unknown [Medicago truncatula]
Length=206

 Score =   353 bits (905),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWN+   IK LE+KRKERA  AYE++K L 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYGGIIKELEDKRKERAGLAYEKKKLLN  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEK  +E+L  QL++L+ VKY
Sbjct  181  KLRAKAEKIVDEKLAPQLEVLAPVKY  206



>sp|O65055.1|RL13A_PICMA RecName: Full=60S ribosomal protein L13a [Picea mariana]
 gb|AAC32117.1| probable 60s ribosomal protein L13a [Picea mariana]
Length=206

 Score =   350 bits (897),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALA L+ +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALATLRAFEGVPPPYDRK  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ +YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQVSYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KA + AE++L  ++++L+S+KY
Sbjct  181  KLRSKAVELAEKQLAPEMELLASLKY  206



>ref|XP_006657401.1| PREDICTED: 60S ribosomal protein L13a-3-like [Oryza brachyantha]
Length=206

 Score =   349 bits (896),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C RRVVVDAR+HM+GRLAS +AKELLNGQRVVVVRCEE+C+SGG VRQKMKY 
Sbjct  1    MVSGSGVCRRRVVVDARNHMMGRLASAVAKELLNGQRVVVVRCEEMCVSGGPVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK + GVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALAALKAFGGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG LS EVGWN++DTI+ LE KRKE+ + AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGHLSKEVGWNYHDTIRELEEKRKEKGKVAYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEKAAEE+LG+QLDIL+ +KY
Sbjct  181  KLRFKAEKAAEEKLGSQLDILAPIKY  206



>ref|XP_004981724.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X1 [Setaria 
italica]
Length=241

 Score =   350 bits (897),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 194/241 (80%), Gaps = 35/241 (15%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG-----------------------------  480
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRG                             
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGYVSSFLDPSPVRRRCFDVPIFQFVGEIFC  120

Query  479  ------MIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGK  318
                  MIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+
Sbjct  121  LLWFCRMIPHKTKRGEAALARLKTYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGE  180

Query  317  LSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVK  138
            LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL KLRVKAEK AEE+LG+QL+IL+ +K
Sbjct  181  LSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRVKAEKTAEEKLGSQLEILAPIK  240

Query  137  Y  135
            Y
Sbjct  241  Y  241



>dbj|BAK07924.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -2

Query  776  E*REDAAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGL  597
            E R     MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGL
Sbjct  37   EGRSQQVTMVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGL  96

Query  596  VRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG  417
            VRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKT RG AALARLK +EG
Sbjct  97   VRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTPRGEAALARLKAFEG  156

Query  416  VPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAA  237
            VPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+++TIK LE KRKE+A+ +
Sbjct  157  VPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHETIKELEEKRKEKAKVS  216

Query  236  YERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  135
            Y+RRKQL KLRVKAEKAAEE+LG+QLDIL+ +KY
Sbjct  217  YDRRKQLAKLRVKAEKAAEEKLGSQLDILAPIKY  250



>gb|EMS52180.1| 60S ribosomal protein L13a-4 [Triticum urartu]
Length=206

 Score =   341 bits (874),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAFEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GH++CLLG+LS EVGWN+++TIK LE KRKE+A+ +Y+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHRFCLLGELSKEVGWNYHETIKELEEKRKEKAKVSYDRRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KAEKAAEE+LG+QLDIL+ +KY
Sbjct  181  KLRFKAEKAAEEKLGSQLDILAPIKY  206



>gb|EMT05694.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=238

 Score =   341 bits (874),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 192/238 (81%), Gaps = 32/238 (13%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAFEGVPPPYDRT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV--------------------  273
            KRMVIPDALKVLRLQ GH++CLLG+LS EVGWN+++TIK+                    
Sbjct  121  KRMVIPDALKVLRLQPGHRFCLLGELSKEVGWNYHETIKLMAIDHQDLQRDVRFLIGGLF  180

Query  272  ------------LENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  135
                        LE KRKE+A+ +Y+R+KQL KLR+KAE AAEE+LG+QLDIL+ +KY
Sbjct  181  LILDLSACLENELEEKRKEKAKLSYDRKKQLAKLRIKAENAAEEKLGSQLDILAPIKY  238



>ref|XP_001774253.1| predicted protein [Physcomitrella patens]
 gb|EDQ60889.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK ++   YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSNVFYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR+KA K  EE+L +  + L+ + Y
Sbjct  181  QLRLKATKRVEEQLSSLQETLAPITY  206



>ref|XP_001763759.1| predicted protein [Physcomitrella patens]
 gb|EDQ71401.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ++VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKIVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR+KA K+ EE+L    + L+ + Y
Sbjct  181  QLRLKAAKSVEEQLAPLQETLAPITY  206



>ref|XP_001765352.1| predicted protein [Physcomitrella patens]
 gb|EDQ69815.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRL+ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLKPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR+KA K  EE+LG+  + L+ + Y
Sbjct  181  QLRLKAAKRVEEQLGSLQETLAPITY  206



>gb|KGN66498.1| hypothetical protein Csa_1G615170 [Cucumis sativus]
Length=202

 Score =   337 bits (863),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 187/206 (91%), Gaps = 4/206 (2%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+   Y+ V
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGL-CIYELV  119

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
               ++    +VLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL 
Sbjct  120  ---MLVWKFRVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLN  176

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR+KAEK AEE+LG QL++++ +KY
Sbjct  177  KLRIKAEKVAEEKLGPQLEVIAPIKY  202



>gb|ABK22228.1| unknown [Picea sitchensis]
 gb|ABK22389.1| unknown [Picea sitchensis]
 gb|ABK22608.1| unknown [Picea sitchensis]
 gb|ABK23686.1| unknown [Picea sitchensis]
 gb|ABK23694.1| unknown [Picea sitchensis]
 gb|ABK26243.1| unknown [Picea sitchensis]
 gb|ABK26404.1| unknown [Picea sitchensis]
 gb|ABR17228.1| unknown [Picea sitchensis]
 gb|ACN40291.1| unknown [Picea sitchensis]
 gb|ACN40454.1| unknown [Picea sitchensis]
 gb|ACN40588.1| unknown [Picea sitchensis]
 gb|ACN40688.1| unknown [Picea sitchensis]
 gb|ADE77397.1| unknown [Picea sitchensis]
Length=206

 Score =   336 bits (862),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALARL+ +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALARLRAFEGVPPPYDRK  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ +YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQVSYERRKQLA  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KA + AE++L  ++++L+S+KY
Sbjct  181  KLRSKAVELAEKQLAPEMELLASLKY  206



>ref|XP_001765905.1| predicted protein [Physcomitrella patens]
 gb|EDQ69226.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   336 bits (862),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  Y+R+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYQRKKQLL  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR+KA K  EE+LG+  + L+ + Y
Sbjct  181  QLRLKAAKRVEEQLGSLQETLAPITY  206



>ref|XP_001773626.1| predicted protein [Physcomitrella patens]
 gb|EDQ61514.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   333 bits (855),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+ VVVDARHHMLGRLASIL+KELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILSKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYERKKQLI  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            +LR+KA K  EE+L +  + L+ + Y
Sbjct  181  QLRLKATKRVEEQLSSLQETLAPITY  206



>ref|XP_002964465.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
 ref|XP_002975331.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ23532.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ34798.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
Length=206

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG CAR VV+DARHHMLGRLASI AKELLNGQR+V+ RCEEI LSGGLVRQKMKY 
Sbjct  1    MVSGSGACARVVVIDARHHMLGRLASIAAKELLNGQRLVITRCEEIALSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPS GPIHFRAP++ILWRTIRGMIPHKTKRGAAAL RLKV+EG PPPYDK 
Sbjct  61   RFLRKRMNTKPSKGPIHFRAPARILWRTIRGMIPHKTKRGAAALERLKVFEGCPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            K+MV+PDALKVLRL+ GHK+CLLG+LS EVGW+H++TIK LE KRK +A   Y+++K+L 
Sbjct  121  KKMVVPDALKVLRLKPGHKFCLLGQLSKEVGWHHHETIKELEEKRKAKALVFYQKKKELL  180

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLR KA  AAEE+L     +L  + Y
Sbjct  181  KLRQKALTAAEEKLPEVKAVLDPLSY  206



>ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 gb|EMJ24647.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=187

 Score =   317 bits (813),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIKV
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKV  160



>ref|XP_006855707.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
 gb|ERN17174.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
Length=171

 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/161 (95%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICAR VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAAL+RLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALSRLKVYEGVPPPYDKK  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVL  270
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIKV+
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTIKVI  161



>gb|KJB72097.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=169

 Score =   314 bits (804),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKM  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIKV
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKV  160



>gb|AIC33046.1| 60S ribosomal protein L13a, partial [Panax ginseng]
Length=157

 Score =   313 bits (802),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/157 (96%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDT  282
            KRMVIPDALKVLRLQAGHKYCLLG+LS+EVGWN+YDT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSAEVGWNYYDT  157



>gb|KCW57253.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=181

 Score =   312 bits (799),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK +EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTFEGVPPPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIKV
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKV  160



>gb|KCW58067.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=174

 Score =   310 bits (795),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+V
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRV  160



>ref|XP_004955326.1| PREDICTED: 60S ribosomal protein L13a-3-like [Setaria italica]
Length=200

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 174/206 (84%), Gaps = 6/206 (3%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSG       VVVDAR HM+GRLAS +AKELL GQRV V+RCEE+ LSGGLVRQK ++ 
Sbjct  1    MVSGC------VVVDARGHMMGRLASAVAKELLKGQRVAVLRCEEMTLSGGLVRQKSRFL  54

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGP+H R+P++I WR +RGM+PHKT RG AALARL+ ++GVPPPYD+ 
Sbjct  55   RFLRKRMNTKPSHGPVHHRSPARIFWRAVRGMVPHKTARGEAALARLQAFDGVPPPYDRT  114

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  213
            KRMVIPDALKVLRLQ GHKYCLLG LS EVGWN+ DTI+ LE KRKE+A+ AY+R+KQL 
Sbjct  115  KRMVIPDALKVLRLQKGHKYCLLGDLSKEVGWNYQDTIRELEEKRKEKAKVAYDRKKQLA  174

Query  212  KLRVKAEKAAEERLGTQLDILSSVKY  135
            KLRVKAEK AEE+LG+QLD+L+ V Y
Sbjct  175  KLRVKAEKVAEEKLGSQLDVLAPVTY  200



>gb|KJB22645.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=173

 Score =   307 bits (787),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+V
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRV  160



>gb|KDO65929.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=179

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI+V
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRV  160



>gb|ACN36734.1| unknown [Zea mays]
 gb|AFW67580.1| hypothetical protein ZEAMMB73_211853 [Zea mays]
Length=179

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+V
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRV  160



>ref|XP_008382629.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=161

 Score =   288 bits (738),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+P PYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPXPYDKT  120

Query  392  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  273
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIKV
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTIKV  160



>gb|AAX92709.1| 60S ribosomal protein L13a [Picea abies]
Length=170

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  644  RVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHK  465
            RVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHK
Sbjct  1    RVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHK  60

Query  464  TKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYD  285
            TKRGAAALARL+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+D
Sbjct  61   TKRGAAALARLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFD  120

Query  284  TIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  135
            TI  LE KRK +AQ +YERRKQL KLR KA + AE++L  ++++L+S+K+
Sbjct  121  TITELEEKRKAKAQVSYERRKQLAKLRSKAVELAEKQLAPEMELLASLKH  170



>emb|CBI37325.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  554  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  375
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIP  60

Query  374  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  195
            DALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQLTKLRVKA
Sbjct  61   DALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLTKLRVKA  120

Query  194  EKAAEERLGTQLDILSSVKY  135
            EK AEE+L TQLDIL++VKY
Sbjct  121  EKVAEEKLSTQLDILAAVKY  140



>gb|KHN23001.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=150

 Score =   264 bits (675),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  584  MKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP  405
            MKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPP
Sbjct  1    MKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPP  60

Query  404  YDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERR  225
            YDK KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+A   YER+
Sbjct  61   YDKTKRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKEKAAVVYERK  120

Query  224  KQLTKLRVKAEKAAEERLGTQLDILSSVKY  135
            KQL KLRVKAEK AEE+LG+QLD+L+ VKY
Sbjct  121  KQLNKLRVKAEKVAEEKLGSQLDVLAPVKY  150



>emb|CDO99456.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  554  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  375
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGIPPPYDKIKRMVIP  60

Query  374  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  195
            DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKERAQ AY+R+KQLT+LR+KA
Sbjct  61   DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERAQVAYQRKKQLTQLRIKA  120

Query  194  EKAAEERLGTQLDILSSVKY  135
            EKAAEE+LG QL++++ +KY
Sbjct  121  EKAAEEKLGPQLEVIAPIKY  140



>emb|CBI17324.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   256 bits (654),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  554  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  375
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIP  60

Query  374  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  195
            DALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERA+ AYER+KQL KLRVKA
Sbjct  61   DALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELEKKRKERAELAYERKKQLNKLRVKA  120

Query  194  EKAAEERLGTQLDILSSVKY  135
            EKAA ++LG+QLD+++ +KY
Sbjct  121  EKAAVDKLGSQLDVIAPIKY  140



>ref|XP_002953387.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45697.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=185

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            VV+D R HMLGRLAS++AK++L+GQ++VVVR E+I +SGGLVRQKMKY RFLRKRMNT P
Sbjct  5    VVIDGRAHMLGRLASVVAKQILSGQQIVVVRAEDITISGGLVRQKMKYDRFLRKRMNTNP  64

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            + GP HFRAPS+I WRT+RGMIPHKT RGAAAL RLK +EGVP PYDKVKRMV+PDALKV
Sbjct  65   TRGPFHFRAPSRIFWRTVRGMIPHKTARGAAALERLKAFEGVPHPYDKVKRMVVPDALKV  124

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  195
            LRLQ GH+ C LG LS+ VGW H   +  LE KRK +A+A Y  +K+L  LRVKA
Sbjct  125  LRLQHGHRCCKLGDLSAAVGWKHQAAVAELEEKRKAKAKAFYVAKKKLIALRVKA  179



>ref|XP_005849945.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
 gb|EFN57843.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
Length=180

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  CARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRM  552
            C + VVVD R HMLGRLAS+LAK+LL+GQ VV VRCEEI +SGG+VRQK KY RFLRKR 
Sbjct  1    CVQTVVVDCRGHMLGRLASVLAKQLLSGQHVVCVRCEEINISGGMVRQKAKYERFLRKRS  60

Query  551  NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPD  372
             T P  G + FRAPS+ILWRT+RGM PHKT RGAAAL RLK +EG+P PYDKVKRMVIPD
Sbjct  61   VTNPRRGAVKFRAPSRILWRTVRGMTPHKTARGAAALERLKAFEGIPAPYDKVKRMVIPD  120

Query  371  ALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAE  192
            ALKVLRLQ GH+YC LG L+S VGW H + +K LE KRK ++ A YE +K+L  LR KAE
Sbjct  121  ALKVLRLQHGHRYCQLGNLASSVGWKHEEAVKELEAKRKVKSAAYYEAKKKLRSLRAKAE  180



>gb|AFK39539.1| unknown [Lotus japonicus]
Length=140

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  554  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  375
            MNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKVYEG+PPPYDKVKRMV+P
Sbjct  1    MNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGAAALERLKVYEGIPPPYDKVKRMVVP  60

Query  374  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  195
            DALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI+ LE KRK++AQ  YER+KQL KLRVKA
Sbjct  61   DALKVLRLQKGHKYCLLGKLSSEVGWNYYDTIRELEKKRKDKAQVVYERKKQLNKLRVKA  120

Query  194  EKAAEERLGTQLDILSSVKY  135
            EK A+E+LG+QLDIL+ VKY
Sbjct  121  EKVADEKLGSQLDILAPVKY  140



>ref|XP_001692909.1| ribosomal protein L13a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03478.1| ribosomal protein L13a [Chlamydomonas reinhardtii]
Length=185

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            VV+D R HMLGRLAS++AK++L GQ++VVVR EEI +SGGLVRQKMKY RFLRKRMNT P
Sbjct  5    VVIDGRAHMLGRLASVVAKQILAGQQIVVVRAEEITISGGLVRQKMKYDRFLRKRMNTNP  64

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            + GP HFRAPS+I WRT+RGMIPHKT RGAAAL RLK +EG+P PYDKVKR+V+PDALKV
Sbjct  65   TRGPFHFRAPSRIFWRTVRGMIPHKTARGAAALERLKAFEGIPHPYDKVKRLVVPDALKV  124

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  195
            LRLQ GH+ C LG LS+ VGW H   +  LE KRK +A+A Y  +K+L  LR KA
Sbjct  125  LRLQHGHRNCKLGDLSASVGWKHQAAVAELEEKRKAKAKAFYVAKKKLVALRSKA  179



>ref|XP_004168353.1| PREDICTED: 60S ribosomal protein L13a-3-like, partial [Cucumis 
sativus]
Length=137

 Score =   251 bits (642),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  545  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  366
            KPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDAL
Sbjct  1    KPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDAL  60

Query  365  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKA  186
            KVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL KLR+KAEK 
Sbjct  61   KVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAEKV  120

Query  185  AEERLGTQLDILSSVKY  135
            AEE+LG QL++++ +KY
Sbjct  121  AEEKLGPQLEVIAPIKY  137



>gb|KDO65930.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=130

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -2

Query  752  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  573
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  572  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  393
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  392  KRMVIPDALK  363
            KRMVIPDALK
Sbjct  121  KRMVIPDALK  130



>ref|XP_005643971.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19427.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=185

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            VV+DAR HMLGRLASI+AK+ LNGQ +VV R EEI +SGGLVRQKMKY RFLRKRMN+ P
Sbjct  5    VVIDARGHMLGRLASIVAKQALNGQHIVVTRAEEINVSGGLVRQKMKYERFLRKRMNSNP  64

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
              GPIHFRAPS+I WRT+RGM+PHKTKRGAAAL RLK +EGVPPPYDKVKRMV+PDALKV
Sbjct  65   KKGPIHFRAPSRIFWRTVRGMVPHKTKRGAAALERLKTFEGVPPPYDKVKRMVVPDALKV  124

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAY  234
            LRLQ GHK+C LG L++ VGW H  ++  LE +R E+A+  Y
Sbjct  125  LRLQHGHKFCKLGDLAASVGWKHKASVAELEARRLEKAKGFY  166



>sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal protein L13a [Cyanophora paradoxa]
 emb|CAA71090.1| ribosomal protein L13a [Cyanophora paradoxa]
Length=200

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            VVVD R H+LGRLA+ LAKELLNGQRVV VR EEI +SG L R K+K+H FL+KRMNT P
Sbjct  6    VVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNP  65

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
              GP HFR+P++ILWRTIRGMIPHKT RGAAAL RLK +EGVPPPYDK+KRMVIP AL+V
Sbjct  66   RRGPFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRV  125

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLR  204
            LRL+ G K+C+LG+L++EVGW H D +  LE KRK ++ A Y R+K L  LR
Sbjct  126  LRLKPGRKFCVLGRLATEVGWRHSDLVTRLEEKRKTKSAAFYARKKTLVNLR  177



>ref|XP_001630812.1| predicted protein [Nematostella vectensis]
 gb|EDO38749.1| predicted protein [Nematostella vectensis]
Length=201

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 150/197 (76%), Gaps = 0/197 (0%)
 Frame = -2

Query  725  RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  546
            +++V+D   H+LGRLAS +AK +L+GQRVVVVRCE+IC+SG   R K+KY  FLRKR NT
Sbjct  5    KQIVIDGAGHLLGRLASTVAKSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRKRTNT  64

Query  545  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  366
            KPSHGP HFRAPS+I WRT+RGMIPHKTK+G  A+ R+KV++GVPPPYDK KRMV+P AL
Sbjct  65   KPSHGPFHFRAPSRIFWRTVRGMIPHKTKKGTEAMNRMKVFDGVPPPYDKEKRMVVPSAL  124

Query  365  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKA  186
            KV+RL+ G K+C+LG+LS EVGW + D ++ LE KRK +++  +E +K++ KL+  AE  
Sbjct  125  KVIRLKPGRKFCVLGRLSHEVGWKYQDILETLEEKRKAKSKLYFEHKKKVQKLKQTAELN  184

Query  185  AEERLGTQLDILSSVKY  135
              + L +    L+   Y
Sbjct  185  KADELKSVNKTLAGYGY  201



>ref|XP_010661466.1| PREDICTED: 60S ribosomal protein L13a-2-like [Vitis vinifera]
Length=249

 Score =   248 bits (632),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  626  CEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  447
            CEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA
Sbjct  121  CEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  180

Query  446  ALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLE  267
             LARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWNHYDTI+ LE
Sbjct  181  TLARLKAYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSLEVGWNHYDTIRELE  240

Query  266  NKRKERAQA  240
             KRKER  A
Sbjct  241  KKRKERRLA  249



>ref|XP_004349662.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22573.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
Length=204

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLASI+AK++LNGQR+VVVRCEEI +SG   R K+KY  FL+K  N +P
Sbjct  10   LVIDGRGHLLGRLASIVAKQILNGQRLVVVRCEEINVSGSFFRNKLKYLSFLKKCSNVRP  69

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            +HGP H+RAPSKI WRT+RGM+ HKT RGA AL RLKV+EGVPPPYDK+KRMV P AL+V
Sbjct  70   THGPYHYRAPSKIFWRTVRGMVAHKTARGAEALGRLKVFEGVPPPYDKMKRMVCPAALRV  129

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            LRL+ G  Y ++G+LS EVGW H  T+K LE KRK R+ A YER+K L +L+ KA     
Sbjct  130  LRLKPGRAYTVIGRLSEEVGWKHAATVKKLEEKRKVRSAAYYERKKALARLQTKALANRT  189

Query  179  ERLGTQLDILSSVKY  135
            E+L   L+ L++  Y
Sbjct  190  EQLKPVLETLTAYGY  204



>ref|XP_008067417.1| PREDICTED: 60S ribosomal protein L13a [Tarsius syrichta]
Length=203

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQLT+LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  187  KKIGKYTEVLKT  198



>gb|AAX48846.1| L13a [Suberites domuncula]
Length=199

 Score =   241 bits (614),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = -2

Query  725  RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  546
            R+V++D + H+LGRLASI+AK +L GQR+V+VRCE+I +SG   R K+KY +FL  R N 
Sbjct  2    RQVLIDGKGHLLGRLASIVAKCILQGQRIVIVRCEDINISGSFYRNKLKYLKFLNLRCNV  61

Query  545  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  366
             P  GP HFRAPS+I WRT+RGM+PHKTKRG  AL RLKV+EG+PPPYDK KRMV+P+AL
Sbjct  62   NPKRGPFHFRAPSRIFWRTVRGMVPHKTKRGMEALNRLKVFEGIPPPYDKQKRMVVPNAL  121

Query  365  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKA  186
            +VLRL+ G KYC +G++S E+GW + D +K LE KRK RA   Y+R+KQ+ + + KAE  
Sbjct  122  RVLRLKPGRKYCDIGRISHEIGWKYKDVVKTLEEKRKARATEFYQRKKQVLRFKAKAEDV  181

Query  185  AEERL  171
             + RL
Sbjct  182  CKPRL  186



>gb|ETE70282.1| 60S ribosomal protein L13a [Ophiophagus hannah]
Length=203

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL KLR +AEK  E
Sbjct  127  VRLKPTRKFAFLGRLAHEVGWKYQAITATLEEKRKEKAKVHYTKKKQLMKLRKQAEKNVE  186

Query  179  ERLGTQLDIL  150
             ++    D+L
Sbjct  187  SKISKYTDVL  196



>ref|XP_004011713.1| PREDICTED: 60S ribosomal protein L13a-like [Ovis aries]
Length=203

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L GQ+VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGQKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPACKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE  186

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  187  KKIGKFTEVLKT  198



>ref|XP_007431701.1| PREDICTED: 60S ribosomal protein L13a-like [Python bivittatus]
Length=203

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL KLR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAITATLEEKRKEKAKLHYTKKKQLMKLRKQAEKNVE  186

Query  179  ERLGTQLDIL  150
             ++    D+L
Sbjct  187  SKIAKYTDVL  196



>ref|XP_002507247.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68505.1| predicted protein [Micromonas sp. RCC299]
Length=199

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            VV+D R H+LGRLASI+AK+LL GQ VVVVR E I +SGG+VR + +Y  F R RMNTKP
Sbjct  5    VVIDGRGHLLGRLASIVAKQLLQGQHVVVVRAEGIVISGGIVRARQRYDYFKRLRMNTKP  64

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            SHGP H+ AP+++LWRT+RGM+P+KT RGA A  R K YEG+PPPYDKVKR V+P+ALKV
Sbjct  65   SHGPFHYAAPARMLWRTVRGMLPYKTTRGACAFERFKAYEGIPPPYDKVKRAVVPEALKV  124

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            LRL AGHKYC+LG LS +VGW H  T++ LE KR   A   + ++K+       A++AA 
Sbjct  125  LRLAAGHKYCVLGDLSHQVGWKHKTTVEALEEKRAAAASEYWTKKKEANSKFAAAKEAAN  184

Query  179  ERLGTQLDILSSVKY  135
             +LG    ++++  Y
Sbjct  185  SQLGDLAPLITATGY  199



>ref|XP_006160205.1| PREDICTED: 60S ribosomal protein L13a [Tupaia chinensis]
Length=203

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  187  KKIGKYTEVLKT  198



>ref|XP_006905092.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Pteropus alecto]
Length=204

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  8    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  67

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  68   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  127

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  128  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  187

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  188  KKIGRYTEVLKT  199



>ref|XP_006905093.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Pteropus alecto]
Length=203

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  187  KKIGRYTEVLKT  198



>ref|XP_004472671.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Dasypus novemcinctus]
Length=203

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
             ++G   ++L +
Sbjct  187  RKIGKYTEVLKT  198



>ref|NP_001070466.1| 60S ribosomal protein L13a [Bos taurus]
 ref|XP_005692777.1| PREDICTED: 60S ribosomal protein L13a [Capra hircus]
 ref|XP_005905051.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Bos mutus]
 ref|XP_006080162.1| PREDICTED: 60S ribosomal protein L13a [Bubalus bubalis]
 ref|XP_010847921.1| PREDICTED: 60S ribosomal protein L13a [Bison bison bison]
 sp|Q3SZ90.3|RL13A_BOVIN RecName: Full=60S ribosomal protein L13a [Bos taurus]
 gb|AAI03040.1| Ribosomal protein L13a [Bos taurus]
 tpg|DAA19656.1| TPA: 60S ribosomal protein L13a [Bos taurus]
Length=203

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE  186

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  187  KKIGKFTEVLKT  198



>gb|ELR49590.1| 60S ribosomal protein L13a, partial [Bos mutus]
Length=199

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  3    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  62

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  63   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  122

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  123  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE  182

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  183  KKIGKFTEVLKT  194



>ref|NP_001016486.1| ribosomal protein L13a [Xenopus (Silurana) tropicalis]
 emb|CAJ83235.1| ribosomal protein L13a [Xenopus (Silurana) tropicalis]
 gb|AAI35477.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gb|AAI60997.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gb|AAI68111.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gb|AAI68117.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
Length=231

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 149/200 (75%), Gaps = 1/200 (1%)
 Frame = -2

Query  746  SGSGICARRV-VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHR  570
            SG    AR+V ++D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  
Sbjct  25   SGGFKSARQVLIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLA  84

Query  569  FLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVK  390
            FLRKRMNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK K
Sbjct  85   FLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRK  144

Query  389  RMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTK  210
            RMV+P ALK++RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++K + K
Sbjct  145  RMVVPAALKIVRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIVK  204

Query  209  LRVKAEKAAEERLGTQLDIL  150
            LR +AEK  E ++    D+L
Sbjct  205  LRKQAEKNVESKISKYTDVL  224



>ref|XP_002723961.2| PREDICTED: 60S ribosomal protein L13a [Oryctolagus cuniculus]
Length=203

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    D+L +
Sbjct  187  KKISKFTDVLKT  198



>ref|XP_001491926.1| PREDICTED: 60S ribosomal protein L13a [Equus caballus]
 ref|XP_008522004.1| PREDICTED: 60S ribosomal protein L13a [Equus przewalskii]
Length=203

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQLT+LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDRYTEVLKT  198



>gb|EWM30220.1| 60s ribosomal protein l13a [Nannochloropsis gaditana]
Length=213

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 147/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  728  ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  549
            ++ VV+D R H+LGRL+SI+AKELL+GQ+VVVVRCEE+ +SGGLVR   +Y +FLRKR N
Sbjct  5    SKEVVIDGRGHLLGRLSSIVAKELLSGQKVVVVRCEELMISGGLVRNHTRYMQFLRKRTN  64

Query  548  TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDA  369
            T P  GP H+RAPS+ILWRTIRGM+PHKT RGA ALARL  +EG+P PYD  KR+V+P A
Sbjct  65   TNPKRGPFHYRAPSRILWRTIRGMLPHKTFRGAQALARLTTFEGIPAPYDTKKRVVVPQA  124

Query  368  LKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEK  189
            LK+LRL+ G ++C L +L+ EVGW H D +  LE KRK +A+A Y+++K  T  +  AE+
Sbjct  125  LKILRLKPGRRFCTLSRLAHEVGWGHRDLVARLEAKRKIKAEAYYQQKKAGTAAKALAER  184

Query  188  AAEERLGTQLDILSSVKY  135
             A   L    ++L+   Y
Sbjct  185  KAASELSAVNNVLAGFGY  202



>ref|XP_004694340.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Condylura cristata]
Length=203

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINKFTEVLKT  198



>ref|XP_003465562.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Cavia porcellus]
Length=203

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++G   ++L +
Sbjct  187  KKIGKFTEVLKT  198



>ref|XP_006898790.1| PREDICTED: 60S ribosomal protein L13a [Elephantulus edwardii]
Length=271

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 149/199 (75%), Gaps = 0/199 (0%)
 Frame = -2

Query  740  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  561
            S  C   +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLR
Sbjct  68   SWACGSVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLR  127

Query  560  KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV  381
            KRMNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV
Sbjct  128  KRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKRKRMV  187

Query  380  IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRV  201
            +P ALKV+RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQ+ +LR 
Sbjct  188  VPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQIMRLRK  247

Query  200  KAEKAAEERLGTQLDILSS  144
            +AEK  E+R+    ++L S
Sbjct  248  QAEKILEKRISKYTEVLKS  266



>ref|XP_008843288.1| PREDICTED: 60S ribosomal protein L13a [Nannospalax galili]
Length=203

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKISKFTEVLKT  198



>ref|XP_003226237.1| PREDICTED: 60S ribosomal protein L13a [Anolis carolinensis]
Length=203

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRK++++  Y ++KQL KLR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAITATLEEKRKQKSKLHYAKKKQLMKLRKQAEKNVE  186

Query  179  ERLGTQLDIL  150
             ++    DIL
Sbjct  187  PKIAKYTDIL  196



>ref|XP_002762391.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Callithrix 
jacchus]
Length=203

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINKYTEVLKT  198



>ref|XP_004597042.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Ochotona princeps]
Length=203

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINKFTEVLKT  198



>ref|XP_004672300.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Jaculus jaculus]
Length=203

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINKFTEVLKT  198



>ref|NP_001080130.1| ribosomal protein L13a [Xenopus laevis]
 gb|AAH43976.1| Rpl13a-prov protein [Xenopus laevis]
Length=231

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 149/200 (75%), Gaps = 1/200 (1%)
 Frame = -2

Query  746  SGSGICARRV-VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHR  570
            SG    AR+V ++D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  
Sbjct  25   SGGFKNARQVLIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLA  84

Query  569  FLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVK  390
            FLRKRMNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK K
Sbjct  85   FLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRK  144

Query  389  RMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTK  210
            RMV+P ALK++RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++K + K
Sbjct  145  RMVVPAALKIVRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIGK  204

Query  209  LRVKAEKAAEERLGTQLDIL  150
            LR +AEK  E ++    D+L
Sbjct  205  LRRQAEKNVESKISKYTDVL  224



>ref|NP_001125810.1| 60S ribosomal protein L13a [Pongo abelii]
 sp|Q5RA38.3|RL13A_PONAB RecName: Full=60S ribosomal protein L13a [Pongo abelii]
 emb|CAH91372.1| hypothetical protein [Pongo abelii]
Length=203

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTSP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKYTEVLKT  198



>ref|XP_001507007.1| PREDICTED: 60S ribosomal protein L13a [Ornithorhynchus anatinus]
Length=203

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y R+K+ T+LR +AEK  E
Sbjct  127  VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRRKKKQTRLRKQAEKNVE  186

Query  179  ERLGTQLDIL  150
             ++    ++L
Sbjct  187  SKISKYTEVL  196



>ref|XP_003384047.1| PREDICTED: 60S ribosomal protein L13a-like [Amphimedon queenslandica]
Length=202

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            ++VDA+ H+LGRLASI+AK+LLNGQ++V++RCE I +SG + R K+KY +FLR R N KP
Sbjct  7    IIVDAKDHLLGRLASIVAKQLLNGQKIVILRCEYINISGSIYRNKVKYLKFLRLRCNVKP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPSKI WRT+RGM+PHKT+RG AAL RL VYEG+PP Y K KR+V+P AL++
Sbjct  67   SRGPFHFRAPSKIFWRTVRGMLPHKTERGKAALGRLSVYEGIPPMYIKKKRVVVPQALRI  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            LRL+ G K+C+LG+LS EVGW + D +K LE KR+ R    YE++ +L +LR +A K A+
Sbjct  127  LRLKPGRKFCVLGRLSHEVGWKYRDVMKTLEEKRQAREAIYYEKKIKLARLRTRATKDAQ  186

Query  179  ERLGTQLDILSSVKY  135
             ++      L+++ Y
Sbjct  187  PKIAEINKKLNAMGY  201



>ref|XP_005879589.1| PREDICTED: 60S ribosomal protein L13a [Myotis brandtii]
Length=203

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINKFTEVLKT  198



>ref|XP_004409938.1| PREDICTED: 60S ribosomal protein L13a [Odobenus rosmarus divergens]
Length=203

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKYTEVLKT  198



>ref|XP_011287982.1| PREDICTED: 60S ribosomal protein L13a [Felis catus]
Length=203

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  728  ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  549
            A+ +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMN
Sbjct  4    AQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMN  63

Query  548  TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDA  369
            T PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P A
Sbjct  64   TNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAA  123

Query  368  LKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEK  189
            LKV+RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK
Sbjct  124  LKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEK  183

Query  188  AAEERLGTQLDILSS  144
              E ++    ++L +
Sbjct  184  NVEGKINKYTEVLKT  198



>ref|NP_036555.1| 60S ribosomal protein L13a isoform 1 [Homo sapiens]
 ref|XP_512821.2| PREDICTED: 60S ribosomal protein L13a [Pan troglodytes]
 ref|XP_002825903.1| PREDICTED: 60S ribosomal protein L13a [Pongo abelii]
 ref|XP_003814375.1| PREDICTED: 60S ribosomal protein L13a [Pan paniscus]
 ref|XP_004061207.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004061208.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004061209.1| PREDICTED: 60S ribosomal protein L13a isoform 3 [Gorilla gorilla 
gorilla]
 sp|P40429.2|RL13A_HUMAN RecName: Full=60S ribosomal protein L13a; AltName: Full=23 kDa 
highly basic protein [Homo sapiens]
 pdb|3J3B|O Chain O, Structure Of The Human 60s Ribosomal Proteins
 pdb|4CXD|O Chain O, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UPX|O Chain O, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4UQ1|O Chain O, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 emb|CAA40254.1| 23 kD highly basic protein [Homo sapiens]
 dbj|BAA88214.1| ribosomal protein L13a [Homo sapiens]
 gb|AAH00514.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH01675.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH01836.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH62537.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH65236.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH70223.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH71929.1| Ribosomal protein L13a [Homo sapiens]
 gb|EAW52495.1| ribosomal protein L13a, isoform CRA_a [Homo sapiens]
 dbj|BAF83809.1| unnamed protein product [Homo sapiens]
 gb|ACE86461.1| ribosomal protein L13a protein [synthetic construct]
 gb|ACE87142.1| ribosomal protein L13a protein [synthetic construct]
 dbj|BAI47189.1| ribosomal protein L13a [synthetic construct]
 gb|ADQ32192.1| ribosomal protein L13a [synthetic construct]
 gb|AIC50976.1| RPL13A, partial [synthetic construct]
 gb|AIC56063.1| RPL13A, partial [synthetic construct]
 gb|AIC63344.1| RPL13A, partial [synthetic construct]
Length=203

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKYTEVLKT  198



>ref|XP_004619892.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Sorex araneus]
Length=203

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS++ WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRMFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    D+L +
Sbjct  187  KKITKFTDVLKA  198



>gb|EFB23940.1| hypothetical protein PANDA_006273 [Ailuropoda melanoleuca]
Length=199

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  3    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  62

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  63   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  122

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  123  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  182

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  183  KKIDKYTEVLKT  194



>ref|XP_004767370.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Mustela putorius 
furo]
 ref|XP_004811758.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Mustela putorius 
furo]
Length=203

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKYTEVLKT  198



>ref|NP_001291802.1| ribosomal protein L13a [Ailuropoda melanoleuca]
 ref|XP_003432774.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Canis lupus 
familiaris]
 ref|XP_006749338.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Leptonychotes 
weddellii]
 ref|XP_008573629.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Galeopterus 
variegatus]
 ref|XP_008682769.1| PREDICTED: 60S ribosomal protein L13a [Ursus maritimus]
 gb|AEA39509.1| ribosomal protein L13A [Ailuropoda melanoleuca]
 gb|AEA39561.1| ribosomal protein L13A [Ailuropoda melanoleuca]
Length=203

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKYTEVLKT  198



>ref|XP_004381707.1| PREDICTED: 60S ribosomal protein L13a [Trichechus manatus latirostris]
Length=203

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINRFTEVLKT  198



>ref|XP_010584802.1| PREDICTED: 60S ribosomal protein L13a [Loxodonta africana]
Length=203

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKINRYTEVLKT  198



>gb|AAH04900.2| RPL13A protein, partial [Homo sapiens]
Length=201

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  5    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  64

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  65   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  124

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  125  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  184

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  185  KKIDKYTEVLKT  196



>ref|XP_008152577.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Eptesicus fuscus]
Length=204

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  8    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  67

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  68   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  127

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  128  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  187

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  188  KKIDKFTEVLKT  199



>ref|XP_005088148.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Mesocricetus 
auratus]
Length=203

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            LRL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  LRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKISKFTEVLKT  198



>gb|EPQ15989.1| 60S ribosomal protein L13a [Myotis brandtii]
Length=217

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  21   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  80

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  81   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  140

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  141  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVE  200

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  201  KKINKFTEVLKT  212



>ref|XP_005412929.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Chinchilla 
lanigera]
Length=203

 Score =   236 bits (602),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++GVPPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGVPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKISKFTEVLKT  198



>ref|XP_008152578.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Eptesicus fuscus]
Length=203

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKFTEVLKT  198



>ref|XP_007941028.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Orycteropus 
afer afer]
Length=203

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNLE  186

Query  179  ERLGTQLDILSS  144
            +++    ++L +
Sbjct  187  KKIDKYTEVLKT  198



>ref|XP_004710493.1| PREDICTED: 60S ribosomal protein L13a [Echinops telfairi]
Length=203

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNLE  186

Query  179  ERLGTQLDILSS  144
             ++    ++L +
Sbjct  187  TKINKYTEVLKT  198



>sp|Q4R8Z2.3|RL13A_MACFA RecName: Full=60S ribosomal protein L13a [Macaca fascicularis]
 dbj|BAE00429.1| unnamed protein product [Macaca fascicularis]
Length=203

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = -2

Query  719  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  540
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  539  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  360
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  359  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE  180
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTTTLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE  186

Query  179  ERLGTQLDILSS  144
            +++     +L +
Sbjct  187  KKIDKYTQVLKT  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385