BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015O06

Length=784
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD94991.1|  cytoplasmic aconitate hydratase                        348   5e-116   Arabidopsis thaliana [mouse-ear cress]
gb|EEC83021.1|  hypothetical protein OsI_28098                          352   6e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001136484.1|  uncharacterized protein LOC100216599               348   7e-113   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        358   9e-113   Cucumis melo [Oriental melon]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    350   1e-112   
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        357   6e-112   Nicotiana tomentosiformis
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        356   9e-112   Sesamum indicum [beniseed]
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     352   1e-111   Eucalyptus grandis [rose gum]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    355   2e-111   Cucumis sativus [cucumbers]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    355   2e-111   
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        355   2e-111   Solanum lycopersicum
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    355   2e-111   Solanum tuberosum [potatoes]
ref|NP_001159192.1|  uncharacterized protein LOC100304277               334   4e-111   
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    345   5e-111   
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    354   5e-111   Glycine max [soybeans]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        354   6e-111   Nicotiana sylvestris
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    352   8e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100637.1|  Aconitate hydratase                                352   8e-111   
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             353   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             353   1e-110   Phaseolus vulgaris [French bean]
gb|EEE68177.1|  hypothetical protein OsJ_26310                          352   2e-110   Oryza sativa Japonica Group [Japonica rice]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         353   2e-110   Jatropha curcas
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    348   2e-110   
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    352   2e-110   Glycine max [soybeans]
dbj|BAE71240.1|  putative cytoplasmic aconitate hydratase               333   3e-110   Trifolium pratense [peavine clover]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        352   3e-110   Glycine soja [wild soybean]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             352   3e-110   Prunus persica
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        352   3e-110   Prunus mume [ume]
sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    343   3e-110   Solanum tuberosum [potatoes]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          352   3e-110   Sorghum bicolor [broomcorn]
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        350   5e-110   Glycine soja [wild soybean]
gb|KJB62843.1|  hypothetical protein B456_009G439700                    336   5e-110   Gossypium raimondii
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        352   5e-110   Populus euphratica
gb|ADM34980.1|  cytosolic aconitase                                     349   6e-110   Pyrus pyrifolia [sha li]
dbj|BAG16527.1|  putative aconitase                                     351   7e-110   Capsicum chinense [bonnet pepper]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        351   7e-110   Fragaria vesca subsp. vesca
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      350   7e-110   Gossypium arboreum [tree cotton]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        351   8e-110   Eucalyptus grandis [rose gum]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         349   8e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        349   9e-110   Glycine soja [wild soybean]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    350   1e-109   Arabis alpina [alpine rockcress]
emb|CDY18054.1|  BnaC07g04160D                                          350   1e-109   Brassica napus [oilseed rape]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    350   1e-109   
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    350   1e-109   Tarenaya hassleriana [spider flower]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    350   2e-109   Glycine max [soybeans]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     338   2e-109   Vitis vinifera
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             350   2e-109   Eutrema salsugineum [saltwater cress]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        350   2e-109   Pyrus x bretschneideri [bai li]
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   345   2e-109   Citrus sinensis [apfelsine]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             350   2e-109   
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    350   2e-109   Glycine max [soybeans]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    350   2e-109   Gossypium raimondii
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    350   3e-109   Phoenix dactylifera
gb|KHG08189.1|  hypothetical protein F383_11434                         347   4e-109   Gossypium arboreum [tree cotton]
ref|NP_178634.2|  aconitate hydratase 3                                 349   4e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93088.1|  BnaA03g38100D                                          349   5e-109   
emb|CDX97969.1|  BnaA06g07200D                                          349   5e-109   
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    348   5e-109   
gb|KJB50479.1|  hypothetical protein B456_008G173400                    348   7e-109   Gossypium raimondii
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    349   7e-109   Elaeis guineensis
gb|ADZ57218.1|  aconitase protein                                       346   9e-109   Litchi chinensis [litchi]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    348   9e-109   Cicer arietinum [garbanzo]
gb|KJB30565.1|  hypothetical protein B456_005G149700                    346   9e-109   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                        348   1e-108   
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           346   1e-108   Nicotiana tabacum [American tobacco]
ref|XP_004158846.1|  PREDICTED: aconitate hydratase-like                323   1e-108   
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        348   1e-108   
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    348   1e-108   Camelina sativa [gold-of-pleasure]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    347   1e-108   Gossypium arboreum [tree cotton]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        348   1e-108   Vitis vinifera
emb|CDY50945.1|  BnaC03g74450D                                          348   2e-108   Brassica napus [oilseed rape]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   345   2e-108   Nelumbo nucifera [Indian lotus]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    347   2e-108   Gossypium raimondii
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        347   2e-108   Solanum lycopersicum
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        347   2e-108   Nelumbo nucifera [Indian lotus]
gb|KJB30566.1|  hypothetical protein B456_005G149700                    347   3e-108   Gossypium raimondii
emb|CBE71058.1|  aconitate hydratase 2                                  345   3e-108   Citrus clementina [clementine]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    347   3e-108   Brassica rapa
ref|XP_008785076.1|  PREDICTED: putative aconitate hydratase, cyt...    332   3e-108   
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    347   3e-108   
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    347   4e-108   Populus euphratica
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    347   4e-108   Nicotiana sylvestris
gb|AAP30039.1|  aconitase                                               344   4e-108   Solanum pennellii
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   342   6e-108   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   346   6e-108   Citrus sinensis [apfelsine]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    345   7e-108   Nicotiana tomentosiformis
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             345   1e-107   Citrus clementina [clementine]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    345   1e-107   Gossypium raimondii
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    343   1e-107   
ref|XP_003605929.1|  Aconitate hydratase                                345   1e-107   Medicago truncatula
emb|CDP10817.1|  unnamed protein product                                345   1e-107   Coffea canephora [robusta coffee]
gb|ADP03320.1|  aconitate hydratase                                     328   1e-107   Pinus pinaster [cluster pine]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             345   1e-107   Capsella rubella
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    345   2e-107   Camelina sativa [gold-of-pleasure]
ref|NP_001159229.1|  uncharacterized protein LOC100304315               337   3e-107   
ref|XP_006376779.1|  aconitate hydratase family protein                 344   4e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    344   4e-107   Brassica rapa
emb|CBE71057.1|  aconitate hydratase 3                                  341   7e-107   Citrus clementina [clementine]
gb|AAO62410.1|  aconitase                                               341   8e-107   Solanum pennellii
ref|XP_002524184.1|  aconitase, putative                                343   9e-107   Ricinus communis
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          342   9e-107   Amborella trichopoda
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    343   1e-106   Solanum tuberosum [potatoes]
gb|ADP03120.1|  aconitate hydratase                                     325   1e-106   Pinus sylvestris [Scotch pine]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    340   1e-106   Cucurbita maxima [Boston marrow]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    340   1e-106   Gossypium raimondii
gb|ADP03151.1|  aconitate hydratase                                     325   2e-106   Pinus sylvestris [Scotch pine]
gb|ADP03123.1|  aconitate hydratase                                     325   2e-106   Pinus sylvestris [Scotch pine]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   342   2e-106   Citrus sinensis [apfelsine]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             342   2e-106   Citrus clementina [clementine]
gb|ABK25210.1|  unknown                                                 331   2e-106   Picea sitchensis
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              335   2e-106   
gb|ADP03134.1|  aconitate hydratase                                     325   2e-106   Pinus sylvestris [Scotch pine]
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   331   2e-106   Citrus sinensis [apfelsine]
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    337   2e-106   Medicago truncatula
ref|XP_002870438.1|  predicted protein                                  341   3e-106   Arabidopsis lyrata subsp. lyrata
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        340   3e-106   Gossypium arboreum [tree cotton]
gb|ADP03144.1|  aconitate hydratase                                     325   3e-106   Pinus sylvestris [Scotch pine]
gb|KHG02134.1|  hypothetical protein F383_25649                         342   3e-106   Gossypium arboreum [tree cotton]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                341   3e-106   Erythranthe guttata [common monkey flower]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    342   4e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    341   4e-106   Camelina sativa [gold-of-pleasure]
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   336   5e-106   
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        340   5e-106   Gossypium arboreum [tree cotton]
ref|XP_002530635.1|  aconitase, putative                                339   5e-106   Ricinus communis
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   338   6e-106   
gb|AAC26045.1|  aconitase-iron regulated protein 1                      338   7e-106   Citrus limon [lemon]
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    336   7e-106   
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              336   7e-106   
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    340   9e-106   Nelumbo nucifera [Indian lotus]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        340   1e-105   Vitis vinifera
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                340   1e-105   Erythranthe guttata [common monkey flower]
gb|KGN48958.1|  Aconitase                                               338   1e-105   
gb|ADP03143.1|  aconitate hydratase                                     323   1e-105   Pinus sylvestris [Scotch pine]
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              338   2e-105   Cucumis sativus [cucumbers]
ref|XP_003612247.1|  Aconitate hydratase                                337   2e-105   Medicago truncatula
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   337   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              337   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              337   3e-105   Pyrus x bretschneideri [bai li]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     337   3e-105   Cucumis melo [Oriental melon]
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   332   4e-105   Citrus sinensis [apfelsine]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    338   4e-105   Camelina sativa [gold-of-pleasure]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               335   4e-105   Triticum urartu
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    338   5e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    338   7e-105   Sesamum indicum [beniseed]
gb|ACK56134.1|  putative aconitase                                      313   7e-105   Dimocarpus longan [longan]
ref|XP_007046597.1|  Aconitase 1                                        336   9e-105   
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               335   1e-104   Triticum urartu
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   335   1e-104   Vitis vinifera
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         335   1e-104   Jatropha curcas
emb|CBI24446.3|  unnamed protein product                                336   1e-104   Vitis vinifera
ref|XP_002532564.1|  aconitase, putative                                337   1e-104   
ref|XP_003596988.1|  Aconitate hydratase                                336   2e-104   Medicago truncatula
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    337   2e-104   
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          337   2e-104   Sorghum bicolor [broomcorn]
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    337   2e-104   Nicotiana sylvestris
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    337   3e-104   Nicotiana tomentosiformis
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   332   3e-104   Citrus sinensis [apfelsine]
gb|AAL13084.1|  putative aconitase                                      334   4e-104   Prunus avium [gean]
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    336   4e-104   Elaeis guineensis
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               335   5e-104   
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    335   5e-104   Elaeis guineensis
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             333   5e-104   Prunus persica
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    335   6e-104   Brachypodium distachyon [annual false brome]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    335   6e-104   Setaria italica
ref|NP_001119125.1|  aconitate hydratase 1                              331   6e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383042.1|  aconitate hydratase family protein                 333   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   333   1e-103   Populus euphratica
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   332   2e-103   Prunus mume [ume]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   332   2e-103   Citrus sinensis [apfelsine]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    334   2e-103   Phoenix dactylifera
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    333   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85661.1|  predicted protein                                      333   2e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92965.1|  predicted protein                                      334   2e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBE71056.1|  aconitate hydratase 1                                  332   2e-103   Citrus clementina [clementine]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   332   3e-103   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   332   3e-103   Citrus sinensis [apfelsine]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             332   3e-103   Citrus clementina [clementine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   331   3e-103   Citrus sinensis [apfelsine]
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     329   5e-103   Gossypium arboreum [tree cotton]
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    328   6e-103   Camelina sativa [gold-of-pleasure]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    331   7e-103   Arabis alpina [alpine rockcress]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         333   7e-103   Jatropha curcas
ref|NP_195308.1|  aconitate hydratase 1                                 330   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   330   9e-103   Citrus sinensis [apfelsine]
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     328   1e-102   Eucalyptus grandis [rose gum]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          330   1e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             332   1e-102   Capsella rubella
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    332   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    332   2e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    331   2e-102   Cicer arietinum [garbanzo]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             329   2e-102   Capsella rubella
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             329   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   329   2e-102   Brassica rapa
emb|CDX69174.1|  BnaC01g02790D                                          329   2e-102   
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    329   3e-102   Glycine max [soybeans]
ref|NP_001048898.1|  Os03g0136900                                       331   3e-102   
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             329   3e-102   Phaseolus vulgaris [French bean]
gb|EEC74472.1|  hypothetical protein OsI_09921                          330   3e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    329   4e-102   
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    330   5e-102   Phoenix dactylifera
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              328   5e-102   Brassica rapa
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    330   5e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             330   7e-102   Eutrema salsugineum [saltwater cress]
emb|CDY24823.1|  BnaA08g14870D                                          328   9e-102   Brassica napus [oilseed rape]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    330   1e-101   Brachypodium distachyon [annual false brome]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     328   1e-101   Eucalyptus grandis [rose gum]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   328   1e-101   Eucalyptus grandis [rose gum]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    330   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    329   1e-101   Solanum tuberosum [potatoes]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   327   1e-101   Glycine max [soybeans]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             327   2e-101   Eutrema salsugineum [saltwater cress]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               336   2e-101   
emb|CDX75532.1|  BnaA01g01700D                                          327   2e-101   
ref|XP_010113288.1|  Aconitate hydratase 1                              328   2e-101   
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    328   3e-101   Arabis alpina [alpine rockcress]
gb|KHN41868.1|  Aconitate hydratase 1                                   326   3e-101   Glycine soja [wild soybean]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              326   5e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    328   5e-101   Brassica rapa
emb|CDY66424.1|  BnaAnng22230D                                          328   5e-101   Brassica napus [oilseed rape]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        326   6e-101   Glycine soja [wild soybean]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              325   7e-101   Cicer arietinum [garbanzo]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   325   7e-101   Tarenaya hassleriana [spider flower]
emb|CDY41626.1|  BnaC03g62580D                                          325   8e-101   Brassica napus [oilseed rape]
emb|CDY14291.1|  BnaA08g14220D                                          326   1e-100   Brassica napus [oilseed rape]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   324   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              324   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   324   2e-100   Fragaria vesca subsp. vesca
emb|CAB36543.1|  putative aconitase                                     323   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             325   4e-100   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             324   5e-100   
ref|NP_567763.2|  aconitase 2                                           324   9e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    321   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              319   2e-98    Tarenaya hassleriana [spider flower]
emb|CDP05740.1|  unnamed protein product                                320   5e-98    Coffea canephora [robusta coffee]
ref|XP_007020807.1|  Aconitase 3                                        317   1e-97    
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          317   2e-97    Sorghum bicolor [broomcorn]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    317   5e-97    Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    317   5e-97    Zea mays [maize]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             315   7e-97    
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             315   1e-96    
ref|XP_007020811.1|  Aconitase 3                                        313   6e-96    
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    307   4e-95    Cucumis melo var. conomon [snake cucumber]
gb|ACR36825.1|  unknown                                                 302   5e-95    Zea mays [maize]
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          308   1e-94    
emb|CAA58046.1|  aconitase                                              307   8e-94    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              301   1e-93    
ref|XP_001780674.1|  predicted protein                                  305   3e-93    
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              305   4e-93    Eucalyptus grandis [rose gum]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     305   7e-93    Eucalyptus grandis [rose gum]
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    297   1e-92    
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    302   5e-92    Zea mays [maize]
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             302   9e-92    
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             302   9e-92    
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    301   2e-91    Zea mays [maize]
ref|NP_001147431.1|  aconitase2                                         300   3e-91    Zea mays [maize]
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               301   3e-91    Triticum urartu
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    296   1e-90    
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               299   2e-90    
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    296   2e-90    
ref|XP_001779205.1|  predicted protein                                  297   3e-90    
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    296   1e-89    Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                296   1e-89    
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    296   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_002866068.1|  hypothetical protein ARALYDRAFT_918634             276   4e-89    
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    295   6e-89    
gb|KJB17578.1|  hypothetical protein B456_003G006000                    293   1e-88    Gossypium raimondii
ref|XP_001770969.1|  predicted protein                                  292   3e-88    
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    280   7e-87    
emb|CDY56501.1|  BnaAnng14360D                                          283   9e-85    Brassica napus [oilseed rape]
ref|XP_010046453.1|  PREDICTED: aconitate hydratase, cytoplasmic        259   9e-84    
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   277   7e-83    
ref|XP_007132547.1|  hypothetical protein PHAVU_011G1037000g            251   5e-81    Phaseolus vulgaris [French bean]
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   267   6e-79    
ref|XP_006108771.1|  PREDICTED: cytoplasmic aconitate hydratase-like    246   2e-77    Myotis lucifugus
ref|XP_005862173.1|  PREDICTED: cytoplasmic aconitate hydratase-like    245   3e-77    
ref|XP_002766275.1|  Aconitate hydratase, cytoplasmic, putative         247   3e-77    Perkinsus marinus ATCC 50983
ref|XP_002784977.1|  aconitase, putative                                239   1e-75    Perkinsus marinus ATCC 50983
ref|XP_001016756.1|  aconitate hydratase                                256   6e-75    Tetrahymena thermophila SB210
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         254   7e-75    
ref|XP_008586142.1|  PREDICTED: cytoplasmic aconitate hydratase         240   9e-75    
gb|AGC69746.1|  putative iron regulatory protein                        255   1e-74    
ref|XP_003884224.1|  Iron regulatory protein-like protein, related      256   1e-74    
gb|EPQ05177.1|  Cytoplasmic aconitate hydratase                         237   4e-74    
gb|ACU19654.1|  unknown                                                 231   8e-73    
ref|XP_010290546.1|  PREDICTED: cytoplasmic aconitate hydratase         231   1e-72    
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         248   2e-72    
dbj|BAM18054.1|  iron regulatory protein 1A                             238   2e-72    
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         247   3e-72    
gb|EGT30572.1|  CBN-ACO-1 protein                                       248   3e-72    
ref|XP_010787894.1|  PREDICTED: cytoplasmic aconitate hydratase-like    236   3e-72    
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         242   5e-72    
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    248   5e-72    
gb|ENN73657.1|  hypothetical protein YQE_09735                          232   6e-72    
ref|XP_001464867.1|  putative aconitase                                 248   6e-72    
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    247   6e-72    
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         242   6e-72    
pdb|3SNP|A  Chain A, Crystal Structure Analysis Of Iron Regulator...    248   7e-72    
ref|XP_003109738.1|  CRE-ACO-1 protein                                  247   7e-72    
ref|XP_002788756.1|  aconitase, putative                                245   7e-72    
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         247   7e-72    
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            247   8e-72    
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      247   8e-72    
emb|CAA04136.1|  iron regulatory protein                                234   9e-72    
emb|CAP35039.2|  Protein CBR-ACO-1                                      247   1e-71    
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   1e-71    
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-71    
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-71    
ref|XP_002776365.1|  aconitase, putative                                246   2e-71    
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             247   2e-71    
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-71    
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             247   2e-71    
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-71    
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             247   2e-71    
gb|ACF33175.1|  aconitase-1                                             246   2e-71    
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             247   2e-71    
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             247   2e-71    
ref|XP_002366326.1|  aconitate hydratase, putative                      247   2e-71    
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-71    
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         243   2e-71    
gb|KHN74276.1|  putative cytoplasmic aconitate hydratase                246   3e-71    
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         245   3e-71    
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         242   3e-71    
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         245   4e-71    
ref|NP_509898.1|  Protein ACO-1                                         245   4e-71    
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    245   4e-71    
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    243   5e-71    
ref|XP_001682457.1|  putative aconitase                                 245   5e-71    
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    245   5e-71    
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    245   5e-71    
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         245   5e-71    
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    244   6e-71    
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    244   6e-71    
gb|KFO19757.1|  Cytoplasmic aconitate hydratase                         245   6e-71    
gb|EYC17817.1|  hypothetical protein Y032_0029g1886                     227   6e-71    
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  243   7e-71    
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    244   7e-71    
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    244   7e-71    
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         244   8e-71    
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         244   8e-71    
gb|AFI44047.1|  iron regulatory protein                                 244   9e-71    
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    245   9e-71    
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         244   9e-71    
ref|XP_002765934.1|  aconitase, putative                                244   1e-70    
emb|CCW61236.1|  unnamed protein product                                244   1e-70    
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-70    
gb|ELK33131.1|  Cytoplasmic aconitate hydratase                         244   1e-70    
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-70    
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-70    
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                        244   1e-70    
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-70    
ref|XP_004428435.1|  PREDICTED: cytoplasmic aconitate hydratase i...    244   1e-70    
gb|AAH05454.1|  Aconitase 1                                             244   1e-70    
ref|XP_004428436.1|  PREDICTED: cytoplasmic aconitate hydratase i...    244   1e-70    
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    244   1e-70    
emb|CAA43455.1|  iron response element binding protein                  243   1e-70    
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       243   1e-70    
emb|CAD20353.1|  cytoplasmic aconitase                                  243   2e-70    
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-70    
ref|XP_001563981.1|  putative aconitase                                 243   2e-70    
gb|KIH47318.1|  putative aconitate hydratase 1                          241   2e-70    
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-70    
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         242   2e-70    
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    243   2e-70    
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-70    
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-70    
gb|AJQ30117.1|  aconitate hydratase 1                                   243   2e-70    
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              243   2e-70    
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         240   2e-70    
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-70    
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   2e-70    
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-70    
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-70    
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-70    
emb|CCW69174.1|  unnamed protein product                                243   2e-70    
ref|XP_003874065.1|  putative aconitase                                 243   3e-70    
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         241   3e-70    
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    243   3e-70    
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         241   3e-70    
gb|EDL98627.1|  rCG55067                                                243   3e-70    
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase         243   3e-70    
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         243   3e-70    
gb|AAH90777.1|  LOC100150527 protein                                    226   3e-70    
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   3e-70    
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         243   3e-70    
ref|XP_002126781.1|  PREDICTED: cytoplasmic aconitate hydratase         243   4e-70    
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         242   4e-70    
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   4e-70    
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    242   4e-70    
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         242   4e-70    
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    242   4e-70    
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         242   4e-70    
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   5e-70    
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   5e-70    
ref|XP_001952191.1|  PREDICTED: cytoplasmic aconitate hydratase-like    242   5e-70    
ref|XP_010697897.1|  aconitase, putative                                242   5e-70    
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         242   5e-70    
gb|EHJ78892.1|  iron regulatory protein 1                               231   5e-70    
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase         242   5e-70    
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         242   5e-70    
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase         242   6e-70    
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         239   6e-70    
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         242   6e-70    
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         242   6e-70    
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         242   6e-70    
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         239   6e-70    
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   7e-70    
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   7e-70    
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...    242   7e-70    
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         240   7e-70    
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         241   7e-70    
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    242   7e-70    
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         241   8e-70    
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         241   8e-70    
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         241   8e-70    
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         241   8e-70    
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase         241   8e-70    
gb|EZA62627.1|  Cytoplasmic aconitate hydratase                         240   8e-70    
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         241   9e-70    
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         240   9e-70    
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         241   9e-70    
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         241   9e-70    
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         241   9e-70    
ref|XP_001462506.1|  hypothetical protein                               236   9e-70    
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase         241   9e-70    
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         241   9e-70    
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                    241   1e-69    
gb|EJY64435.1|  Aconitate hydratase 1 family protein                    241   1e-69    
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         241   1e-69    
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         241   1e-69    
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   1e-69    
ref|XP_010837907.1|  PREDICTED: cytoplasmic aconitate hydratase         241   1e-69    
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     240   1e-69    
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                   241   1e-69    
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    241   1e-69    
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         241   1e-69    
gb|EJY70620.1|  Aconitate hydratase 1 family protein                    241   1e-69    
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   1e-69    
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         241   1e-69    
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   1e-69    
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   1e-69    
gb|EPY31043.1|  aconitase                                               241   1e-69    
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   1e-69    
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    240   1e-69    
ref|XP_004004476.1|  PREDICTED: cytoplasmic aconitate hydratase i...    241   1e-69    
ref|XP_011148978.1|  PREDICTED: cytoplasmic aconitate hydratase-like    241   1e-69    
gb|ELR46544.1|  Cytoplasmic aconitate hydratase                         241   1e-69    
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    241   1e-69    
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         241   1e-69    
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         241   2e-69    
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         241   2e-69    
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
gb|EPY23614.1|  aconitate hydratase 1                                   241   2e-69    
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    241   2e-69    
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         241   2e-69    
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase         241   2e-69    
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    241   2e-69    
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                    241   2e-69    
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase         241   2e-69    
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       240   2e-69    
ref|XP_004031131.1|  hypothetical protein IMG5_146680                   240   2e-69    
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    240   2e-69    
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    240   2e-69    
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
ref|XP_004004477.1|  PREDICTED: cytoplasmic aconitate hydratase i...    240   2e-69    
ref|XP_011347901.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    240   2e-69    
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         240   2e-69    
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein           240   2e-69    
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         240   3e-69    
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...    240   3e-69    
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         240   3e-69    
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase         240   3e-69    
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         240   3e-69    
ref|XP_002413165.1|  RNA-binding translational regulator IRP, put...    239   3e-69    
ref|XP_004362727.1|  putative iron regulatory protein                   240   3e-69    
ref|XP_011347824.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    240   3e-69    
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         240   3e-69    
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         240   3e-69    
gb|ETN69391.1|  aconitase domain protein                                223   3e-69    
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like    236   3e-69    
ref|XP_977148.1|  aconitate hydratase 1 family protein                  240   4e-69    
ref|XP_006809760.1|  PREDICTED: cytoplasmic aconitate hydratase-like    238   4e-69    
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    239   4e-69    
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         239   4e-69    
gb|EHH57327.1|  hypothetical protein EGM_06925                          239   5e-69    
gb|EHH24050.1|  hypothetical protein EGK_07631                          239   5e-69    
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase         239   5e-69    
gb|KFB40343.1|  AGAP007258-PA-like protein                              239   5e-69    
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         239   5e-69    
ref|XP_006060333.1|  PREDICTED: cytoplasmic aconitate hydratase i...    239   6e-69    
gb|KFM82338.1|  hypothetical protein X975_14216                         239   6e-69    
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase         239   6e-69    
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase         239   6e-69    
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         239   7e-69    
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         239   8e-69    
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like    239   8e-69    



>dbj|BAD94991.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=328

 Score =   348 bits (892),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  146  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  205

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  206  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  265

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  266  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  325

Query  244  SKQ  236
            SKQ
Sbjct  326  SKQ  328



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   352 bits (904),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DTI+LA
Sbjct  439  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDTIVLA  498

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  499  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  558

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+N++EIRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L
Sbjct  559  GHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNL  618

Query  244  SKQ  236
            ++ 
Sbjct  619  AQN  621



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   348 bits (892),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILA
Sbjct  381  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILA  440

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  441  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  500

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L
Sbjct  501  GHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNL  560

Query  244  S  242
            +
Sbjct  561  A  561



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   358 bits (920),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DTI+LA
Sbjct  807  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDTIVLA  866

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  867  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  926

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLPSNI+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  927  GHERYSIDLPSNISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  986

Query  244  SKQ  236
             KQ
Sbjct  987  IKQ  989



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G+DT+ILA
Sbjct  476  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGQDTVILA  535

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  536  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  595

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+NI EIRPGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGILPYVIR L
Sbjct  596  GHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYVIRNL  655

Query  244  SKQ  236
            SKQ
Sbjct  656  SKQ  658



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   357 bits (915),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YKS G+DT+ILA
Sbjct  815  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKSAGQDTVILA  874

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  875  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  934

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP NI+EIRPGQDVTV+T+ GK+FTCTVRFDTEVELAYFNHGGILPYVIRQL
Sbjct  935  GHERYTIDLPENISEIRPGQDVTVRTETGKSFTCTVRFDTEVELAYFNHGGILPYVIRQL  994

Query  244  SKQ  236
            +KQ
Sbjct  995  TKQ  997



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   356 bits (914),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAAM+YKS G+DTIILA
Sbjct  819   RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGQDTIILA  878

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  879   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  938

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLPS I++IRPGQDVTV TD+GK FTCTVRFDTEVELAYFNHGGILPYVIRQL
Sbjct  939   GHERYTIDLPSKISDIRPGQDVTVVTDSGKQFTCTVRFDTEVELAYFNHGGILPYVIRQL  998

Query  244   SKQ  236
             +KQ
Sbjct  999   TKQ  1001



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAM+YKS G DTI+LA
Sbjct  613  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGHDTIVLA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGED D+LGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDTLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLPSNI+EIRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGILPYVIR L
Sbjct  733  GHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVIRNL  792

Query  244  SKQ  236
              Q
Sbjct  793  INQ  795



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DTI+LA
Sbjct  807  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDTIVLA  866

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  867  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  926

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP NI+EIRPGQDV+V TD+GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  927  GHERYSIDLPDNISEIRPGQDVSVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  986

Query  244  SKQ  236
             KQ
Sbjct  987  IKQ  989



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   355 bits (911),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DTI+LA
Sbjct  807  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDTIVLA  866

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  867  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  926

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP NI+EIRPGQDV++ TD+GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  927  GHERYSIDLPDNISEIRPGQDVSITTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  986

Query  244  SKQ  236
             KQ
Sbjct  987  IKQ  989



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   355 bits (910),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DTIILA
Sbjct  799  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMKYKSAGQDTIILA  858

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT
Sbjct  859  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  918

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  919  GHERYTIDLPDNISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILPYVIRQL  978

Query  244  SKQ  236
            S+Q
Sbjct  979  SQQ  981



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   355 bits (910),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DTIILA
Sbjct  799  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMKYKSAGQDTIILA  858

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT
Sbjct  859  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  918

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  919  GHERYTIDLPDNISEIRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  978

Query  244  SKQ  236
            S+Q
Sbjct  979  SQQ  981



>ref|NP_001159192.1| uncharacterized protein LOC100304277 [Zea mays]
 gb|ACN25362.1| unknown [Zea mays]
Length=287

 Score =   334 bits (856),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  105  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  164

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLC+KAGEDAD+LGLT
Sbjct  165  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLT  224

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV R++
Sbjct  225  GHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVARKI  284

Query  244  SKQ  236
            ++Q
Sbjct  285  AEQ  287



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -1

Query  778  GNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGA  599
            GNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILAGA
Sbjct  435  GNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGA  494

Query  598  EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGH  419
            EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGH
Sbjct  495  EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGH  554

Query  418  ERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  242
            ERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L+
Sbjct  555  ERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  613



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   354 bits (908),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DTI+LA
Sbjct  802  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDTIVLA  861

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLT
Sbjct  862  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLT  921

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQDVTV T  GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  922  GHERYTIDLPSNISEIRPGQDVTVTTTTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  981

Query  244  SKQ  236
             KQ
Sbjct  982  IKQ  984



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   354 bits (908),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YKS G+DT+ILA
Sbjct  814  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKSAGQDTVILA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP NI+EIRPGQDV V+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  934  GHERYTIDLPENISEIRPGQDVAVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  993

Query  244  SKQ  236
            +KQ
Sbjct  994  TKQ  996



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   352 bits (902),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DTI+LA
Sbjct  716  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDTIVLA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+N++EIRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L
Sbjct  836  GHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNL  895

Query  244  SKQ  236
            ++ 
Sbjct  896  AQN  898



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   352 bits (904),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G DTIILA
Sbjct  756  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYKSAGHDTIILA  815

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLT
Sbjct  816  GAEYGSGSSRDWAAKGPMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLT  875

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPY IR L
Sbjct  876  GHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYAIRNL  935

Query  244  SKQ  236
             KQ
Sbjct  936  IKQ  938



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYKS G DTI+LA
Sbjct  817  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGYDTIVLA  876

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DAD+LGLT
Sbjct  877  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKDGQDADTLGLT  936

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLPSNI EIRPGQDVTV TDNGK+F CTVRFDTEVELAYFNHGGILPY IR L
Sbjct  937  GHERYSIDLPSNIGEIRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHGGILPYAIRNL  996

Query  244  SKQ  236
             KQ
Sbjct  997  MKQ  999



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   353 bits (905),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVG KTVHIPTGEKLYVFDAA RYK+EGKDTI+LA
Sbjct  801  RRGNDEVMARGTFANIRLVNKLLNGEVGAKTVHIPTGEKLYVFDAAQRYKAEGKDTIVLA  860

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  861  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  920

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS I+EIRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGILPYVIR L
Sbjct  921  GHERYTIDLPSKISEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNL  980

Query  244  SKQ  236
             KQ
Sbjct  981  IKQ  983



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DTI+LA
Sbjct  774  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDTIVLA  833

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  834  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  893

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+N++EIRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L
Sbjct  894  GHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNL  953

Query  244  SKQ  236
            ++ 
Sbjct  954  AQN  956



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   353 bits (905),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAM+YK+ G DTI+LA
Sbjct  816  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMKYKTAGHDTIVLA  875

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLT
Sbjct  876  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLT  935

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  936  GHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  995

Query  244  SKQ  236
             K+
Sbjct  996  MKE  998



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILA
Sbjct  613  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L
Sbjct  733  GHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNL  792

Query  244  S  242
            +
Sbjct  793  A  793



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DTI+LA
Sbjct  802  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDTIVLA  861

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLT
Sbjct  862  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLT  921

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQDVTV T+ GK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  922  GHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  981

Query  244  SKQ  236
             KQ
Sbjct  982  IKQ  984



>dbj|BAE71240.1| putative cytoplasmic aconitate hydratase [Trifolium pratense]
Length=316

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+M+RGTFANIR+VNKLL+GEVGPKTVH+PTGEKL+VFDAA RYK+ G  TI+LA
Sbjct  133  RRGNDEVMSRGTFANIRIVNKLLNGEVGPKTVHVPTGEKLFVFDAAERYKAAGHATIVLA  192

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  193  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  252

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I+EI+PGQDVTV TDNGK+FTCT RFDTEVEL YFNHGGILPYVIR L
Sbjct  253  GHERYTIDLPNKISEIKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHGGILPYVIRNL  312



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   352 bits (903),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DTI+LA
Sbjct  802  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDTIVLA  861

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLT
Sbjct  862  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLT  921

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQDVTV T+ GK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  922  GHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  981

Query  244  SKQ  236
             KQ
Sbjct  982  IKQ  984



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   352 bits (904),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK++G DTI+LA
Sbjct  814  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYKADGHDTIVLA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+I+EI+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  934  GHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYVIRNL  993

Query  244  SKQ  236
            SKQ
Sbjct  994  SKQ  996



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   352 bits (904),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK++G DTI+LA
Sbjct  812  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYKADGHDTIVLA  871

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  872  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  931

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+I+EI+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  932  GHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYVIRNL  991

Query  244  SKQ  236
            SKQ
Sbjct  992  SKQ  994



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVH+P+GEKL VFDAAM+YKS G+ TIILA
Sbjct  434  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQSTIILA  493

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  494  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  553

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL
Sbjct  554  GQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYVIRQL  613

Query  244  SKQ  236
            +++
Sbjct  614  TQR  616



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   352 bits (903),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L+GEVGPKT+H+PTGEKLYVFDAAMRYKSEG  TIILA
Sbjct  812  RRGNDEIMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLYVFDAAMRYKSEGHATIILA  871

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  872  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  931

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+N++EIRPGQDVTV TDNGK+FTCT+RFDTEVELAYFNHGGILPYVIR L
Sbjct  932  GHERYSIDLPANLSEIRPGQDVTVITDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNL  991

Query  244  S  242
            +
Sbjct  992  A  992



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   350 bits (898),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKLYVFDAA RYK+ G+DTI+LA
Sbjct  736  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAATRYKASGQDTIVLA  795

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  796  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  855

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LPS INEIRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGILPYVIR L
Sbjct  856  GHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNL  915

Query  244  SKQ  236
             KQ
Sbjct  916  IKQ  918



>gb|KJB62843.1| hypothetical protein B456_009G439700, partial [Gossypium raimondii]
Length=417

 Score =   336 bits (861),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+V+KLL GEVGPKT+H+PTGEKLYV+DAAMRYK+ G+DTI+LA
Sbjct  235  RRGNDEVMARGTFANIRIVSKLLKGEVGPKTIHVPTGEKLYVYDAAMRYKAAGQDTIVLA  294

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKG MLLGVKAVI KSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  295  GAEYGSGSSRDWAAKGQMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLT  354

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+ I+EIRPGQDVTV T  GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  355  GHERYSIDLPNKISEIRPGQDVTVTTVTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  414

Query  244  SKQ  236
            +K+
Sbjct  415  NKE  417



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   352 bits (902),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIRLVNK L+GEVGPKTVHIPTGEKLYVFDAAMRYKS G DTI+LA
Sbjct  819   RRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGYDTIVLA  878

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLT
Sbjct  879   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLT  938

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERYSIDLPSNI+EIRPGQDVTV TDNGK+F CTVRFDTEVELAYFNHGGIL Y IR L
Sbjct  939   GHERYSIDLPSNIDEIRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHGGILQYAIRNL  998

Query  244   SKQ  236
              KQ
Sbjct  999   MKQ  1001



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   349 bits (896),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL+VFDAA RYK++G DTI++A
Sbjct  716  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDTIVIA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EI+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGIL YVIR L
Sbjct  836  GHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNL  895

Query  244  SKQ  236
            SKQ
Sbjct  896  SKQ  898



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   351 bits (901),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL VFDAAM+YKS G++TIILA
Sbjct  813  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQNTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP NI+EIRPGQDV+V+TD GK+FTCTVRFDTEVELAYFNHGGIL YVIRQL
Sbjct  933  GHERYTIDLPENISEIRPGQDVSVQTDTGKSFTCTVRFDTEVELAYFNHGGILQYVIRQL  992

Query  244  SKQ  236
            +KQ
Sbjct  993  TKQ  995



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   351 bits (901),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+P+GEKL VFDAAM+YKS G+DTI+LA
Sbjct  808  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQDTIVLA  867

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  868  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  927

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EI+PGQDVTV TD+GK+F CTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  928  GHERYTIDLPSNISEIKPGQDVTVTTDSGKSFVCTVRFDTEVELAYFNHGGILPYVIRNL  987

Query  244  SKQ  236
            SKQ
Sbjct  988  SKQ  990



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   350 bits (897),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  751  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFDAAMRYKDAGYDTIVLA  810

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  811  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  870

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS I +IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  871  GHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  930

Query  244  SKQ  236
             KQ
Sbjct  931  IKQ  933



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   351 bits (900),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAM+YKS G DTI+LA
Sbjct  814  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGHDTIVLA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGED D+LGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDTLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLPSNI+EIRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGILPYVIR L
Sbjct  934  GHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVIRNL  993

Query  244  SKQ  236
              Q
Sbjct  994  INQ  996



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   349 bits (895),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  836  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  895

Query  244  SKQ  236
            SKQ
Sbjct  896  SKQ  898



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   349 bits (895),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKTVHIPTGEKLYVFDAA RY + G+DTI+LA
Sbjct  721  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHIPTGEKLYVFDAATRYMASGQDTIVLA  780

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  781  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  840

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLPS I+EIRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGILPYVIR L
Sbjct  841  GHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYVIRNL  900

Query  244  SKQ  236
             KQ
Sbjct  901  IKQ  903



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   350 bits (899),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  804  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMRYKSSGEDTIILA  863

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  864  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  923

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+NI+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  924  GHERYTIHLPTNISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  983

Query  244  SKQ  236
            SKQ
Sbjct  984  SKQ  986



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   350 bits (899),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  804  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  863

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDADSLGLT
Sbjct  864  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLT  923

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  924  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  983

Query  244  SKQ  236
            SKQ
Sbjct  984  SKQ  986



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   350 bits (899),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL+VFDAA RYK++G DTI++A
Sbjct  810  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLFVFDAATRYKADGHDTIVIA  869

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  870  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  929

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EI+PGQDVTV TDNGK FTCTVRFDTEVEL YFNHGGIL YVIR L
Sbjct  930  GHERYTIDLPSNISEIKPGQDVTVTTDNGKAFTCTVRFDTEVELEYFNHGGILQYVIRNL  989

Query  244  SKQ  236
            SKQ
Sbjct  990  SKQ  992



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   350 bits (899),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G+DT+ILA
Sbjct  816  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGQDTVILA  875

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  876  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  935

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+NI EIRPGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGILPYVIR L
Sbjct  936  GHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYVIRNL  995

Query  244  SKQ  236
            SKQ
Sbjct  996  SKQ  998



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKLYVFDAA RYK+ G+DTI+LA
Sbjct  802  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAATRYKASGQDTIVLA  861

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  862  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  921

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LPS INEIRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGILPYVIR L
Sbjct  922  GHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNL  981

Query  244  SKQ  236
             KQ
Sbjct  982  IKQ  984



>emb|CAN62964.1| hypothetical protein VITISV_029521 [Vitis vinifera]
Length=520

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKL VFDAAM+YK+  + TIILA
Sbjct  338  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLSVFDAAMKYKTANQGTIILA  397

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  398  GAEYGSGSSRDWAAKGPMLLGVKAXIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  457

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQD+TV T+ GK+F CT RFDTEVELAYFNHGGILPYVIR L
Sbjct  458  GHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTARFDTEVELAYFNHGGILPYVIRNL  517

Query  244  SKQ  236
             KQ
Sbjct  518  IKQ  520



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  813  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  933  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  992

Query  244  SKQ  236
            SKQ
Sbjct  993  SKQ  995



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL+VFDAA RYK++G DTI++A
Sbjct  812  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDTIVIA  871

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  872  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  931

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EI+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGIL YVIR L
Sbjct  932  GHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNL  991

Query  244  SKQ  236
            SKQ
Sbjct  992  SKQ  994



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILA
Sbjct  613  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  733  GHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  792

Query  244  SKQ  236
             KQ
Sbjct  793  IKQ  795



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  811  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  870

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  871  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  930

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  931  GHERYTINLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  990

Query  244  SKQ  236
            SKQ
Sbjct  991  SKQ  993



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   350 bits (897),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKTVHIPTGEKLYVFDAA RY + G+DTI+LA
Sbjct  797  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHIPTGEKLYVFDAATRYMASGQDTIVLA  856

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  857  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  916

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLPS I+EIRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGILPYVIR L
Sbjct  917  GHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYVIRNL  976

Query  244  SKQ  236
             KQ
Sbjct  977  IKQ  979



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   350 bits (897),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  808  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFDAAMRYKDAGYDTIVLA  867

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  868  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  927

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS I +IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  928  GHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  987

Query  244  SKQ  236
             KQ
Sbjct  988  IKQ  990



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   350 bits (897),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKLYVFD AMRYK++G DTI+LA
Sbjct  826   RRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLYVFDVAMRYKADGHDTIVLA  885

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK G+DADSLGLT
Sbjct  886   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVIPLCFKPGQDADSLGLT  945

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLPSNINEIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  946   GHERYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  1005



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  697  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLA  756

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GA+YGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  757  GADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  816

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  817  GHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  876

Query  244  SKQ  236
             KQ
Sbjct  877  IKQ  879



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   349 bits (895),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  808  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  867

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  868  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  927

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  928  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  987

Query  244  SKQ  236
            SKQ
Sbjct  988  SKQ  990



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   349 bits (895),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  812  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  871

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  872  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  931

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  932  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  991

Query  244  SKQ  236
            SKQ
Sbjct  992  SKQ  994



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   349 bits (895),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  809  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  868

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  869  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  928

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  929  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  988

Query  244  SKQ  236
            SKQ
Sbjct  989  SKQ  991



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   348 bits (894),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILA
Sbjct  803  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILA  862

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  863  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  922

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L
Sbjct  923  GHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNL  982

Query  244  S  242
            +
Sbjct  983  A  983



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   348 bits (894),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  814  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP  I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  934  GHERYTIDLPRKIDEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  993

Query  244  SKQ  236
             +Q
Sbjct  994  IRQ  996



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   349 bits (895),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKLYVFDAAMRYK++G DTI+LA
Sbjct  825   RRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLYVFDAAMRYKADGHDTIVLA  884

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DADSLGLT
Sbjct  885   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADSLGLT  944

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHE Y+IDLPSNINEIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  945   GHELYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYVIRSL  1004



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   346 bits (887),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGP+TVH+PTGEKL+VFDAA RYK  G DTIILA
Sbjct  701  RRGNDEVMARGTFANIRLVNKLLNGEVGPQTVHVPTGEKLFVFDAAQRYKDAGHDTIILA  760

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  761  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  820

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  821  GHERYTIDLPNSISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  880

Query  244  SKQ  236
             +Q
Sbjct  881  IEQ  883



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   348 bits (892),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTG+KLYVFDAAMRY + G+DTI+LA
Sbjct  797  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGDKLYVFDAAMRYMTSGQDTIVLA  856

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLC+K+GEDAD+LGLT
Sbjct  857  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKSGEDADTLGLT  916

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS I+EIRPGQDV V TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L
Sbjct  917  GHERYTIDLPSKISEIRPGQDVKVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNL  976

Query  244  SKQ  236
             KQ
Sbjct  977  IKQ  979



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   346 bits (888),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  716  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I++IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  836  GHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   348 bits (893),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKLYVF+AAMRYK+ G DTI+LA
Sbjct  813  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFEAAMRYKAAGHDTIVLA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI  IRPGQDV+V T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  933  GHERYTIDLPSNITHIRPGQDVSVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  992

Query  244  SKQ  236
             KQ
Sbjct  993  IKQ  995



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   346 bits (887),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP  I+EI PGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  836  GHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  895

Query  244  SKQ  236
             +Q
Sbjct  896  IQQ  898



>ref|XP_004158846.1| PREDICTED: aconitate hydratase-like [Cucumis sativus]
Length=178

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  763  MARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSG  584
            MARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSG
Sbjct  1    MARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSG  60

Query  583  SSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSI  404
            SSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHER++I
Sbjct  61   SSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTI  120

Query  403  DLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            DLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  121  DLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  173



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   348 bits (892),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL+VFDAA RYK++G DTI++A
Sbjct  812  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDTIVIA  871

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  872  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  931

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+I+EI+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGIL YVIR L
Sbjct  932  GHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNL  991

Query  244  SKQ  236
            SKQ
Sbjct  992  SKQ  994



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   348 bits (892),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DTIILA
Sbjct  809  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDTIILA  868

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  869  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  928

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  929  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  988

Query  244  SKQ  236
            SKQ
Sbjct  989  SKQ  991



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   347 bits (891),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  791  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLA  850

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GA+YGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  851  GADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  910

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  911  GHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  970

Query  244  SKQ  236
             KQ
Sbjct  971  IKQ  973



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   348 bits (892),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK++G DTI+LA
Sbjct  827   RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKADGHDTIVLA  886

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  887   GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  946

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLPS I+EIRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGILPY IR L
Sbjct  947   GHERYNIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILPYAIRNL  1006

Query  244   SKQ  236
               Q
Sbjct  1007  INQ  1009



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  813  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+F+CTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  933  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFSCTVRFDTEVELAYFNHGGILPYVIRNL  992

Query  244  SKQ  236
            SKQ
Sbjct  993  SKQ  995



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEK+ VFDAAMRYKSEG+DTIILA
Sbjct  716  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKISVFDAAMRYKSEGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSI+LPSN++EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILPYVIR L
Sbjct  836  GHERYSINLPSNVSEIRPGQDVTVVTDSGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  895



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  803  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLA  862

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  863  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  922

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I++IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  923  GHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  982

Query  244  SKQ  236
             KQ
Sbjct  983  IKQ  985



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL VFDAAM+YKS G+ TIILA
Sbjct  813  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQSTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL
Sbjct  933  GQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQL  992

Query  244  SKQ  236
            +KQ
Sbjct  993  TKQ  995



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK+ G+DTI+LA
Sbjct  810  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKAAGQDTIVLA  869

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  870  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  929

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS ++EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  930  GQERYTIDLPSKVSEIRPGQDVTVVTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  989

Query  244  SKQ  236
             K 
Sbjct  990  MKH  992



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   347 bits (890),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DTI+LA
Sbjct  810  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDTIVLA  869

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  870  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  929

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I++IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  930  GHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  989

Query  244  SKQ  236
             KQ
Sbjct  990  IKQ  992



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   345 bits (885),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILA
Sbjct  716  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  836  GHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   347 bits (889),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  809  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  868

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSS DWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  869  GAEYGSGSSSDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  928

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  929  GHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  988

Query  244  SKQ  236
            SKQ
Sbjct  989  SKQ  991



>ref|XP_008785076.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=437

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDAAMRYKSEG DT+ILA
Sbjct  253  RRGNDEVMARGTFANIRLVNKLLKGEPGPKTIHIPSGEKLSVFDAAMRYKSEGHDTVILA  312

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  313  GAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  372

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP+++++I+PGQDVTV TDNGK F CTVRFDTEVELAY+NHGGILP+VIR L
Sbjct  373  GHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHGGILPFVIRNL  432



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   347 bits (889),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DTIILA
Sbjct  809  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDTIILA  868

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  869  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  928

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EI+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  929  GHERYTIHLPTDISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  988

Query  244  SKQ  236
            SKQ
Sbjct  989  SKQ  991



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   347 bits (889),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L+GEVGPKTVHIPTGEKL V+DAAMRYK+ G DTI+LA
Sbjct  813  RRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLSVYDAAMRYKNAGHDTIVLA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQDVTV TDNGK+FTCTVRFDT VEL YFNHGGILPY IR L
Sbjct  933  GHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTVRFDTAVELEYFNHGGILPYAIRNL  992

Query  244  SKQ  236
             KQ
Sbjct  993  MKQ  995



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   347 bits (889),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DTIILA
Sbjct  807  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDTIILA  866

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++LGLT
Sbjct  867  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLT  926

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP  I+EI PGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  927  GHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  986

Query  244  SKQ  236
             +Q
Sbjct  987  IQQ  989



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   344 bits (883),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL VFDAAM+YKS G+ TIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQSTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL
Sbjct  836  GQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQL  895

Query  244  SKQ  236
            +K 
Sbjct  896  TKH  898



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   342 bits (876),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +TI+LA
Sbjct  613  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHETIVLA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL 
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLA  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L
Sbjct  733  GHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  792

Query  244  SKQ  236
             KQ
Sbjct  793  IKQ  795



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   346 bits (887),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILA
Sbjct  814  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  934  GHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  993

Query  244  SKQ  236
             KQ
Sbjct  994  IKQ  996



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   345 bits (886),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DTIILA
Sbjct  803  RRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDTIILA  862

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++ GLT
Sbjct  863  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETHGLT  922

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYVIRQL
Sbjct  923  GHERYTIDLPKNISEIRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  982



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   345 bits (886),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILA
Sbjct  818  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILA  877

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  878  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  937

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  938  GHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  997

Query  244  SKQ  236
             KQ
Sbjct  998  IKQ  1000



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   345 bits (886),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKT+H+PTGEKLYV+DAAMRYK+ G+DTI+LA
Sbjct  811  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTIHVPTGEKLYVYDAAMRYKAAGQDTIVLA  870

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML+GVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  871  GAEYGSGSSRDWAAKGPMLVGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLT  930

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+ I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  931  GHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  990

Query  244  SKQ  236
            +K+
Sbjct  991  NKE  993



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   343 bits (881),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYV+DAAMRYKS G+DTI+LA
Sbjct  716  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKSAGQDTIVLA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I++IRPGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERYTIDLPTKISDIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SKQ  236
            +KQ
Sbjct  896  TKQ  898



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G+DTI+LA
Sbjct  797  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKTSGQDTIVLA  856

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLC+K GEDAD+LGLT
Sbjct  857  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKPGEDADTLGLT  916

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++IDLPS I+EI+PGQDV V TD+GK+FTC  RFDTEVELAYFNHGGILPYVIR L
Sbjct  917  GHERFTIDLPSKISEIKPGQDVKVTTDSGKSFTCIARFDTEVELAYFNHGGILPYVIRNL  976

Query  244  SKQ  236
             KQ
Sbjct  977  IKQ  979



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 1/183 (1%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDEIMARGTFANIRLVNKL S + GPKT+HIPTGEKLYVFDAAMRYK++G DTIILA
Sbjct  828   RRGNDEIMARGTFANIRLVNKLCSKD-GPKTIHIPTGEKLYVFDAAMRYKADGHDTIILA  886

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  887   GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  946

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLPS I+EIRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGILPYV+RQL
Sbjct  947   GHERYTIDLPSKIDEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVVRQL  1006

Query  244   SKQ  236
             +KQ
Sbjct  1007  TKQ  1009



>gb|ADP03320.1| aconitate hydratase [Pinus pinaster]
Length=371

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   345 bits (884),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G DTIILA
Sbjct  806  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSSGVDTIILA  865

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  866  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  925

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  926  GHERFTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  985

Query  244  SKQ  236
            SKQ
Sbjct  986  SKQ  988



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DTIILA
Sbjct  812  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDTIILA  871

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  872  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  931

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EIRPGQDV+V TDNGK+F CTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  932  GHERYTIHLPTDISEIRPGQDVSVTTDNGKSFNCTVRFDTEVELAYFNHGGILPYVIRNL  991

Query  244  SKQ  236
            SKQ
Sbjct  992  SKQ  994



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   337 bits (863),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+G+KL VFDAAM+YK+EG DTIILA
Sbjct  503  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGDKLSVFDAAMKYKNEGHDTIILA  562

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  563  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  622

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYVIR++
Sbjct  623  GHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVIRKI  682

Query  244  SKQ  236
            ++Q
Sbjct  683  AEQ  685



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   344 bits (882),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L+GEVGPKTVHIPTGEKL V+DAAMRYK+ G DTI+LA
Sbjct  813  RRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLSVYDAAMRYKNAGLDTIVLA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAG+DAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQDVTV TDNGK+FTCT RFDT VEL YFNHGGILPY IR L
Sbjct  933  GHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTARFDTAVELEYFNHGGILPYAIRSL  992

Query  244  SKQ  236
             KQ
Sbjct  993  MKQ  995



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   344 bits (882),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DTIILA
Sbjct  813  RRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP++I+EI P QDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  933  GHERYTIHLPTDISEISPCQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  992

Query  244  SKQ  236
            SKQ
Sbjct  993  SKQ  995



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   341 bits (875),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +TI+LA
Sbjct  716  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHETIVLA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL 
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLA  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L
Sbjct  836  GHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   341 bits (875),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKL++GEV PKTVHIP+GEKL VFDAAM+YKS G+ TIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLVNGEVAPKTVHIPSGEKLSVFDAAMKYKSAGQSTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL
Sbjct  836  GQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQL  895

Query  244  SKQ  236
            +K 
Sbjct  896  TKH  898



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   343 bits (879),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RY + G DTI+LA
Sbjct  814  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAASRYMAAGHDTIVLA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DAD+LGL+
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADTLGLS  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EI+PGQDVTV TDNGK+FTCT RFDTEVEL YFNHGGILPYVIR L
Sbjct  934  GHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHGGILPYVIRNL  993

Query  244  SK  239
             K
Sbjct  994  MK  995



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   342 bits (878),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRY ++G+DTIILA
Sbjct  793  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYNTQGQDTIILA  852

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  853  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  912

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS ++EIRPGQDVTV TD+GK+FTCT RFDTEVELAYF+HGGILPYVIR L
Sbjct  913  GHERYTIDLPSTVSEIRPGQDVTVVTDSGKSFTCTARFDTEVELAYFDHGGILPYVIRNL  972



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   343 bits (879),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVH+P+GEKL VFDAAM+YKS G+ TIILA
Sbjct  815  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQSTIILA  874

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAD+LGLT
Sbjct  875  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLT  934

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YVIRQL
Sbjct  935  GQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYVIRQL  994

Query  244  SKQ  236
            +++
Sbjct  995  TQR  997



>gb|ADP03120.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03121.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03122.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03125.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03127.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03128.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03129.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03130.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03131.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03135.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03137.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03138.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03140.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03145.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03147.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03148.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03150.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I++++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VF+AA +YKS G+DTI+LA
Sbjct  716  RRGNDEVMARGTFANIRLVNKLLDGEVGPKTVHVPTGEKLSVFEAAEKYKSAGQDTIVLA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP +I++IRPGQDVTV TD+GK+FTCTVRFDTEVELAYFN+GGILPYVIR L
Sbjct  836  GHERYTIDLPDDISKIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNNGGILPYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS ++EIRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNL  895



>gb|ADP03151.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03123.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03124.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03126.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03132.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03133.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03136.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03141.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03142.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03146.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03149.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03152.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03153.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   342 bits (877),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  TIILA
Sbjct  814  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGTIILA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLL +KAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLVIKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  934  GHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  993

Query  244  SKQ  236
             KQ
Sbjct  994  IKQ  996



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   342 bits (878),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +TI+LA
Sbjct  820   RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHETIVLA  879

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL 
Sbjct  880   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLA  939

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L
Sbjct  940   GHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  999

Query  244   SKQ  236
              KQ
Sbjct  1000  IKQ  1002



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAA+RYKS G+DTI+LA
Sbjct  381  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAIRYKSAGQDTIVLA  440

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLT
Sbjct  441  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLT  500

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNHGGILPYVIRQL
Sbjct  501  GHERYSIDLPNDIAQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHGGILPYVIRQL  560



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  503  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  562

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLC+KAGEDAD+LGLT
Sbjct  563  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLT  622

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV R++
Sbjct  623  GHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVARKI  682

Query  244  SKQ  236
            ++Q
Sbjct  683  AEQ  685



>gb|ADP03134.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03139.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  381  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  440

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  441  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  500

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  501  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  560



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+P+GEKL VFDAA +YKSEG DTIILA
Sbjct  613  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPSGEKLSVFDAANKYKSEGHDTIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS++NEIRPGQD+TV TDNGKTF+CT+RFDTEVELAYFNHGGIL Y IR L
Sbjct  733  GHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYAIRNL  792



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAMRYK+ G+ TIILA
Sbjct  795  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMRYKAAGEATIILA  854

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  855  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  914

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I LP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  915  GKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  974

Query  244  SKQ  236
            SKQ
Sbjct  975  SKQ  977



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   340 bits (871),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 2/185 (1%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS ++EIRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNL  895

Query  244  --SKQ  236
              SKQ
Sbjct  896  IGSKQ  900



>gb|ADP03144.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDITKLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   342 bits (876),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKT+ +PTGEKLYV+DAAMRYK+ G+DTI+LA
Sbjct  811  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTILVPTGEKLYVYDAAMRYKAAGQDTIVLA  870

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  871  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLT  930

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP+ I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYF+HGGILP+VIR L
Sbjct  931  GHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNL  990

Query  244  SKQ  236
            +++
Sbjct  991  NRE  993



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR++NKLL+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DTIILA
Sbjct  814  RRGNDEIMARGTFANIRILNKLLNGEVGPKTIHIPSGEKLTVFDAAMKYKSAGQDTIILA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFK+GEDAD+LGLT
Sbjct  874  GDEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS++++IRPGQD+TVKTD GK FTCTVRFDTEVELAYFNHGGIL YVIRQL
Sbjct  934  GHERYTIDLPSSVSDIRPGQDITVKTDTGKQFTCTVRFDTEVELAYFNHGGILQYVIRQL  993

Query  244  SKQ  236
            + +
Sbjct  994  AAK  996



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   342 bits (876),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVH+PTGEKLYVFDAAM+YK  G  TI+LA
Sbjct  833   RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHVPTGEKLYVFDAAMKYKEAGHQTIVLA  892

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMG++PLCFKAGEDAD+LGLT
Sbjct  893   GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGVIPLCFKAGEDADTLGLT  952

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLPS ++EIRPGQD+TV TD GK+FTCT+RFDTEVELAYF+HGGILPYVIRQL
Sbjct  953   GHERYTIDLPSKVSEIRPGQDITVTTDTGKSFTCTLRFDTEVELAYFDHGGILPYVIRQL  1012

Query  244   SK  239
              K
Sbjct  1013  MK  1014



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   341 bits (874),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YK+ G+ TIILA
Sbjct  799  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKAAGEATIILA  858

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDADSLGLT
Sbjct  859  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLT  918

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I LP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  919  GKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  978

Query  244  SKQ  236
            SKQ
Sbjct  979  SKQ  981



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILA
Sbjct  597  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILA  656

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  657  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  716

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  717  GEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  776

Query  244  SKQ  236
             K 
Sbjct  777  IKS  779



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   340 bits (871),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 2/185 (1%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DTIILA
Sbjct  745  RRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDTIILA  804

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  805  GAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  864

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS ++EIRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  865  GHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNL  924

Query  244  --SKQ  236
              SKQ
Sbjct  925  IGSKQ  929



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   339 bits (869),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKTVHIP+GEKL VFDAAMRYKSEG DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKFLGGEVGPKTVHIPSGEKLSVFDAAMRYKSEGHDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETFGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS++ EIRPGQDVTV TDNGK+FTCT+RFDTEVELAYF+HGGILP+VIR L
Sbjct  836  GHERYNIDLPSSVAEIRPGQDVTVTTDNGKSFTCTLRFDTEVELAYFDHGGILPFVIRNL  895



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILA
Sbjct  716  RRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS+++EIRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTIDLPSSVSEIRPGQDITVVTDNGKSFICTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   338 bits (868),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G DTI+LA
Sbjct  716  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHDTIVLA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+ LCFK GEDAD+LGL 
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIILLCFKPGEDADTLGLA  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYVIR L
Sbjct  836  GHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILA
Sbjct  613  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  733  GEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  792

Query  244  SKQ  236
             K 
Sbjct  793  IKS  795



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILA
Sbjct  613  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  733  GEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  792

Query  244  SKQ  236
             K 
Sbjct  793  IKS  795



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   340 bits (872),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK+ G+DTI+LA
Sbjct  815  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKTAGQDTIVLA  874

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGPMLLGV+AVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  875  GTEYGSGSSRDWAAKGPMLLGVQAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  934

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS I+EIRPGQDVTV TD GK+FTCTVRFDTEVEL YFN+GGILPYVIR L
Sbjct  935  GHERYTIDLPSKISEIRPGQDVTVVTDTGKSFTCTVRFDTEVELEYFNNGGILPYVIRNL  994

Query  244  SKQ  236
             K 
Sbjct  995  MKH  997



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKL VFDAAM+YK+  + TIILA
Sbjct  805  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLSVFDAAMKYKTANQGTIILA  864

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  865  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  924

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSNI+EIRPGQD+TV T+ GK+F CT RFDTEVELAYFNHGGILPYVIR L
Sbjct  925  GHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTARFDTEVELAYFNHGGILPYVIRNL  984

Query  244  SKQ  236
             KQ
Sbjct  985  IKQ  987



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYV+DAAMRYKS G+DTI+LA
Sbjct  828   RRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVYDAAMRYKSSGQDTIVLA  887

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDA++LGLT
Sbjct  888   GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGILPLCFKAGEDAETLGLT  947

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLP   ++I+PGQD+TV TDNGK+FTCT+RFDTEVEL YF+HGGIL YVIR L
Sbjct  948   GHERYTIDLPEKTSDIKPGQDITVTTDNGKSFTCTLRFDTEVELTYFDHGGILQYVIRNL  1007

Query  244   SKQ  236
             SKQ
Sbjct  1008  SKQ  1010



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILA
Sbjct  697  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILA  756

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT
Sbjct  757  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  816

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++IDLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  817  GHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  876



>gb|ADP03143.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT++IPTGEKL V+DAAMRYKS G DTI+LA
Sbjct  187  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIYIPTGEKLSVYDAAMRYKSAGHDTIVLA  246

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFK+GEDA+SLGLT
Sbjct  247  GSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLT  306

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+ID+P++I++++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV+RQL
Sbjct  307  GHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   338 bits (866),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++IDLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+P+GEKL VFDAA +YKSEG DTIILA
Sbjct  717  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPSGEKLSVFDAANKYKSEGHDTIILA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  777  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS++NEIRPGQD+TV TDNGKTF+CT+RFDTEVELAYFNHGGIL Y IR L
Sbjct  837  GHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DTIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFD AMRYKSEG DTIILA
Sbjct  716  RRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDVAMRYKSEGHDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS+++EIRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFD AMRYKSEG DTIILA
Sbjct  716  RRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDVAMRYKSEGHDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS+++EIRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++IDLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  895



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   332 bits (851),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  518  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  577

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  578  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  637

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  638  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  697



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   338 bits (867),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YK+ G+ TIILA
Sbjct  798  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKAAGEATIILA  857

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLT
Sbjct  858  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLT  917

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I LP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYVIR L
Sbjct  918  GKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  977

Query  244  SKQ  236
            S+Q
Sbjct  978  SRQ  980



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   335 bits (860),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGP+T+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  677  RRGNDEIMARGTFANIRIVNKFLKGEVGPQTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  736

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIVPLCFKAGEDAD+LGLT
Sbjct  737  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLT  796

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+++NEI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+ HGGILPYVIR++
Sbjct  797  GHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYVIRKI  856

Query  244  SKQ  236
            + +
Sbjct  857  AAE  859



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   338 bits (868),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL GEVGPKTVHIPTG+KLYVF+ AMRYK++G DTI+LA
Sbjct  819  RRGNDEIMARGTFANIRLVNKLLKGEVGPKTVHIPTGDKLYVFEVAMRYKADGHDTIVLA  878

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  879  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  938

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+I +IRPGQD+TV  DNGK+FTCT+RFDTEVELAYFNHGGILP+VIR L
Sbjct  939  GHERYTIDLPSSITDIRPGQDITVVVDNGKSFTCTLRFDTEVELAYFNHGGILPFVIRNL  998



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   338 bits (867),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYV+DAAMRYKS G DTI+LA
Sbjct  829   RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKSAGHDTIVLA  888

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  889   GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  948

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             G ERY+IDLP+  ++IRPGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  949   GQERYTIDLPTKKSDIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  1008

Query  244   SKQ  236
             SKQ
Sbjct  1009  SKQ  1011



>gb|ACK56134.1| putative aconitase, partial [Dimocarpus longan]
Length=167

 Score =   313 bits (803),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYKSEG +TIILA
Sbjct  3    RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHNTIILA  62

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFK GEDA++L LT
Sbjct  63   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDAETLSLT  122

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELA  290
            GHERY+IDLPS+++EIRPGQDV+V TDNGK+FTCTVRFDTEVELA
Sbjct  123  GHERYTIDLPSSVSEIRPGQDVSVVTDNGKSFTCTVRFDTEVELA  167



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   336 bits (861),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 2/185 (1%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIPTGEKL V+D AMRYK+ G+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPTGEKLSVYDVAMRYKAAGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  776  GVEYGSGSSRDWAAKGPVLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ ++EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GHERYTIDLPNTVSEIRPGQDVTVATDCGKSFTCTVRFDTEVELAYFNHGGILQYVIRNL  895

Query  244  --SKQ  236
              SKQ
Sbjct  896  IGSKQ  900



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA +YKSEG DTIILA
Sbjct  674  RRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAATKYKSEGHDTIILA  733

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  734  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  793

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++++EIRPGQDVT+ TDN K+FTC +RFDTEVELAY+NHGGILPYVIR +
Sbjct  794  GHERYTINLPTDVSEIRPGQDVTISTDNDKSFTCILRFDTEVELAYYNHGGILPYVIRNM  853

Query  244  S  242
            +
Sbjct  854  A  854



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   335 bits (860),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EI+PGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  836  GHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  895



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   335 bits (860),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFD AM+YKSEG DTIILA
Sbjct  716  RRGNDEVMARGTFANIRIVNKLLGGEVGPKTIHIPSGEKLSVFDVAMKYKSEGHDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYSIDLP++++EIRPGQDV V TDNGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERYSIDLPNSVSEIRPGQDVKVLTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILA
Sbjct  734  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDTIILA  793

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DA++LGLT
Sbjct  794  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLT  853

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EI+PGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  854  GHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  913



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   337 bits (864),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL+VFDAAMRYK  G++TI+LA
Sbjct  808  RRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLHVFDAAMRYKEAGENTIVLA  867

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHR NLVGMGI+PLCFK GEDAD+LGLT
Sbjct  868  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRGNLVGMGIIPLCFKPGEDADTLGLT  927

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP  I+EIRPGQ+V VKTD GK+F C VRFDTEVELAYF+HGGILPYVIR L
Sbjct  928  GHERYTIDLPDKISEIRPGQEVGVKTDTGKSFACRVRFDTEVELAYFDHGGILPYVIRNL  987

Query  244  SKQ  236
            SK+
Sbjct  988  SKE  990



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   336 bits (862),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+M+RGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+ G  TI+LA
Sbjct  797  RRGNDEVMSRGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKASGHATIVLA  856

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  857  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  916

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ I+EI+PGQDVTV TD GK+FTCT RFDTEVEL YFNHGGILPYVIR L
Sbjct  917  GHERYTIDLPNKISEIKPGQDVTVTTDTGKSFTCTARFDTEVELEYFNHGGILPYVIRNL  976

Query  244  SKQ  236
             K+
Sbjct  977  IKK  979



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+G+KL VFDAAM+YK+EG DTIILA
Sbjct  807  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGDKLSVFDAAMKYKNEGHDTIILA  866

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  867  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  926

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYVIR++
Sbjct  927  GHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVIRKI  986

Query  244  SKQ  236
            ++Q
Sbjct  987  AEQ  989



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  809  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  868

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  869  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  928

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV R++
Sbjct  929  GHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVTRKI  988

Query  244  SKQ  236
            ++Q
Sbjct  989  AEQ  991



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   337 bits (864),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIR++NKLL+GEVGPKT+HIP+GEKLYV+DAAMRYKS G  TI++A
Sbjct  835   RRGNDEVMARGTFANIRIINKLLNGEVGPKTIHIPSGEKLYVYDAAMRYKSAGHGTIVIA  894

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GED ++LGLT
Sbjct  895   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDTETLGLT  954

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLP +I++IRPGQD+TV TDNG++FTC +RFDTEVELAYF+HGGILPYVIR L
Sbjct  955   GHERYTIDLPHSISDIRPGQDITVTTDNGRSFTCILRFDTEVELAYFDHGGILPYVIRNL  1014

Query  244   SKQ  236
             SKQ
Sbjct  1015  SKQ  1017



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   337 bits (865),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGND++MARGTFANIR++NKLL+GEV PKT+HIPTGEKLYV+DAAMRYKS G DTI++A
Sbjct  882   RRGNDQVMARGTFANIRIINKLLNGEVSPKTIHIPTGEKLYVYDAAMRYKSAGHDTIVIA  941

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  942   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAEALGLT  1001

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+IDLP  I++IRPGQD+TV TD+GK+FTCT+RFDTEVELAYF+HGGILPYVIR L
Sbjct  1002  GHERYTIDLPQRISDIRPGQDLTVTTDSGKSFTCTLRFDTEVELAYFDHGGILPYVIRNL  1061

Query  244   SK  239
             SK
Sbjct  1062  SK  1063



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  613  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  733  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  792



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG  TIILA
Sbjct  720  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHATIILA  779

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  780  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLT  839

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS++ EI+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  840  GEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  899

Query  244  SK  239
             K
Sbjct  900  IK  901



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   336 bits (861),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAA+RYKSEG DT+ILA
Sbjct  808  RRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAALRYKSEGHDTVILA  867

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  868  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  927

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LPS++++I+PGQDVTV TDNGK+FTC VRFDTEVELAY+NHGGILP+VIR L
Sbjct  928  GHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFVIRNL  987



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   335 bits (858),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA +YKSEG DTIILA
Sbjct  753  RRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAATKYKSEGHDTIILA  812

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDADSLGLT
Sbjct  813  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLT  872

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++++EIRPGQDVT+ TDN K+FTC +RFDTEVELAY+NHGGILPYVIR +
Sbjct  873  GHERYTINLPTDVSEIRPGQDVTITTDNDKSFTCILRFDTEVELAYYNHGGILPYVIRNM  932

Query  244  S  242
            +
Sbjct  933  A  933



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   335 bits (860),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDAAMRYKSE  DT+ILA
Sbjct  811  RRGNDEVMARGTFANIRLVNKLLKGEAGPKTIHIPSGEKLSVFDAAMRYKSEEHDTVILA  870

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  871  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  930

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP N+++I+PGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGILP+VIR L
Sbjct  931  GHERYTINLPDNVSDIKPGQDVTVVTDNGKSFTCTVRFDTEVELAYYNHGGILPFVIRNL  990



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG  TIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHATIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS++ EI+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   335 bits (860),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+GEKL VFDAA RYKSEG DTIILA
Sbjct  803  RRGNDEIMARGTFANIRIVNKFLGGEVGPKTIHVPSGEKLSVFDAATRYKSEGHDTIILA  862

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLC+K GEDADSLGLT
Sbjct  863  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCYKTGEDADSLGLT  922

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++I+LP+++++IRPGQDVT+ TDNGK+F+CT+RFDTEVELAY+NHGGILPYVIR L
Sbjct  923  GHERFTINLPTDVSKIRPGQDVTITTDNGKSFSCTLRFDTEVELAYYNHGGILPYVIRSL  982

Query  244  SKQ  236
            + Q
Sbjct  983  AGQ  985



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   335 bits (859),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAAM+YK+EG DTIILA
Sbjct  804  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLAVFDAAMKYKNEGHDTIILA  863

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  864  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  923

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+N++EI+PGQDVTV TD GK+FTCT+RFDTEVELAY++HGGILPYV R++
Sbjct  924  GHERYTIHLPTNVSEIKPGQDVTVTTDTGKSFTCTLRFDTEVELAYYDHGGILPYVTRKI  983

Query  244  SKQ  236
            ++Q
Sbjct  984  AEQ  986



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   331 bits (849),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DTIILA
Sbjct  613  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  733  GQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  792

Query  244  SKQ  236
             KQ
Sbjct  793  IKQ  795



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HI TGEKL VFD AMRYKSEG+DT+ILA
Sbjct  715  RRGNDEVMARGTFANIRLVNKLLGGEVGPKTIHISTGEKLSVFDVAMRYKSEGRDTVILA  774

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  775  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  834

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHE YSIDLPSN++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  835  GHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFACTLRFDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HI TGEKL VFDAAMR KSEG+DT+ILA
Sbjct  715  RRGNDEVMARGTFANIRLVNKLLGGEVGPKTIHISTGEKLSVFDAAMRCKSEGRDTVILA  774

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  775  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  834

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHE YSIDLPSN++EIRPGQDVTV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  835  GHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFTCTLRFDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   332 bits (852),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRY+SEG  TIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYRSEGHATIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS++ EI+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  705  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  764

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  765  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  824

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  825  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  884



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L GEVGPKT+HIPTGEKL VFDAA+RYKSEG DT+ILA
Sbjct  813  RRGNDEVMARGTFANIRIVNKFLKGEVGPKTIHIPTGEKLSVFDAAVRYKSEGHDTVILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LPS++++I+PGQDVTV TDNGK+FTC VRFDTEVELAY+NHGGILP+VIR L
Sbjct  933  GHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFVIRNL  992



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   333 bits (855),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIP+GEKL VFD AMRYK EG DTIILA
Sbjct  793  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPSGEKLSVFDTAMRYKDEGHDTIILA  852

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIVPLCFK GEDAD+LGLT
Sbjct  853  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDADTLGLT  912

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LPSN+++I+PGQDVTV TD GK FTCTVRFDTEVELAY+ HGGILPYV+R L
Sbjct  913  GHERYTINLPSNVSDIKPGQDVTVTTDTGKLFTCTVRFDTEVELAYYGHGGILPYVVRSL  972



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   333 bits (855),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA++YKSEG DTIILA
Sbjct  800  RRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAALKYKSEGHDTIILA  859

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+P+CFKAGEDADSLGLT
Sbjct  860  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPMCFKAGEDADSLGLT  919

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP+++ +IRPGQDVT+ T++GK+FTC +RFDTEVELAY+NHGGILPYVIR +
Sbjct  920  GHERYTINLPTDVGQIRPGQDVTITTEDGKSFTCILRFDTEVELAYYNHGGILPYVIRNM  979

Query  244  S  242
            +
Sbjct  980  A  980



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  816  RRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  875

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIVPLCFKAGEDAD+LGLT
Sbjct  876  GAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLT  935

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+++NEI+PGQDVTV TDNGK+FTCT+RFDTEVE+AY+ HGGILPYVIR++
Sbjct  936  GHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVEIAYYTHGGILPYVIRKI  995

Query  244  SKQ  236
            + +
Sbjct  996  AAE  998



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  714  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  773

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  774  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  833

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  834  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  893



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   331 bits (849),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  697  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  756

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  757  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  816

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  817  GHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  876



>gb|KHG24816.1| Aconitate hydratase 1 -like protein [Gossypium arboreum]
Length=813

 Score =   329 bits (844),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 173/185 (94%), Gaps = 2/185 (1%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRY + G+DTIILA
Sbjct  629  RRGNDEVMARGTFANIRLVNKLLEGEVGPKTIHIPTGEKLSVYDAAMRYNTAGQDTIILA  688

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPM+LG+KAVIAKSFE+IHRSNLVGMGI+PLCFK G+DAD+LGLT
Sbjct  689  GAEYGSGSSRDWAAKGPMMLGIKAVIAKSFEQIHRSNLVGMGIIPLCFKPGDDADTLGLT  748

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++++EIRPGQDVTV TD  K+F+CTVRFDTEVELAYFNHGGIL YVIR L
Sbjct  749  GHERYTINLPNSVSEIRPGQDVTVATDTSKSFSCTVRFDTEVELAYFNHGGILQYVIRNL  808

Query  244  --SKQ  236
              SKQ
Sbjct  809  VGSKQ  813



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ G+DTIILA
Sbjct  613  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDTIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  673  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  733  GHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  792

Query  244  SKQ  236
            S +
Sbjct  793  STK  795



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   331 bits (848),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+IDLP+N++EI+PGQD+TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GQELYTIDLPNNVSEIKPGQDITVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   333 bits (853),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK  G+DTI+LA
Sbjct  817  RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKEAGQDTIVLA  876

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  877  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFETIHRSNLVGMGIIPLCFKPGEDADTLGLT  936

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G+ERY+IDLP  I+EIRPGQDVTV TDNG +FTC  RFDT+VELAYF+HGGIL YVIR L
Sbjct  937  GNERYTIDLPDKISEIRPGQDVTVTTDNGNSFTCIARFDTQVELAYFDHGGILQYVIRNL  996

Query  244  SKQ  236
             K+
Sbjct  997  IKE  999



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   330 bits (847),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   330 bits (847),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++ GLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP++++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GHERYTIDLPNSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYKSEG  TIILA
Sbjct  613  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHATIILA  672

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLT
Sbjct  673  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLT  732

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++++EIRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  733  GHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  792



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILA
Sbjct  725  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILA  784

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLT
Sbjct  785  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLT  844

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++
Sbjct  845  GHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKI  904

Query  244  SKQ  236
            ++Q
Sbjct  905  AEQ  907



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   332 bits (851),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ G+DTIILA
Sbjct  813  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDA+SLGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAESLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ ++EIRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSEIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  STK  995



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   332 bits (850),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTG+KLYVF+AAMRYK++G DTI+LA
Sbjct  809  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGDKLYVFEAAMRYKADGYDTIVLA  868

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  869  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  928

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G+E Y+IDLPS I++IRPGQD+TV TD+GK+FTCT+RFDTEVELAYFNHGGILP+VIR L
Sbjct  929  GYESYTIDLPSCISDIRPGQDITVVTDSGKSFTCTLRFDTEVELAYFNHGGILPFVIRNL  988



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNK L GEVGPKT+H+P+GEKL  FDAA RYKSEG DTI+LA
Sbjct  802  RRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLSAFDAATRYKSEGHDTIVLA  861

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLT
Sbjct  862  GEEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLT  921

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LPSN+++I+PGQDVTV TD GK+FTCTVRFDTEVELAY+NHGGILPYVIR L
Sbjct  922  GHERYTIHLPSNVSDIKPGQDVTVTTDTGKSFTCTVRFDTEVELAYYNHGGILPYVIRSL  981

Query  244  SK  239
             K
Sbjct  982  IK  983



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+M+RGTFANIRLVNKLL+GEVG KTVH+PTGEKLYVFDAA RYK+ G DTI+LA
Sbjct  803  RRGNDEVMSRGTFANIRLVNKLLNGEVGAKTVHVPTGEKLYVFDAAERYKAAGHDTIVLA  862

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDAD+LGLT
Sbjct  863  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLT  922

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLP  I+EI+PGQDVTV TD GK+FTC  RFDTEVEL YFNHGGILPYVIR L
Sbjct  923  GRERYTIDLPDKISEIKPGQDVTVTTDTGKSFTCKARFDTEVELEYFNHGGILPYVIRNL  982

Query  244  SK  239
            +K
Sbjct  983  AK  984



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAA++Y++EG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAALKYRNEGRDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGND++MARGTFANIR+VNKLL GEVGPKT+H PT EKL VFD AMRYKSEG DT+ILA
Sbjct  715  RRGNDDVMARGTFANIRIVNKLLGGEVGPKTIHFPTREKLSVFDVAMRYKSEGHDTVILA  774

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLT
Sbjct  775  GAEYGSGSSRDWAAKGPMLLGVKAVMAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLT  834

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERYS+DLPSN++EIRPGQDVTV TDNGK FTCT+R+DTEVELAYF+HGGIL Y IR L
Sbjct  835  GHERYSLDLPSNVSEIRPGQDVTVVTDNGKQFTCTLRYDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILA
Sbjct  719  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILA  778

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  779  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  838

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  839  GEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNL  898

Query  244  SKQ  236
             KQ
Sbjct  899  IKQ  901



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   329 bits (844),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFDAA +YKSEG D IILA
Sbjct  717  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYKSEGHDMIILA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DADSLGLT
Sbjct  777  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADSLGLT  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR +
Sbjct  837  GHERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYVIRNM  896



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   331 bits (848),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILA
Sbjct  804  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILA  863

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLT
Sbjct  864  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLT  923

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++
Sbjct  924  GHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKI  983

Query  244  SKQ  236
            ++Q
Sbjct  984  AEQ  986



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   329 bits (843),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFDAA +YK+EG D IILA
Sbjct  717  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYKNEGHDMIILA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDADSLGLT
Sbjct  777  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLT  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS++NEIRPGQDVTV TD GKTF  T+RFDTEVELAYFNHGGIL Y IR L
Sbjct  837  GHERYTIDLPSDVNEIRPGQDVTVVTDTGKTFVSTLRFDTEVELAYFNHGGILQYAIRNL  896



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   330 bits (847),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILA
Sbjct  804  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILA  863

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLT
Sbjct  864  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLT  923

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++
Sbjct  924  GHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKI  983

Query  244  SKQ  236
            ++Q
Sbjct  984  AEQ  986



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   329 bits (843),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DTIILA
Sbjct  724  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDTIILA  783

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFK+GEDAD+LGLT
Sbjct  784  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLT  843

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER+++ LP+N+++I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYVIR++
Sbjct  844  GHERFTVHLPANVSDIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKI  903

Query  244  SKQ  236
            ++Q
Sbjct  904  AEQ  906



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   330 bits (847),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDA MRYKSEG DT+ILA
Sbjct  814  RRGNDEVMARGTFANIRLVNKLLKGEPGPKTIHIPSGEKLSVFDATMRYKSEGHDTVILA  873

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  874  GAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLT  933

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP+++++I+PGQDVTV TDNGK F CTVRFDTEVELAY+NHGGILP+VIR L
Sbjct  934  GHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHGGILPFVIRNL  993



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   328 bits (842),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+YK+EG+DTIILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYKNEGRDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++L LT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLRLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LPSN++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   330 bits (846),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK++G+DTIILA
Sbjct  815  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTDGQDTIILA  874

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  875  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLT  934

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  935  GHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  994

Query  244  SKQ  236
            S +
Sbjct  995  STK  997



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   330 bits (846),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKL+ GEVGPKTVHIPTGEKL VFDAA RYK+ G+DT+ILA
Sbjct  817  RRGNDEVMARGTFANIRIVNKLVDGEVGPKTVHIPTGEKLSVFDAASRYKTAGQDTVILA  876

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  877  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  936

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  937  GHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  996

Query  244  SKQ  236
            S +
Sbjct  997  STK  999



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   328 bits (841),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+YK+EG+DTIILA
Sbjct  740  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYKNEGRDTIILA  799

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++L LT
Sbjct  800  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLRLT  859

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LPSN++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  860  GEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNL  919

Query  244  SKQ  236
             KQ
Sbjct  920  IKQ  922



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   330 bits (845),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAAM+YK+EG DTIILA
Sbjct  811  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLAVFDAAMKYKNEGHDTIILA  870

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  871  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  930

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++I LP+N+++I+PGQDVTV TD GK+FTCT+RFDTEVELAY+ +GGILPYVIR++
Sbjct  931  GHERFTIQLPTNVSDIKPGQDVTVTTDAGKSFTCTLRFDTEVELAYYTNGGILPYVIRKI  990

Query  244  SKQ  236
            + +
Sbjct  991  AAE  993



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYKSEG  TIILA
Sbjct  714  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHATIILA  773

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLT
Sbjct  774  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLT  833

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++++EIRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  834  GHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  893



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYKSEG  TIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHATIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I+LP++++EIRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y IR L
Sbjct  836  GHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  895



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   330 bits (845),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ G+DTIILA
Sbjct  816  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDTIILA  875

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  876  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLT  935

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  936  GHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  995

Query  244  S  242
            S
Sbjct  996  S  996



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+M RGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYV+DAAMRYKSEG DTI++A
Sbjct  798  RRGNDEVMTRGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKSEGHDTIVVA  857

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PL FK GEDA++LGLT
Sbjct  858  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGLIPLSFKHGEDAETLGLT  917

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHE Y+IDLP  I++IRPGQDV V TD+GK+F CT+RFDTEVEL YF HGGILPYVIR L
Sbjct  918  GHECYTIDLPQKISDIRPGQDVAVTTDSGKSFICTLRFDTEVELTYFEHGGILPYVIRNL  977

Query  244  SKQ  236
            +KQ
Sbjct  978  TKQ  980



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFD A +YKSEG D IILA
Sbjct  717  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDVAEKYKSEGHDMIILA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  777  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLT  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR L
Sbjct  837  GQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  896



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVEL YFNHGGIL YVIR L
Sbjct  836  GQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELEYFNHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   336 bits (862),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDEIMARGTFANIR+VNK L GEVGP+T+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  1784  RRGNDEIMARGTFANIRIVNKFLKGEVGPQTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  1843

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIVPLCFKAGEDAD+LGLT
Sbjct  1844  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLT  1903

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             GHERY+I LP+++NEI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+ HGGILPYVIR++
Sbjct  1904  GHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYVIRKI  1963

Query  244   SKQ  236
             + +
Sbjct  1964  AAE  1966



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   327 bits (839),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILA
Sbjct  743  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILA  802

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  803  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  862

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  863  GEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  922

Query  244  SKQ  236
             KQ
Sbjct  923  IKQ  925



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   328 bits (841),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 174/200 (87%), Gaps = 17/200 (9%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAM-------------  644
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKL VFD AM             
Sbjct  776  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVFDTAMVDCISIDCLKLYV  835

Query  643  ----RYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI  476
                RYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG+
Sbjct  836  WLLQRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGV  895

Query  475  VPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVE  296
            +PLCFK GEDA++LGLTGHERY+IDLPS+++EI+PGQDVT+ TD+GK+FTCT+RFDTEVE
Sbjct  896  IPLCFKPGEDAETLGLTGHERYTIDLPSSVSEIKPGQDVTMVTDDGKSFTCTLRFDTEVE  955

Query  295  LAYFNHGGILPYVIRQLSKQ  236
            LAYF+HGGILPYVIR L K 
Sbjct  956  LAYFDHGGILPYVIRNLIKS  975



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   328 bits (841),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA RY + G+DT+ILA
Sbjct  817  RRGNDEIMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASRYMNAGQDTVILA  876

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVI+KSFERIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  877  GAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLT  936

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ ++EIRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  937  GHERYTVHLPTKVSEIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  996

Query  244  SKQ  236
            S +
Sbjct  997  STK  999



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFDAA +YKSEG D IILA
Sbjct  717  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYKSEGHDMIILA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G+DADSLGLT
Sbjct  777  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADSLGLT  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR +
Sbjct  837  GQERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYVIRNM  896



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   326 bits (835),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+ ++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   328 bits (840),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY + G+DT+ILA
Sbjct  813  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDTVILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  SAK  995



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   328 bits (840),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY + G+DT+ILA
Sbjct  813  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDTVILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  SAK  995



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   326 bits (835),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFD A +YKSEG D IILA
Sbjct  724  RRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDVAEKYKSEGHDMIILA  783

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAK FERIHRSNLVGMGI+PLCFK GEDADSLGLT
Sbjct  784  GAEYGSGSSRDWAAKGPMLLGVKAVIAKGFERIHRSNLVGMGIIPLCFKPGEDADSLGLT  843

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YVIR L
Sbjct  844  GQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  903



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNK ++GEVGPKT+HIP+GEKL VFDAA +YK+EG D IILA
Sbjct  717  RRGNDEVMARGTFANIRIVNKFMNGEVGPKTIHIPSGEKLSVFDAATKYKTEGHDMIILA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP LLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  777  GAEYGSGSSRDWAAKGPKLLGVKAVISKSFERIHRSNLVGMGIIPLCFKDGEDAETLGLT  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHER++IDLPSN+NEIRPGQD+ V TDNGKTF CT+RFDTEVELAYFNHGGIL Y IR L
Sbjct  837  GHERFTIDLPSNVNEIRPGQDIAVVTDNGKTFLCTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNKLL GEVGPKT+H+P+GE L VFD AM+Y S+G+DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKLLGGEVGPKTIHVPSGETLSVFDVAMKYNSDGQDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHE+Y+I+LPSN+ EI+PGQDVTV T+NGK+F+CT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  836  GHEQYNIELPSNVGEIKPGQDVTVVTNNGKSFSCTLRFDTEVELAYFNHGGILQYVIRNL  895



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   325 bits (834),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DTIILA
Sbjct  723  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTIILA  782

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  783  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  842

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+N++EI+PGQDVTV T+NGK+FT T+RFDTEVELAYFNHGGIL YVIR L
Sbjct  843  GEELYTIELPNNVSEIKPGQDVTVITNNGKSFTSTLRFDTEVELAYFNHGGILQYVIRNL  902

Query  244  SKQ  236
             KQ
Sbjct  903  IKQ  905



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY + G+DT+ILA
Sbjct  813  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDTVILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVI+KSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  SAK  995



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+ ++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT+ILA
Sbjct  716  RRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDTVILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFK GEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E Y+I+LP+ ++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SKQ  236
             KQ
Sbjct  896  IKQ  898



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H PTG+K+ VFDAAM+YKSEG DTIILA
Sbjct  716  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHHPTGDKVSVFDAAMKYKSEGHDTIILA  775

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDA++LGLT
Sbjct  776  GAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLT  835

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+IDLPS ++EI+PGQD+TV T NGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  836  GEERYTIDLPSTVSEIKPGQDITVVTSNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNL  895

Query  244  SK  239
             K
Sbjct  896  IK  897



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+  +DTIILA
Sbjct  725  RRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDTIILA  784

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  785  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLT  844

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  845  GHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  904

Query  244  SKQ  236
            S +
Sbjct  905  SAK  907



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   325 bits (833),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+  +DTIILA
Sbjct  813  RRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAEQDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFK+GEDA++LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDAETLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  SAK  995



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   324 bits (831),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFA+IR+VNKL  GEVGPKTVHIPTGEKL VFDAA RYK+ G+DT+ILA
Sbjct  780  RRGNDEVMARGTFASIRIVNKLADGEVGPKTVHIPTGEKLTVFDAASRYKTAGQDTVILA  839

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAV AKSFERIHRSNL GMGI+PLCFKAGEDAD+LGLT
Sbjct  840  GAEYGSGSSRDWAAKGPLLLGVKAVTAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLT  899

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  900  GHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  959

Query  244  SKQ  236
            S +
Sbjct  960  STK  962



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   324 bits (831),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+  +DTIILA
Sbjct  813  RRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  SAK  995



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+  +DTIILA
Sbjct  813  RRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDTIILA  872

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP+LLGVKAVIAKSF RIHRSNL GMGI+PLCFKAGEDA++LGLT
Sbjct  873  GAEYGSGSSRDWAAKGPLLLGVKAVIAKSFGRIHRSNLAGMGIIPLCFKAGEDAETLGLT  932

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYVIR L
Sbjct  933  GHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSL  992

Query  244  SKQ  236
            S +
Sbjct  993  SAK  995



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGP+T+HIPTG+KL VFDAA +YKSEG+DTIILA
Sbjct  718  RRGNDEVMARGTFANIRLVNKLLRGEVGPETIHIPTGQKLSVFDAATKYKSEGQDTIILA  777

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRSNLVGMGIVPLCFK GEDA++LGLT
Sbjct  778  GSEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKVGEDAETLGLT  837

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G E+Y+++LP+ INEI+PGQDV V TD+GK+F CT+RFDTEVELAYFNHGGIL YVIR L
Sbjct  838  GFEQYNVELPNEINEIKPGQDVKVITDDGKSFVCTLRFDTEVELAYFNHGGILQYVIRNL  897



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   320 bits (819),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  784   RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
             RRGNDE+MARGTFANIRL+NK L+ +  PKT+HIPTGE+LYV+DAAMRYKS G+DTIILA
Sbjct  829   RRGNDEVMARGTFANIRLLNKFLNKQ-APKTIHIPTGEELYVYDAAMRYKSAGQDTIILA  887

Query  604   GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
             G EYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGLT
Sbjct  888   GTEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLT  947

Query  424   GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
             G+ERYSIDLP  ++++RPGQD+TV TD+GK+FTC VRFDT+VEL YF+HGGILPYVIR L
Sbjct  948   GYERYSIDLPKKVSDVRPGQDITVTTDDGKSFTCVVRFDTQVELTYFDHGGILPYVIRNL  1007

Query  244   SK  239
             +K
Sbjct  1008  AK  1009



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MA+G FA+IR+VNK+L GEVGPKT+HIPTG+KL V+DAA RYK+ G+DTIILA
Sbjct  701  RRGNDEVMAKGAFADIRIVNKILKGEVGPKTIHIPTGDKLNVYDAATRYKATGQDTIILA  760

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G +YGSGSSRDWAAKG MLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD LGLT
Sbjct  761  GEDYGSGSSRDWAAKGSMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADFLGLT  820

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLPS I EIRPGQDVT+ TD GK+FTCT  FDT+VEL YF+HGGILPYVIR L
Sbjct  821  GHERYTIDLPSKIKEIRPGQDVTITTDTGKSFTCTAWFDTKVELEYFDHGGILPYVIRNL  880

Query  244  SK  239
            +K
Sbjct  881  NK  882



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   317 bits (813),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VN+LL+GEVGPKT+H+PT +KL+VFDAAMRYK++G  TI+LA
Sbjct  793  RRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTSDKLFVFDAAMRYKADGHHTIVLA  852

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GEDADSLGLT
Sbjct  853  GEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLT  912

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+N++EI+PGQDV V TD GK+FTC +R DT VELAYF+HGGIL YV+R L
Sbjct  913  GHERYTIRLPTNVSEIQPGQDVQVVTDTGKSFTCKLRIDTLVELAYFDHGGILHYVLRNL  972

Query  244  SKQ*ATQ  224
             KQ   Q
Sbjct  973  VKQQQQQ  979



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   317 bits (811),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VN+LL+GEVGPKT+H+PT EKL+VFDAAMRYK++G  TI+LA
Sbjct  795  RRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTNEKLFVFDAAMRYKADGHHTIVLA  854

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GEDADSLGLT
Sbjct  855  GEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLT  914

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+N++EI+PGQDV V +D GK+FTC +R DT VELAYF+HGGIL YV+R L
Sbjct  915  GHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYVLRNL  974

Query  244  SKQ  236
             +Q
Sbjct  975  VRQ  977



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   317 bits (811),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VN+LL+GEVGPKT+H+PT EKL+VFDAAMRYK++G  TI+LA
Sbjct  797  RRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTNEKLFVFDAAMRYKADGHHTIVLA  856

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GEDADSLGLT
Sbjct  857  GEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLT  916

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+I LP+N++EI+PGQDV V +D GK+FTC +R DT VELAYF+HGGIL YV+R L
Sbjct  917  GHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYVLRNL  976

Query  244  SKQ  236
             +Q
Sbjct  977  VRQ  979



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   315 bits (807),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKT+HIP+GEKL VFDAA +Y+ EG DTIILA
Sbjct  724  RRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHIPSGEKLSVFDAAKKYQDEGHDTIILA  783

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP L GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLT
Sbjct  784  GAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLT  843

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G+ER++ID+PS+I +I+PGQDV VKTD GK+FTCT+RFDT+VEL YF +GGIL YVIRQL
Sbjct  844  GYERFTIDIPSDIKDIKPGQDVVVKTDKGKSFTCTLRFDTQVELTYFENGGILHYVIRQL  903



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKT+HIP+GEKL VFDAA +Y+ EG DTIILA
Sbjct  724  RRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHIPSGEKLSVFDAAKKYQDEGHDTIILA  783

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP L GVKAVIAKSFERIHRSNLVGMGI+PLCFK+GEDA+SLGLT
Sbjct  784  GAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLT  843

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G+ER++ID+PS+I +I+PGQDV VKTD GK+FTCT+RFDT+VEL YF +GGIL YVIRQL
Sbjct  844  GYERFTIDIPSDIKDIKPGQDVLVKTDKGKSFTCTLRFDTQVELTYFENGGILHYVIRQL  903



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   313 bits (802),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIR+VNKLL GEVGPKT+HIPTG+KL+V+DAAMRYK+ G+DTIILA
Sbjct  787  RRGNDEVMARGTFANIRIVNKLLQGEVGPKTIHIPTGDKLHVYDAAMRYKTAGQDTIILA  846

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDAD+LGL+
Sbjct  847  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLS  906

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELA  290
            GHERYSIDLPS I+EIRPGQDVTV TD GK+FTCTVRFDTEVELA
Sbjct  907  GHERYSIDLPSKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELA  951



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = -1

Query  748  FANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDW  569
            FANIR+VNKLL GEVGPKT+HIP+ EKL VFDAAMRYKSEG+DTIILAGAEYG GSSRDW
Sbjct  592  FANIRIVNKLLKGEVGPKTIHIPSREKLSVFDAAMRYKSEGQDTIILAGAEYGIGSSRDW  651

Query  568  AAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSN  389
            AAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDADSLGLTGHER++IDLPSN
Sbjct  652  AAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSN  711

Query  388  INEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            + EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  712  VGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  759



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGN+E++ RG FAN+R+VNKLL+GE GP T+H+PTGEKLYV+DAAM+YKSEG D +I+A
Sbjct  381  RRGNNEVVMRGAFANMRIVNKLLNGEAGPWTIHVPTGEKLYVYDAAMKYKSEGHDMVIIA  440

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYGSGSSRD AAKGPMLLGVK+VIAKSFERIHRSNLVGMGI+PLCF+AGEDADSLGLT
Sbjct  441  GSEYGSGSSRDSAAKGPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADSLGLT  500

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G ERY+I LP++  EI PGQDVTV T +G++FTCT+R DT++E+ YFNHGGILPY++R L
Sbjct  501  GRERYTIHLPTSTAEISPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNL  560

Query  244  SKQ  236
            + Q
Sbjct  561  AAQ  563



>ref|XP_006830449.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
 gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
Length=854

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+MARGTFANIRLVNKLL GEVGPKT+H+PTGE+LYVFDAAMRYK +G DTI+LA
Sbjct  694  RRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHVPTGEELYVFDAAMRYKEDGHDTIVLA  753

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKAGEDAD+LGLT
Sbjct  754  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLT  813

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTE  302
            GHERY+I+LPSNI+EIRPGQD++V TD+GK+FTCT RFDTE
Sbjct  814  GHERYTINLPSNISEIRPGQDISVVTDSGKSFTCTARFDTE  854



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   307 bits (786),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  763  MARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSG  584
            + R  FANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DTIILAGAEYGSG
Sbjct  744  LWREHFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDTIILAGAEYGSG  803

Query  583  SSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSI  404
            SSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I
Sbjct  804  SSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTI  863

Query  403  DLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLSKQ  236
            +LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YVIR L KQ
Sbjct  864  ELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  919



>tpg|DAA43248.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=664

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DTIILA
Sbjct  503  RRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDTIILA  562

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLC+KAGEDAD+LGLT
Sbjct  563  GAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLT  622

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEV  299
            GHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEV
Sbjct  623  GHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEV  664



>ref|XP_001780674.1| predicted protein [Physcomitrella patens]
 gb|EDQ54560.1| predicted protein [Physcomitrella patens]
Length=867

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+ E+L++FDAA +YK EG DTIILA
Sbjct  685  RRGNDEIMARGTFANIRIVNKFLGGEVGPKTIHVPSKERLFIFDAAKKYKDEGHDTIILA  744

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GAEYGSGSSRDWAAKGP L GVKAVI+KSFERIHRSNLVGMG++PLCFK G+DADSLGLT
Sbjct  745  GAEYGSGSSRDWAAKGPYLQGVKAVISKSFERIHRSNLVGMGLIPLCFKQGQDADSLGLT  804

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            G+ERY+I++P+++ +I+PG DV V TD+GK+F CT+RFDT+VEL Y+ HGGIL YV+RQL
Sbjct  805  GYERYTIEMPTDMKQIKPGMDVNVTTDDGKSFKCTLRFDTQVELTYYMHGGILHYVLRQL  864

Query  244  SKQ  236
            + +
Sbjct  865  AAK  867



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   305 bits (781),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGN E+M RGTFAN+R+VNKLL GEVGP+T+HIP+GEK++VFDAAMRYK+EG+DTI+LA
Sbjct  717  RRGNYEVMVRGTFANVRIVNKLLEGEVGPRTIHIPSGEKMHVFDAAMRYKNEGQDTIVLA  776

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYG GSSRD AAKGPML+GV+AVIAKSFE+IHRSNLVGMGI+PLCFK GEDA++LGL 
Sbjct  777  GSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRSNLVGMGIIPLCFKPGEDAETLGLN  836

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ ++E++P QDV V TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  837  GHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTLRFDTEVELAYFDHGGILQYVIRTL  896



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   305 bits (780),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGN E+M RGTFAN+R+VNKLL GEVGP+T+HIP+GEK++VFDAAMRYK+EG+DTI+LA
Sbjct  744  RRGNYEVMVRGTFANVRIVNKLLEGEVGPRTIHIPSGEKMHVFDAAMRYKNEGQDTIVLA  803

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            G+EYG GSSRD AAKGPML+GV+AVIAKSFE+IHRSNLVGMGI+PLCFK GEDA++LGL 
Sbjct  804  GSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRSNLVGMGIIPLCFKPGEDAETLGLN  863

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GHERY+IDLP+ ++E++P QDV V TDNGK+F CT+RFDTEVELAYF+HGGIL YVIR L
Sbjct  864  GHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTLRFDTEVELAYFDHGGILQYVIRTL  923



>ref|XP_009361096.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase, cytoplasmic 
[Pyrus x bretschneideri]
Length=634

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  784  RRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILA  605
            RRGNDE+M RGTFANIR+VNK L GEVGPKT+HIPTGEKL+V+DAAM+YK+  + TI+ A
Sbjct  453  RRGNDEVMTRGTFANIRIVNKFLIGEVGPKTIHIPTGEKLHVYDAAMKYKAAEQSTIVSA  512

Query  604  GAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLT  425
            GA+YGSGS+RDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PL FK GEDAD+LGLT
Sbjct  513  GADYGSGSARDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLSFKPGEDADTLGLT  572

Query  424  GHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  245
            GH+R +I+LP +I+EI+PGQDV V TDN K+FT T+ FDT+VELAYF+HGGILPYVIR +
Sbjct  573  GHKRCTIELPRDISEIKPGQDVKVTTDNAKSFTRTLCFDTKVELAYFDHGGILPYVIRNM  632

Query  244  SK  239
             K
Sbjct  633  IK  634



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150