BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015M22

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS61269.1|  hypothetical protein M569_13528                         135   1e-35   Genlisea aurea
ref|XP_009598681.1|  PREDICTED: uncharacterized protein At1g04910       138   2e-34   
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910       139   3e-34   Vitis vinifera
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...    138   5e-34   Nicotiana sylvestris
ref|XP_007045152.1|  O-fucosyltransferase family protein                136   2e-33   Theobroma cacao [chocolate]
emb|CDP00784.1|  unnamed protein product                                135   6e-33   Coffea canephora [robusta coffee]
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...    135   6e-33   Solanum tuberosum [potatoes]
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...    134   2e-32   Cicer arietinum [garbanzo]
gb|KEH30846.1|  O-fucosyltransferase family protein                     133   3e-32   Medicago truncatula
ref|XP_010093364.1|  hypothetical protein L484_022926                   133   3e-32   Morus notabilis
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       133   4e-32   Eucalyptus grandis [rose gum]
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910       132   5e-32   Solanum lycopersicum
gb|KHN08072.1|  DUF246 domain-containing protein                        132   5e-32   Glycine soja [wild soybean]
ref|XP_008389203.1|  PREDICTED: uncharacterized protein At1g04910...    128   5e-32   
gb|KJB30799.1|  hypothetical protein B456_005G161000                    132   5e-32   Gossypium raimondii
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910       132   7e-32   Fragaria vesca subsp. vesca
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    132   8e-32   Glycine max [soybeans]
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910       131   2e-31   Populus euphratica
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g             131   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002526030.1|  conserved hypothetical protein                     131   2e-31   Ricinus communis
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g             130   2e-31   Phaseolus vulgaris [French bean]
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    130   5e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...    129   6e-31   Nelumbo nucifera [Indian lotus]
gb|KJB15424.1|  hypothetical protein B456_002G178200                    129   6e-31   Gossypium raimondii
gb|KJB15425.1|  hypothetical protein B456_002G178200                    129   6e-31   Gossypium raimondii
gb|KHG19963.1|  hypothetical protein F383_04918                         129   6e-31   Gossypium arboreum [tree cotton]
gb|KHG09805.1|  hypothetical protein F383_15167                         129   7e-31   Gossypium arboreum [tree cotton]
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...    129   7e-31   Camelina sativa [gold-of-pleasure]
gb|KHN43011.1|  DUF246 domain-containing protein                        128   7e-31   Glycine soja [wild soybean]
ref|XP_010502128.1|  PREDICTED: uncharacterized protein At1g04910...    129   8e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...    129   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg             129   9e-31   Eutrema salsugineum [saltwater cress]
gb|KDP38063.1|  hypothetical protein JCGZ_04706                         128   1e-30   Jatropha curcas
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...    128   2e-30   Pyrus x bretschneideri [bai li]
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                    128   2e-30   Arabis alpina [alpine rockcress]
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...    128   2e-30   Glycine max [soybeans]
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...    128   2e-30   Malus domestica [apple tree]
ref|XP_002875074.1|  hypothetical protein ARALYDRAFT_484066             127   3e-30   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg             127   3e-30   Prunus persica
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    127   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...    127   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910       127   3e-30   Prunus mume [ume]
ref|XP_006290827.1|  hypothetical protein CARUB_v10016938mg             127   4e-30   Capsella rubella
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...    126   7e-30   Cucumis melo [Oriental melon]
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    125   1e-29   Cicer arietinum [garbanzo]
ref|NP_178257.1|  O-fucosyltransferase family protein                   125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...    125   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    125   1e-29   Cicer arietinum [garbanzo]
ref|XP_009101345.1|  PREDICTED: uncharacterized protein At1g04910...    125   3e-29   Brassica rapa
ref|XP_009101344.1|  PREDICTED: uncharacterized protein At1g04910...    125   3e-29   Brassica rapa
emb|CDY65925.1|  BnaC07g48790D                                          125   3e-29   Brassica napus [oilseed rape]
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...    124   4e-29   
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...    124   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg                124   4e-29   Erythranthe guttata [common monkey flower]
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910       124   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...    124   5e-29   Populus euphratica
ref|XP_004235088.1|  PREDICTED: uncharacterized protein At1g04910...    124   6e-29   Solanum lycopersicum
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...    124   6e-29   Tarenaya hassleriana [spider flower]
gb|KJB50369.1|  hypothetical protein B456_008G166900                    123   9e-29   Gossypium raimondii
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...    123   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_009129233.1|  PREDICTED: uncharacterized protein At1g04910...    123   1e-28   Brassica rapa
emb|CDY52384.1|  BnaCnng22220D                                          123   1e-28   Brassica napus [oilseed rape]
tpg|DAA59674.1|  TPA: hypothetical protein ZEAMMB73_298098              116   4e-28   
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...    121   4e-28   Solanum tuberosum [potatoes]
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...    121   4e-28   Citrus sinensis [apfelsine]
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...    122   4e-28   Zea mays [maize]
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                   121   4e-28   Citrus sinensis [apfelsine]
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg             121   4e-28   Citrus clementina [clementine]
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g             121   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...    122   5e-28   Zea mays [maize]
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...    121   5e-28   Solanum tuberosum [potatoes]
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                    121   5e-28   Arabis alpina [alpine rockcress]
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...    121   6e-28   
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...    121   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...    121   6e-28   
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                    120   1e-27   
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...    120   1e-27   Zea mays [maize]
ref|NP_001183075.1|  hypothetical protein                               116   2e-27   Zea mays [maize]
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg             119   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...    119   3e-27   
emb|CAN77011.1|  hypothetical protein VITISV_036881                     119   3e-27   Vitis vinifera
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg             119   3e-27   Capsella rubella
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685             119   3e-27   
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...    119   4e-27   
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...    119   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_008655749.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-27   
ref|XP_008645342.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-27   Zea mays [maize]
gb|AAF79229.1|AC006917_14  F10B6.36                                     117   6e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD81763.1|  putative auxin-independent growth promoter             116   7e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-26   
ref|NP_001044765.1|  Os01g0841200                                       116   1e-26   
gb|EEE55649.1|  hypothetical protein OsJ_04031                          116   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560          117   2e-26   Amborella trichopoda
gb|EEC71770.1|  hypothetical protein OsI_04380                          116   2e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_172950.1|  O-fucosyltransferase family protein                   117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...    117   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...    117   2e-26   Sesamum indicum [beniseed]
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...    117   2e-26   Elaeis guineensis
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...    115   2e-26   
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...    117   2e-26   
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...    116   4e-26   Elaeis guineensis
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                    115   5e-26   
gb|AFW80351.1|  hypothetical protein ZEAMMB73_842533                    114   6e-26   
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450          115   8e-26   Sorghum bicolor [broomcorn]
emb|CDY33727.1|  BnaA09g45330D                                          115   9e-26   Brassica napus [oilseed rape]
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-25   
emb|CDX81687.1|  BnaC08g39140D                                          115   1e-25   
ref|XP_009117860.1|  PREDICTED: uncharacterized protein At1g04910...    115   1e-25   Brassica rapa
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910       115   1e-25   Brassica rapa
emb|CDY36519.1|  BnaA06g09720D                                          114   1e-25   Brassica napus [oilseed rape]
gb|AES59903.2|  O-fucosyltransferase family protein                     113   6e-25   Medicago truncatula
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                  113   7e-25   
ref|XP_008674839.1|  PREDICTED: uncharacterized protein At1g04910...    111   1e-24   Zea mays [maize]
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...    112   2e-24   
gb|EMT14891.1|  hypothetical protein F775_28466                         107   2e-23   
dbj|BAJ88036.1|  predicted protein                                      108   3e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    4e-20   Pyrus x bretschneideri [bai li]
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910     96.3    2e-19   
ref|XP_010104478.1|  hypothetical protein L484_025447                 94.4    2e-19   
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...  95.5    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...  95.9    6e-19   Nelumbo nucifera [Indian lotus]
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910     95.1    1e-18   Fragaria vesca subsp. vesca
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    1e-18   Eucalyptus grandis [rose gum]
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...  94.4    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...  93.6    2e-18   
emb|CDP10650.1|  unnamed protein product                              94.0    3e-18   Coffea canephora [robusta coffee]
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg           93.6    3e-18   
gb|KHN47089.1|  DUF246 domain-containing protein                      93.6    4e-18   Glycine soja [wild soybean]
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...  93.6    4e-18   Glycine max [soybeans]
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g           93.2    4e-18   Phaseolus vulgaris [French bean]
emb|CBI18521.3|  unnamed protein product                              92.8    5e-18   Vitis vinifera
gb|EMT10519.1|  hypothetical protein F775_32922                       88.2    7e-18   
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg           91.7    7e-18   Citrus clementina [clementine]
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...  91.7    7e-18   Citrus sinensis [apfelsine]
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910     92.8    7e-18   Vitis vinifera
gb|KJB28879.1|  hypothetical protein B456_005G074200                  92.4    8e-18   Gossypium raimondii
gb|KJB28877.1|  hypothetical protein B456_005G074200                  92.4    8e-18   Gossypium raimondii
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg           92.4    1e-17   
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...  92.0    1e-17   
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg           92.0    1e-17   
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...  92.0    1e-17   Solanum lycopersicum
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...  92.0    1e-17   Solanum lycopersicum
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...  92.0    1e-17   Solanum tuberosum [potatoes]
gb|KHG28222.1|  hypothetical protein F383_11890                       91.3    1e-17   Gossypium arboreum [tree cotton]
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190        91.3    1e-17   
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    92.0    1e-17   
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910     92.0    1e-17   Nicotiana sylvestris
gb|AFK46212.1|  unknown                                               89.7    1e-17   Medicago truncatula
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           91.7    2e-17   
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     91.7    2e-17   Populus euphratica
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...  91.3    2e-17   Glycine max [soybeans]
ref|XP_003598018.1|  DUF246 domain-containing protein                 91.7    2e-17   
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...  91.3    2e-17   Glycine max [soybeans]
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...  90.5    4e-17   Cicer arietinum [garbanzo]
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910     90.1    6e-17   Nicotiana tomentosiformis
gb|KDP34835.1|  hypothetical protein JCGZ_11197                       90.1    6e-17   Jatropha curcas
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     89.7    7e-17   Cucumis melo [Oriental melon]
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  89.7    8e-17   Tarenaya hassleriana [spider flower]
ref|XP_008219032.1|  PREDICTED: uncharacterized protein At1g04910     88.6    1e-16   Prunus mume [ume]
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...  88.6    2e-16   Cucumis sativus [cucumbers]
ref|XP_002533585.1|  conserved hypothetical protein                   88.6    2e-16   Ricinus communis
gb|EMT33054.1|  hypothetical protein F775_09106                       87.8    2e-16   
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                     87.4    2e-16   Triticum urartu
gb|EMT24938.1|  hypothetical protein F775_20364                       86.7    4e-16   
ref|NP_001066285.2|  Os12g0174100                                     86.7    6e-16   
gb|EEE52851.1|  hypothetical protein OsJ_35390                        86.7    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132122.1|  uncharacterized protein LOC100193539             84.3    8e-16   
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...  86.3    9e-16   Brachypodium distachyon [annual false brome]
ref|XP_008669808.1|  PREDICTED: uncharacterized protein At1g04910...  85.9    1e-15   Zea mays [maize]
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...  85.9    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910     85.9    1e-15   Sesamum indicum [beniseed]
gb|EEC68940.1|  hypothetical protein OsI_37646                        85.9    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008669806.1|  PREDICTED: uncharacterized protein At1g04910...  85.1    2e-15   Zea mays [maize]
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...  85.1    2e-15   Zea mays [maize]
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...  84.3    3e-15   
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg              84.7    3e-15   Erythranthe guttata [common monkey flower]
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                  84.3    4e-15   
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg           84.3    5e-15   Eutrema salsugineum [saltwater cress]
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...  84.3    5e-15   Zea mays [maize]
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...  84.0    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...  84.0    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...  83.2    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...  82.8    1e-14   
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...  82.8    1e-14   
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890        82.8    1e-14   
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg           82.8    1e-14   Capsella rubella
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                  82.4    2e-14   Arabis alpina [alpine rockcress]
gb|EEE51747.1|  hypothetical protein OsJ_33163                        82.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67779.1|  hypothetical protein OsI_35317                        82.4    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650        82.0    2e-14   
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...  82.4    2e-14   Tarenaya hassleriana [spider flower]
gb|AAK93632.1|  putative growth regulator protein                     82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                   82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...  82.0    2e-14   
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           82.0    3e-14   
emb|CDY66921.1|  BnaAnng23210D                                        82.0    3e-14   Brassica napus [oilseed rape]
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910     81.6    3e-14   Brassica rapa
gb|AAF79365.1|AC007887_24  F15O4.45                                   82.0    3e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03127.1|  BnaC06g08460D                                        80.5    7e-14   
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...  80.9    7e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...  80.9    7e-14   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ97328.1|  predicted protein                                    80.5    8e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS68582.1|  hypothetical protein M569_06186                       75.5    9e-14   Genlisea aurea
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...  79.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...  79.3    2e-13   Phoenix dactylifera
ref|XP_002984324.1|  hypothetical protein SELMODRAFT_268854           77.0    1e-12   
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  76.6    2e-12   
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812           77.0    2e-12   
emb|CDY39592.1|  BnaC05g11210D                                        75.5    3e-12   Brassica napus [oilseed rape]
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  75.5    4e-12   Elaeis guineensis
gb|EMT11808.1|  hypothetical protein F775_16126                       73.9    1e-11   
gb|EMS47472.1|  hypothetical protein TRIUR3_14732                     72.8    2e-11   Triticum urartu
ref|XP_001760728.1|  predicted protein                                71.2    1e-10   
ref|XP_006847061.1|  hypothetical protein AMTR_s00017p00201590        70.5    2e-10   Amborella trichopoda
ref|XP_009390143.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH40566.1|  receptor-like kinase                                  69.7    4e-10   Medicago truncatula
ref|XP_010930931.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    4e-10   Elaeis guineensis
ref|XP_003589648.1|  Receptor serine/threonine kinase                 69.3    5e-10   
gb|AES59899.2|  receptor-like kinase                                  69.3    5e-10   Medicago truncatula
gb|KDP32763.1|  hypothetical protein JCGZ_12055                       67.8    1e-09   Jatropha curcas
ref|XP_001753325.1|  predicted protein                                65.9    4e-09   
gb|KHN09000.1|  DUF246 domain-containing protein                      63.9    2e-08   Glycine soja [wild soybean]
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    2e-08   Glycine max [soybeans]
ref|XP_010272863.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    5e-08   Nelumbo nucifera [Indian lotus]
gb|KDO80742.1|  hypothetical protein CISIN_1g047008mg                 61.2    5e-08   Citrus sinensis [apfelsine]
ref|XP_010091349.1|  hypothetical protein L484_020151                 63.2    6e-08   
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    6e-08   
ref|XP_007136337.1|  hypothetical protein PHAVU_009G0371001g          58.2    7e-08   Phaseolus vulgaris [French bean]
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_002513766.1|  conserved hypothetical protein                   62.4    8e-08   Ricinus communis
ref|XP_003614789.1|  Growth regulator-related protein                 62.0    9e-08   Medicago truncatula
ref|XP_006434133.1|  hypothetical protein CICLE_v10000652mg           62.0    9e-08   Citrus clementina [clementine]
ref|XP_006434132.1|  hypothetical protein CICLE_v10000652mg           62.0    1e-07   Citrus clementina [clementine]
ref|XP_006472723.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    1e-07   Citrus sinensis [apfelsine]
gb|KHN26036.1|  DUF246 domain-containing protein                      61.6    1e-07   Glycine soja [wild soybean]
ref|XP_006472724.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Citrus sinensis [apfelsine]
ref|XP_010274355.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_007141089.1|  hypothetical protein PHAVU_008G166600g           61.6    1e-07   Phaseolus vulgaris [French bean]
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Glycine max [soybeans]
emb|CBI19065.3|  unnamed protein product                              61.2    2e-07   Vitis vinifera
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   Vitis vinifera
ref|XP_010664246.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   Vitis vinifera
ref|XP_003602912.1|  PsRT17-1 like protein                            61.2    2e-07   Medicago truncatula
gb|KJB59186.1|  hypothetical protein B456_009G243300                  60.8    2e-07   Gossypium raimondii
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   Glycine max [soybeans]
gb|KHN08263.1|  DUF246 domain-containing protein                      60.8    2e-07   Glycine soja [wild soybean]
gb|KJB59188.1|  hypothetical protein B456_009G243300                  60.5    3e-07   Gossypium raimondii
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    3e-07   Cicer arietinum [garbanzo]
gb|KJB59187.1|  hypothetical protein B456_009G243300                  60.5    3e-07   Gossypium raimondii
ref|XP_001753764.1|  predicted protein                                60.1    4e-07   
ref|XP_002533683.1|  conserved hypothetical protein                   60.1    5e-07   Ricinus communis
ref|XP_007018985.1|  O-fucosyltransferase family protein isoform 2    59.7    7e-07   Theobroma cacao [chocolate]
ref|XP_009366982.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    7e-07   Pyrus x bretschneideri [bai li]
gb|KDP29763.1|  hypothetical protein JCGZ_18698                       58.9    1e-06   Jatropha curcas
gb|KHG27420.1|  hypothetical protein F383_15612                       58.2    2e-06   Gossypium arboreum [tree cotton]
ref|XP_008338786.1|  PREDICTED: uncharacterized protein At1g04910     58.2    2e-06   
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910     58.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_007221795.1|  hypothetical protein PRUPE_ppa003430mg           57.8    2e-06   
gb|AGV54860.1|  O-fucosyltransferase family protein                   57.8    2e-06   Phaseolus vulgaris [French bean]
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g           57.4    4e-06   
ref|XP_008233904.1|  PREDICTED: uncharacterized protein At1g04910     57.0    4e-06   Prunus mume [ume]
ref|XP_004142690.1|  PREDICTED: DUF246 domain-containing protein ...  57.0    4e-06   Cucumis sativus [cucumbers]
gb|KJB44061.1|  hypothetical protein B456_007G232700                  57.0    5e-06   Gossypium raimondii
ref|XP_009775860.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   Nicotiana sylvestris
ref|XP_009599287.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   Nicotiana tomentosiformis
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   Nicotiana sylvestris
ref|XP_011027600.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    6e-06   Populus euphratica
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    6e-06   Cucumis melo [Oriental melon]
ref|XP_011027599.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    6e-06   Populus euphratica
ref|XP_004292679.1|  PREDICTED: uncharacterized protein At1g04910     56.6    6e-06   Fragaria vesca subsp. vesca
gb|KJB44059.1|  hypothetical protein B456_007G232700                  56.6    7e-06   Gossypium raimondii
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg           56.2    8e-06   
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg           56.2    9e-06   
ref|XP_001777077.1|  predicted protein                                56.2    9e-06   
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                   55.8    1e-05   
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                   55.8    1e-05   
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910     55.8    1e-05   
ref|XP_002307421.1|  hypothetical protein POPTR_0005s16060g           55.8    1e-05   
gb|KHG05570.1|  hypothetical protein F383_31127                       55.8    1e-05   
emb|CDP12443.1|  unnamed protein product                              55.8    1e-05   
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910     55.5    1e-05   
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g           55.5    1e-05   
gb|KJB18178.1|  hypothetical protein B456_003G038000                  55.5    1e-05   
gb|KJB18177.1|  hypothetical protein B456_003G038000                  55.5    1e-05   
ref|XP_006351922.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    1e-05   
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338            55.5    2e-05   
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910     55.5    2e-05   
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...  55.5    2e-05   
gb|KJB18182.1|  hypothetical protein B456_003G038000                  55.1    2e-05   
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    2e-05   
gb|KJB18179.1|  hypothetical protein B456_003G038000                  55.1    2e-05   
ref|XP_010691586.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    2e-05   
ref|XP_004250340.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    2e-05   
ref|XP_010500091.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    3e-05   
ref|XP_010500090.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    3e-05   
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093            54.7    3e-05   
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    3e-05   
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    3e-05   
ref|XP_010113429.1|  hypothetical protein L484_026763                 54.7    3e-05   
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1    54.3    3e-05   
ref|XP_002514041.1|  conserved hypothetical protein                   54.3    3e-05   
ref|XP_010063352.1|  PREDICTED: uncharacterized protein At1g04910...  54.3    4e-05   
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    4e-05   
gb|EPS73888.1|  hypothetical protein M569_00867                       53.9    4e-05   
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    4e-05   
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    5e-05   
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910     53.9    5e-05   
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    5e-05   
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    5e-05   
gb|KJB58883.1|  hypothetical protein B456_009G229500                  53.5    6e-05   
gb|KJB58881.1|  hypothetical protein B456_009G229500                  53.5    7e-05   
gb|AAK84479.1|  putative auxin growth promotor protein                53.5    7e-05   
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    7e-05   
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg           53.5    7e-05   
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    7e-05   
emb|CAN78778.1|  hypothetical protein VITISV_029752                   53.5    7e-05   
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    7e-05   
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    7e-05   
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    7e-05   
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    7e-05   
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    8e-05   
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...  53.5    8e-05   
ref|XP_011097784.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    8e-05   
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910     53.1    9e-05   
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg              53.1    9e-05   
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    9e-05   
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg           53.1    9e-05   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg           53.1    9e-05   
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910     53.1    9e-05   
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    1e-04   
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    1e-04   
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    1e-04   
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                 53.1    1e-04   
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg           53.1    1e-04   
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg           53.1    1e-04   
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    1e-04   
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    1e-04   
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...  53.1    1e-04   
emb|CDX73383.1|  BnaC05g27230D                                        53.1    1e-04   
emb|CDY33958.1|  BnaC02g43790D                                        53.1    1e-04   
ref|XP_007018221.1|  O-fucosyltransferase family protein              53.1    1e-04   
ref|XP_009145111.1|  PREDICTED: uncharacterized protein At1g04910     53.1    1e-04   
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780           52.8    1e-04   
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910     52.8    1e-04   
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg           52.8    1e-04   
gb|AAM13166.1|  unknown protein                                       52.8    1e-04   
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
emb|CDY14569.1|  BnaC03g48900D                                        52.8    1e-04   
ref|NP_201350.2|  O-fucosyltransferase family protein                 52.8    1e-04   
dbj|BAB11569.1|  unnamed protein product                              52.8    1e-04   
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...  52.8    1e-04   
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g           52.8    1e-04   
ref|XP_006396013.1|  hypothetical protein EUTSA_v10003892mg           52.8    1e-04   
ref|XP_010461370.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_010478972.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_010478971.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_010478969.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_010461371.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
ref|XP_010461373.1|  PREDICTED: uncharacterized protein At1g04910...  52.8    1e-04   
dbj|BAE71212.1|  hypothetical protein                                 52.4    1e-04   
gb|AGV54211.1|  O-fucosyltransferase family protein                   52.4    2e-04   
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    2e-04   
emb|CDY37829.1|  BnaAnng04900D                                        52.4    2e-04   
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    2e-04   
ref|XP_009341670.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    2e-04   
gb|KFK32890.1|  hypothetical protein AALP_AA6G300900                  52.4    2e-04   
ref|XP_003613050.1|  DUF246 domain-containing protein                 51.6    2e-04   
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...  52.0    2e-04   
gb|EYU22927.1|  hypothetical protein MIMGU_mgv1a018388mg              52.0    2e-04   
ref|XP_007018984.1|  O-fucosyltransferase family protein isoform 1    52.0    2e-04   
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910     52.0    2e-04   
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...  52.0    2e-04   
ref|XP_003613049.1|  DUF246 domain-containing protein                 51.6    3e-04   
ref|NP_849755.1|  O-fucosyltransferase-like protein                   51.6    3e-04   
gb|AFK40388.1|  unknown                                               51.6    3e-04   
emb|CAA23010.1|  PsRT17-1 like protein                                51.6    3e-04   
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...  51.6    3e-04   
gb|ABJ96379.1|  expressed protein                                     51.6    3e-04   
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg           51.6    3e-04   
ref|XP_009367298.1|  PREDICTED: uncharacterized protein At1g04910...  51.6    3e-04   
emb|CDP01562.1|  unnamed protein product                              51.2    4e-04   
ref|XP_006306299.1|  hypothetical protein CARUB_v10012165mg           51.6    4e-04   
ref|NP_683362.1|  O-fucosyltransferase-like protein                   51.6    4e-04   
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...  51.2    4e-04   
gb|KGN62755.1|  hypothetical protein Csa_2G370540                     51.6    4e-04   
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...  51.2    4e-04   
ref|XP_002893927.1|  hypothetical protein ARALYDRAFT_473732           51.2    4e-04   
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                     51.2    4e-04   
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...  51.2    4e-04   
ref|NP_194184.2|  O-fucosyltransferase family protein                 51.2    4e-04   
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910     51.2    4e-04   
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...  50.8    5e-04   
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...  50.8    5e-04   
gb|KHN14510.1|  DUF246 domain-containing protein                      50.8    5e-04   
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...  50.8    5e-04   
ref|XP_008365206.1|  PREDICTED: uncharacterized protein At1g04910...  50.8    5e-04   
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...  50.8    5e-04   
gb|EMT16885.1|  hypothetical protein F775_06176                       50.8    6e-04   
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    7e-04   
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    7e-04   
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    7e-04   
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg              50.4    7e-04   
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg              50.4    7e-04   
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    8e-04   
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    8e-04   
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    8e-04   
gb|KJB48896.1|  hypothetical protein B456_008G092600                  50.1    0.001   
gb|KDP41479.1|  hypothetical protein JCGZ_15886                       50.1    0.001   
ref|XP_002867661.1|  predicted protein                                50.1    0.001   
dbj|BAK06980.1|  predicted protein                                    50.1    0.001   



>gb|EPS61269.1| hypothetical protein M569_13528, partial [Genlisea aurea]
Length=174

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLA++FDNPNIGWKSFKRQMLNMR+HSDSKGIELKRPNDSIYS PCPDCMCR
Sbjct  102  RTIRPDKRKLAVIFDNPNIGWKSFKRQMLNMRSHSDSKGIELKRPNDSIYSVPCPDCMCR  161

Query  561  LNKTKDSKLS  532
            +N T+DSK S
Sbjct  162  VNGTEDSKSS  171



>ref|XP_009598681.1| PREDICTED: uncharacterized protein At1g04910, partial [Nicotiana 
tomentosiformis]
Length=419

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNPNIGWKSFKRQMLN+RAHSDSKGIE+KRPNDSIYSFPCPDCMCR
Sbjct  347  RTIRPDKRKLALLYDNPNIGWKSFKRQMLNIRAHSDSKGIEIKRPNDSIYSFPCPDCMCR  406

Query  561  LNKTKDSKLSPGT  523
             NKT+DS+ S  T
Sbjct  407  SNKTEDSRSSSVT  419



>ref|XP_002284457.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI26895.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T+RPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSD+KG ELKRPNDSIY+FPCPDCMCR
Sbjct  489  KTVRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDAKGFELKRPNDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
            +NK++DS+ S  T
Sbjct  549  MNKSEDSRSSSAT  561



>ref|XP_009785418.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009785419.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNPNIGWKSFKRQMLN+RAHSDSKGIE+KRPNDSIYSFPCPDCMCR
Sbjct  502  RTIRPDKRKLALLYDNPNIGWKSFKRQMLNIRAHSDSKGIEIKRPNDSIYSFPCPDCMCR  561

Query  561  LNKTKDSKLSPGT  523
             NKT+DS+ S  T
Sbjct  562  SNKTEDSRSSSVT  574



>ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=561

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWKSFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NK++DS+ S  T
Sbjct  549  TNKSEDSRSSSAT  561



>emb|CDP00784.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RT++PDKRKLA++FDNPNIGW+SFKRQML+MRAHSDSKGIELKRPNDS YSFPCPDCMCR
Sbjct  489  RTVKPDKRKLAVIFDNPNIGWRSFKRQMLSMRAHSDSKGIELKRPNDSPYSFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             N+T+DSKLS  T
Sbjct  549  QNRTEDSKLSSVT  561



>ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=578

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNPNIGWKSFKRQML++RAHSDSKGIE+KRPNDSIYSFPCPDCMCR
Sbjct  506  RTIRPDKRKLALLYDNPNIGWKSFKRQMLSIRAHSDSKGIEIKRPNDSIYSFPCPDCMCR  565

Query  561  LNKTKDSKLSPGT  523
             N+T+DS+ S  T
Sbjct  566  SNRTEDSRSSSVT  578



>ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=560

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKSFKRQ+++MR+HSDSKG+ELKRPNDSIYSFPCPDCMCR
Sbjct  488  KTIKPDKRKLALLFDNPNIGWKSFKRQLMSMRSHSDSKGVELKRPNDSIYSFPCPDCMCR  547

Query  561  LNKTKDSKLS  532
             NKT DSK S
Sbjct  548  ANKTDDSKSS  557



>gb|KEH30846.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=561

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGW+SFKRQ+LNMR+HSDSKG+ELKRPNDSIYSFPCP+CMCR
Sbjct  489  KTIKPDKRKLALLFDNPNIGWRSFKRQLLNMRSHSDSKGVELKRPNDSIYSFPCPECMCR  548

Query  561  LNKTKDSKLS  532
             N+T DSK S
Sbjct  549  ANRTDDSKSS  558



>ref|XP_010093364.1| hypothetical protein L484_022926 [Morus notabilis]
 gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis]
Length=562

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWKSFKRQML +R+HSD KG ELKRPNDSIY+FPCPDCMCR
Sbjct  490  KTIRPDKRKLALLFDNPNIGWKSFKRQMLGIRSHSDLKGFELKRPNDSIYTFPCPDCMCR  549

Query  561  LNKTKDSKLS  532
            +NKT+DSK S
Sbjct  550  INKTEDSKPS  559



>ref|XP_010066619.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW64583.1| hypothetical protein EUGRSUZ_G02181 [Eucalyptus grandis]
Length=564

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLAL+FDNPN+GWK+FKRQMLNMR+HSDSKG ELKRPNDSIYSFPCPDCMC 
Sbjct  492  KTIRPDKRKLALIFDNPNLGWKNFKRQMLNMRSHSDSKGFELKRPNDSIYSFPCPDCMCH  551

Query  561  LNKTKDSKLSPGT  523
             NKT+DS+ S  T
Sbjct  552  RNKTEDSRSSSAT  564



>ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
 ref|XP_010320701.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=581

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNPNIGWKSFKRQM ++RAHSDSKGIE+KRPNDSIY+FPCPDCMCR
Sbjct  509  RTIRPDKRKLALLYDNPNIGWKSFKRQMHSIRAHSDSKGIEIKRPNDSIYTFPCPDCMCR  568

Query  561  LNKTKDSKLSPGT  523
             N+T+DSK S  T
Sbjct  569  SNRTEDSKSSSVT  581



>gb|KHN08072.1| DUF246 domain-containing protein [Glycine soja]
Length=449

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKS KRQ+L+MR+HSDSKG+ELKRPNDSIYSFPCPDCMCR
Sbjct  377  KTIKPDKRKLALLFDNPNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCR  436

Query  561  LNKTKDSKLSPGT  523
             N+T DS+ S  T
Sbjct  437  ANRTDDSRSSSAT  449



>ref|XP_008389203.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=228

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR +L MR+HSDSKG E+KRPNDSIY+FPCPDCMCR
Sbjct  156  KTIRPDKRKLALLFDNPQIGWKTFKRHLLGMRSHSDSKGYEIKRPNDSIYTFPCPDCMCR  215

Query  561  LNKTKDSKLSPGT  523
             NKT+DS+ +  T
Sbjct  216  SNKTEDSRAASAT  228



>gb|KJB30799.1| hypothetical protein B456_005G161000 [Gossypium raimondii]
Length=561

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWKSFKRQMLNMR+HSDSKG ELKRP+DSIY+FPCPDCMC 
Sbjct  489  KTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRSHSDSKGFELKRPSDSIYTFPCPDCMCH  548

Query  561  LNKTKDSKLSPGT  523
             NK+ DS+ S  T
Sbjct  549  TNKSADSRSSSAT  561



>ref|XP_004297377.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=569

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLAL+FDNP IGWK+FKRQ+L+MR+HSDSKG ELKRPNDSIY+FPCPDCMCR
Sbjct  497  KTIRPDKRKLALIFDNPKIGWKTFKRQLLSMRSHSDSKGFELKRPNDSIYTFPCPDCMCR  556

Query  561  LNKTKDSKLSPGT  523
             NK++DSKLS  T
Sbjct  557  TNKSEDSKLSLAT  569



>ref|XP_003556095.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 ref|XP_006605495.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=564

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKS KRQ+L+MR+HSDSKG+ELKRPNDSIYSFPCPDCMCR
Sbjct  492  KTIKPDKRKLALLFDNPNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCR  551

Query  561  LNKTKDSKLSPGT  523
             N+T DS+ S  T
Sbjct  552  ANRTDDSRSSSAT  564



>ref|XP_011038632.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=569

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWKSFKR M+NMR+HSDSKG ELKRPNDS+YS+PCPDCMCR
Sbjct  497  KTIRPDKRKLALLFDNPKIGWKSFKRHMMNMRSHSDSKGFELKRPNDSVYSYPCPDCMCR  556

Query  561  LNKTKDSKLSPGT  523
            +N+T+DS+ S  T
Sbjct  557  VNRTEDSRSSSVT  569



>ref|XP_002315879.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
 gb|EEF02050.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
Length=569

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWKSFKR M+NMR+HSDSKG ELKRPNDS+YS+PCPDCMCR
Sbjct  497  KTIRPDKRKLALLFDNPKIGWKSFKRHMMNMRSHSDSKGFELKRPNDSVYSYPCPDCMCR  556

Query  561  LNKTKDSKLSPGT  523
            +N+T+DS+ S  T
Sbjct  557  VNRTEDSRSSSVT  569



>ref|XP_002526030.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36370.1| conserved hypothetical protein [Ricinus communis]
Length=570

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPN+GWKSFKR MLNMR+HSDSKG ELKRPNDSIYSFPCPDCMCR
Sbjct  500  KTIRPDKRKLALLFDNPNLGWKSFKRHMLNMRSHSDSKGFELKRPNDSIYSFPCPDCMCR  559

Query  561  LNKTKD  544
            +NKT+ 
Sbjct  560  MNKTES  565



>ref|XP_007157752.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
 gb|ESW29746.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
Length=563

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWKS KRQ+L+MR HSDSKG+ELKRPNDSIYSFPCPDCMCR
Sbjct  491  KTIRPDKRKLALLFDNPNIGWKSLKRQLLSMRWHSDSKGVELKRPNDSIYSFPCPDCMCR  550

Query  561  LNKTKDSKLSPGT  523
             N+T DS+ +  T
Sbjct  551  ANRTDDSRSASAT  563



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA +FDNPNIGWK+FKR MLNMR+HSDSKG ELKRPNDSIYSFPCPDCMCR
Sbjct  500  KTIRPDKRKLAQIFDNPNIGWKTFKRHMLNMRSHSDSKGFELKRPNDSIYSFPCPDCMCR  559

Query  561  LNKTKDSKLSPGT  523
            + K +DS+ +  T
Sbjct  560  VGKAEDSRSASAT  572



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWK+FKR +LNMR+HSD+KGIELKRPNDSIY+FPCPDCMCR
Sbjct  486  KTIRPDKRKLALLFDNPNIGWKTFKRHVLNMRSHSDAKGIELKRPNDSIYTFPCPDCMCR  545

Query  561  LNKTKDSKLS  532
            +NK ++ + S
Sbjct  546  VNKLEELRFS  555



>gb|KJB15424.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
 gb|KJB15426.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=561

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKR+LALLFDNPNIGW++FKRQMLNMR+HSD+KG ELKRPNDSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRRLALLFDNPNIGWRTFKRQMLNMRSHSDTKGFELKRPNDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NK++ ++ S  T
Sbjct  549  TNKSEAARSSSAT  561



>gb|KJB15425.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=539

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKR+LALLFDNPNIGW++FKRQMLNMR+HSD+KG ELKRPNDSIY+FPCPDCMCR
Sbjct  467  KTIRPDKRRLALLFDNPNIGWRTFKRQMLNMRSHSDTKGFELKRPNDSIYTFPCPDCMCR  526

Query  561  LNKTKDSKLSPGT  523
             NK++ ++ S  T
Sbjct  527  TNKSEAARSSSAT  539



>gb|KHG19963.1| hypothetical protein F383_04918 [Gossypium arboreum]
Length=561

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWKSFKRQMLNMR+HSDSKG ELK+P DSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRSHSDSKGFELKKPVDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NK+ +S  S  T
Sbjct  549  TNKSANSGSSSAT  561



>gb|KHG09805.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=561

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKR+LALLFDNPNIGW++FKRQMLNMR+HSD+KG ELKRPNDSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRRLALLFDNPNIGWRTFKRQMLNMRSHSDTKGFELKRPNDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NK++ ++ S  T
Sbjct  549  TNKSEAARSSSAT  561



>ref|XP_010513871.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=568

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  494  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  553

Query  561  LNKTK--DSKLSPGT  523
             NKT   DS+ SP T
Sbjct  554  RNKTTSPDSRPSPAT  568



>gb|KHN43011.1| DUF246 domain-containing protein [Glycine soja]
Length=440

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKS KRQ+L+MR+HSDSKG+ELKRPNDSIYSFPCPDCMCR
Sbjct  368  KTIKPDKRKLALLFDNPNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCR  427

Query  561  LNKTKDSKLSPGT  523
             N+T D + S  T
Sbjct  428  SNRTDDLRSSLAT  440



>ref|XP_010502128.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
 ref|XP_010424919.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=568

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  494  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  553

Query  561  LNKTK--DSKLSPGT  523
             NKT   DS+ SP T
Sbjct  554  RNKTTSPDSRPSPAT  568



>ref|XP_009420104.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=571

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKS KRQ+LNMRAHSD+KG+E+KRP+DS+Y+FPCPDCMCR
Sbjct  499  KTIKPDKRKLALLFDNPNIGWKSLKRQLLNMRAHSDAKGMEMKRPSDSLYTFPCPDCMCR  558

Query  561  LNKTKDSKLS  532
            LNKT+ SK S
Sbjct  559  LNKTEVSKSS  568



>ref|XP_006398540.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
 gb|ESQ39993.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
Length=565

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKGIELKRPNDSIY+FPCPDCM R
Sbjct  491  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGIELKRPNDSIYTFPCPDCMSR  550

Query  561  LNKTK--DSKLSPGT  523
             NKT   DS+  P T
Sbjct  551  RNKTTTPDSRPPPAT  565



>gb|KDP38063.1| hypothetical protein JCGZ_04706 [Jatropha curcas]
Length=561

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALL DNPN+GWKSFKR MLNMR+HSDSKG ELKRPNDSIYSFPCPDCMCR
Sbjct  491  KTIRPDKRKLALLLDNPNLGWKSFKRHMLNMRSHSDSKGFELKRPNDSIYSFPCPDCMCR  550

Query  561  LNKTKD  544
            +NKT+ 
Sbjct  551  MNKTES  556



>ref|XP_009339689.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=561

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR +L MR+HSDSKG E+KRPNDSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPQIGWKTFKRHLLGMRSHSDSKGYEIKRPNDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NKT+DS+ +  T
Sbjct  549  SNKTEDSRAASAT  561



>gb|KFK33363.1| hypothetical protein AALP_AA5G004000 [Arabis alpina]
Length=565

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  491  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  550

Query  561  LNKTK--DSKLSPGT  523
             NKT   DSK  P T
Sbjct  551  RNKTTTPDSKPPPAT  565



>ref|XP_003529417.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=564

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKS KRQ+L+MR+HSDSKG+ELKRPNDSIYSFPCPDCMCR
Sbjct  492  KTIKPDKRKLALLFDNPNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCR  551

Query  561  LNKTKDSKLSPGT  523
             N+T D + S  T
Sbjct  552  SNRTDDLRSSLAT  564



>ref|XP_008339538.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=561

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR +L MR+HSDSKG ELKRPNDSIYSFPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPKIGWKTFKRHLLGMRSHSDSKGFELKRPNDSIYSFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NKT+ S+ +  T
Sbjct  549  TNKTEGSRAASAT  561



>ref|XP_002875074.1| hypothetical protein ARALYDRAFT_484066 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51333.1| hypothetical protein ARALYDRAFT_484066 [Arabidopsis lyrata subsp. 
lyrata]
Length=567

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  493  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  552

Query  561  LNKTK--DSKLSPGT  523
             NKT   DS+ SP T
Sbjct  553  RNKTTTPDSRPSPVT  567



>ref|XP_007225729.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
 gb|EMJ26928.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
Length=561

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKRQ+L MR H DSKG ELKRPNDSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPKIGWKTFKRQLLGMRTHGDSKGFELKRPNDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NKT+DS+    T
Sbjct  549  SNKTEDSRALSAT  561



>ref|XP_009351481.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=561

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR +L MR HSDSKG ELKRPNDSIYSFPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPKIGWKTFKRHLLGMRTHSDSKGFELKRPNDSIYSFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NKT+ S+ +  T
Sbjct  549  TNKTEGSRAASAT  561



>ref|XP_009351480.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=574

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR +L MR HSDSKG ELKRPNDSIYSFPCPDCMCR
Sbjct  502  KTIRPDKRKLALLFDNPKIGWKTFKRHLLGMRTHSDSKGFELKRPNDSIYSFPCPDCMCR  561

Query  561  LNKTKDSKLSPGT  523
             NKT+ S+ +  T
Sbjct  562  TNKTEGSRAASAT  574



>ref|XP_008243446.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=540

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKRQ+L MR+H DSKG ELKRPNDSIY+FPCPDCMCR
Sbjct  468  KTIRPDKRKLALLFDNPKIGWKTFKRQLLGMRSHGDSKGFELKRPNDSIYTFPCPDCMCR  527

Query  561  LNKTKDSKLSPGT  523
             NKT+D++    T
Sbjct  528  SNKTEDARALSAT  540



>ref|XP_006290827.1| hypothetical protein CARUB_v10016938mg [Capsella rubella]
 gb|EOA23725.1| hypothetical protein CARUB_v10016938mg [Capsella rubella]
Length=567

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  493  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  552

Query  561  LNK--TKDSKLSPGT  523
             NK  T DS+  P T
Sbjct  553  RNKTTTTDSRPPPAT  567



>ref|XP_008467134.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=563

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR MLNMR+HSDSKG ELKRPNDSIY+FPCPDCMC 
Sbjct  491  KTIRPDKRKLALLFDNPTIGWKNFKRHMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMCF  550

Query  561  LNKTKDSKLS  532
             NK+ D+K S
Sbjct  551  TNKSNDTKSS  560



>ref|XP_004498294.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=519

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+ NIGWKS KRQ+L+MR+HSDSKG+ELKRPNDSIYSFPCPDCMC 
Sbjct  447  KTIKPDKRKLALLFDSTNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCH  506

Query  561  LNKTKDSKLSPGT  523
             N+T DSK S  T
Sbjct  507  ANRTDDSKSSSAT  519



>ref|NP_178257.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAC67324.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AAM13108.1| similar to axi 1 protein [Arabidopsis thaliana]
 gb|AAM91218.1| similar to axi 1 protein [Arabidopsis thaliana]
 dbj|BAE99174.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AEC05459.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=567

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  493  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  552

Query  561  LNKTKDSKLSP  529
             NKT   +  P
Sbjct  553  RNKTTTPESRP  563



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWK+FK  MLNMRA SD+KGIELKRPNDS Y+FPCPDCMCR
Sbjct  491  KTIRPDKRKLALLFDNPNIGWKTFKHNMLNMRAQSDAKGIELKRPNDSTYTFPCPDCMCR  550

Query  561  LNKTKDSKLS  532
            +NK+++ + S
Sbjct  551  MNKSEEVRSS  560



>ref|XP_004498293.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=563

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+ NIGWKS KRQ+L+MR+HSDSKG+ELKRPNDSIYSFPCPDCMC 
Sbjct  491  KTIKPDKRKLALLFDSTNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCH  550

Query  561  LNKTKDSKLSPGT  523
             N+T DSK S  T
Sbjct  551  ANRTDDSKSSSAT  563



>ref|XP_009101345.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
 emb|CDY17669.1| BnaA06g34880D [Brassica napus]
Length=564

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA++FDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  490  KTIRPDKRKLAIIFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  549

Query  561  LNKTKDSKLSP  529
             NKT      P
Sbjct  550  RNKTTTPDTRP  560



>ref|XP_009101344.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=568

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA++FDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  494  KTIRPDKRKLAIIFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  553

Query  561  LNKTKDSKLSP  529
             NKT      P
Sbjct  554  RNKTTTPDTRP  564



>emb|CDY65925.1| BnaC07g48790D [Brassica napus]
Length=564

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA++FDNPNIGW+SFKRQMLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  490  KTIRPDKRKLAIIFDNPNIGWRSFKRQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  549

Query  561  LNKTKDSKLSP  529
             NKT      P
Sbjct  550  RNKTTTPDTRP  560



>ref|XP_004150597.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004164435.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN51494.1| hypothetical protein Csa_5G570390 [Cucumis sativus]
Length=563

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP IGWK+FKR MLNMR+HSDSKG ELKRP+DSIY+FPCPDCMC 
Sbjct  491  KTIRPDKRKLALLFDNPTIGWKNFKRHMLNMRSHSDSKGFELKRPSDSIYTFPCPDCMCF  550

Query  561  LNKTKDSKLS  532
             NK+ D+K S
Sbjct  551  TNKSNDTKSS  560



>ref|XP_009407491.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNIGWKS KRQ+LNMRAHSD+KGIE+KRPNDSIYS+PCPDCMC 
Sbjct  497  KTIKPDKRKLALLFDNPNIGWKSLKRQLLNMRAHSDAKGIEMKRPNDSIYSYPCPDCMCL  556

Query  561  LNKTK  547
             NKT+
Sbjct  557  SNKTE  561



>gb|EYU30069.1| hypothetical protein MIMGU_mgv1a003875mg [Erythranthe guttata]
Length=558

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLA+LFDNPNIGWKSFKRQMLN+RAHSD KGIELKR NDSIYS+PCPDCMC+
Sbjct  488  RTIRPDKRKLAILFDNPNIGWKSFKRQMLNIRAHSDLKGIELKRRNDSIYSYPCPDCMCK  547

Query  561  -LNKTKDSK  538
             +NK++D K
Sbjct  548  VVNKSEDLK  556



>ref|XP_010527785.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=567

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKRQMLNMR HSDSKG ELKRPNDSIY+FPCPDCMCR
Sbjct  491  KTIRPDKRKLAILFDNPNIGWRSFKRQMLNMRCHSDSKGHELKRPNDSIYTFPCPDCMCR  550

Query  561  LNK  553
             N+
Sbjct  551  TNR  553



>ref|XP_011023536.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=569

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDN  I WKSFKR MLNMR+HSDSKG E+KRPNDSIYSFPCPDCMC 
Sbjct  497  KTIRPDKRKLAMLFDNLKIDWKSFKRHMLNMRSHSDSKGFEIKRPNDSIYSFPCPDCMCH  556

Query  561  LNKTKDSKLSPGT  523
            +N+T+DS+ S  T
Sbjct  557  VNRTEDSRSSSAT  569



>ref|XP_004235088.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=552

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNPNIGWKSFKRQMLN+RAHSDSKGIE+KRP+DS+YS PCPDCM R
Sbjct  480  RTIRPDKRKLALLYDNPNIGWKSFKRQMLNVRAHSDSKGIEIKRPSDSLYSVPCPDCMRR  539

Query  561  LNKTKDSKLSPGT  523
             NKT+  K S  T
Sbjct  540  SNKTEVLKSSLAT  552



>ref|XP_010553860.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=566

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP+IGW+SFKRQMLNMR+HSDSKG+ELKRPNDSIY+FPCPDCMCR
Sbjct  493  KTIRPDKRKLAILFDNPSIGWRSFKRQMLNMRSHSDSKGLELKRPNDSIYTFPCPDCMCR  552

Query  561  LNK  553
             N+
Sbjct  553  PNR  555



>gb|KJB50369.1| hypothetical protein B456_008G166900 [Gossypium raimondii]
Length=561

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGWKSFKRQMLNMR+HSDSKG ELK+  DSIY+FPCPDCMCR
Sbjct  489  KTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRSHSDSKGFELKKLVDSIYTFPCPDCMCR  548

Query  561  LNKTKDSKLSPGT  523
             NK+ +   S  T
Sbjct  549  TNKSTNPGSSSAT  561



>ref|XP_003568305.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=570

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFDNP IGWKS KR +LNMR HSD+KG+ELKRPN+SIY+FPCPDCMCR
Sbjct  498  KTIKPDKRRLAILFDNPRIGWKSLKRHLLNMRTHSDAKGVELKRPNESIYTFPCPDCMCR  557

Query  561  LNKTKDSK  538
            LN+T  SK
Sbjct  558  LNRTAHSK  565



>ref|XP_009129233.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
 emb|CDY40371.1| BnaA02g26850D [Brassica napus]
Length=568

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKR MLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  493  KTIRPDKRKLAILFDNPNIGWRSFKRHMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  552

Query  561  LNKTK--DSKLSP  529
             N+T   DSK  P
Sbjct  553  KNRTTTPDSKPPP  565



>emb|CDY52384.1| BnaCnng22220D [Brassica napus]
Length=568

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNPNIGW+SFKR MLNMR+HSDSKG ELKRPNDSIY+FPCPDCM R
Sbjct  493  KTIRPDKRKLAILFDNPNIGWRSFKRHMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSR  552

Query  561  LNKTK--DSKLSP  529
             N+T   DSK  P
Sbjct  553  KNRTTTPDSKPPP  565



>tpg|DAA59674.1| TPA: hypothetical protein ZEAMMB73_298098 [Zea mays]
Length=184

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LF+NP IGW + KR +LNMRAHSD KGIE+KRPN+SIY+F CPDCMCR
Sbjct  112  KTIKPDKRRLAVLFNNPRIGWTALKRHLLNMRAHSDVKGIEMKRPNESIYTFRCPDCMCR  171

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  172  LNRTEHSK  179



>ref|XP_006342312.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=486

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNP IGWKSFKRQMLN+RAHSDSKGIE+KRP+DS+YS PCPDCM R
Sbjct  414  RTIRPDKRKLALLYDNPIIGWKSFKRQMLNVRAHSDSKGIEIKRPSDSVYSVPCPDCMRR  473

Query  561  LNKTKDSKLSPGT  523
             NKT+  K S  T
Sbjct  474  SNKTEVLKSSLAT  486



>ref|XP_006469184.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=558

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGW+SFKRQML+MR+HSDSKG ELKRP+DS Y+FPCPDCMCR
Sbjct  492  KTIRPDKRKLALLFDNPNIGWRSFKRQMLSMRSHSDSKGYELKRPSDSPYTFPCPDCMCR  551

Query  561  LNKT  550
             NK+
Sbjct  552  ANKS  555



>ref|XP_008649712.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=585

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+L DNP IGWK+ KR +LNMRAHSD+KGIE+KRPN+SIY+FPCPDCMCR
Sbjct  513  KTIKPDKRRLAVLLDNPRIGWKALKRHLLNMRAHSDAKGIEMKRPNESIYTFPCPDCMCR  572

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  573  LNRTEHSK  580



>gb|KDO64642.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=558

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGW+SFKRQML+MR+HSDSKG ELKRP+DS Y+FPCPDCMCR
Sbjct  492  KTIRPDKRKLALLFDNPNIGWRSFKRQMLSMRSHSDSKGYELKRPSDSPYTFPCPDCMCR  551

Query  561  LNKT  550
             NK+
Sbjct  552  ANKS  555



>ref|XP_006448248.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
 gb|ESR61488.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
Length=558

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNPNIGW+SFKRQML+MR+HSDSKG ELKRP+DS Y+FPCPDCMCR
Sbjct  492  KTIRPDKRKLALLFDNPNIGWRSFKRQMLSMRSHSDSKGYELKRPSDSPYTFPCPDCMCR  551

Query  561  LNKT  550
             NK+
Sbjct  552  ANKS  555



>ref|XP_002311505.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa]
 gb|EEE88872.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa]
Length=569

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDN  I WKSFKR MLNMR+HSDSKG E+KRPNDSIYSFPCPDCMC 
Sbjct  497  KTIRPDKRKLAMLFDNLKIDWKSFKRHMLNMRSHSDSKGFEIKRPNDSIYSFPCPDCMCH  556

Query  561  LNKTKDSKLSPGT  523
            +N+T+ S+ S  T
Sbjct  557  VNRTEGSRSSSAT  569



>ref|XP_008649711.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=588

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+L DNP IGWK+ KR +LNMRAHSD+KGIE+KRPN+SIY+FPCPDCMCR
Sbjct  516  KTIKPDKRRLAVLLDNPRIGWKALKRHLLNMRAHSDAKGIEMKRPNESIYTFPCPDCMCR  575

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  576  LNRTEHSK  583



>ref|XP_006342311.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=552

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLALL+DNP IGWKSFKRQMLN+RAHSDSKGIE+KRP+DS+YS PCPDCM R
Sbjct  480  RTIRPDKRKLALLYDNPIIGWKSFKRQMLNVRAHSDSKGIEIKRPSDSVYSVPCPDCMRR  539

Query  561  LNKTKDSKLSPGT  523
             NKT+  K S  T
Sbjct  540  SNKTEVLKSSLAT  552



>gb|KFK43757.1| hypothetical protein AALP_AA1G168900 [Arabis alpina]
Length=557

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSDSKG ELKRP+DSIY FPCPDCMCR
Sbjct  489  KTIRPDKRKLAILFDNPKLGWRSFKRQMLSMRSHSDSKGFELKRPSDSIYIFPCPDCMCR  548

Query  561  LNKTKDS  541
             NKT  S
Sbjct  549  RNKTTAS  555



>ref|XP_010496702.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSDSKG ELKRP+DSIY FPCPDCMCR
Sbjct  481  KTIRPDKRKLAVLFDNPKLGWRSFKRQMLSMRSHSDSKGFELKRPSDSIYIFPCPDCMCR  540

Query  561  LNKTKDS  541
             NKT  S
Sbjct  541  KNKTTAS  547



>ref|XP_010496695.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSDSKG ELKRP+DSIY FPCPDCMCR
Sbjct  488  KTIRPDKRKLAVLFDNPKLGWRSFKRQMLSMRSHSDSKGFELKRPSDSIYIFPCPDCMCR  547

Query  561  LNKTKDS  541
             NKT  S
Sbjct  548  KNKTTAS  554



>ref|XP_004963730.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=576

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFDN  IGWKS KR +LNMRAHSD+KGIE+KRPN+SIY+FPCPDCMCR
Sbjct  504  KTIKPDKRRLAVLFDNQRIGWKSLKRHLLNMRAHSDTKGIEMKRPNESIYTFPCPDCMCR  563

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  564  LNRTEHSK  571



>gb|AFW82218.1| hypothetical protein ZEAMMB73_014086, partial [Zea mays]
Length=582

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+L +LFDNP IGWK+ KR +LNMRAHSD+KGIE+KRP++SIY+FPCPDCMCR
Sbjct  514  KTIKPDKRRLVVLFDNPRIGWKALKRHLLNMRAHSDAKGIEMKRPSESIYTFPCPDCMCR  573

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  574  LNRTEHSK  581



>ref|XP_008656362.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=586

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+L +LFDNP IGWK+ KR +LNMRAHSD+KGIE+KRP++SIY+FPCPDCMCR
Sbjct  514  KTIKPDKRRLVVLFDNPRIGWKALKRHLLNMRAHSDAKGIEMKRPSESIYTFPCPDCMCR  573

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  574  LNRTEHSK  581



>ref|NP_001183075.1| hypothetical protein [Zea mays]
 ref|XP_008651798.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR35645.1| unknown [Zea mays]
 tpg|DAA62043.1| TPA: hypothetical protein ZEAMMB73_645940 [Zea mays]
Length=264

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LF+NP IGW + KR +LNMRA+SD KGIE+KRPN+SIY+FPCPDCMCR
Sbjct  192  KTIKPDKRRLAVLFNNPRIGWTALKRHLLNMRAYSDVKGIEMKRPNESIYTFPCPDCMCR  251

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  252  LNRTEHSK  259



>ref|XP_006416955.1| hypothetical protein EUTSA_v10007261mg [Eutrema salsugineum]
 gb|ESQ35308.1| hypothetical protein EUTSA_v10007261mg [Eutrema salsugineum]
Length=557

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQMLNMR+HSDSKG ELKR +DSIY FPCPDCMCR
Sbjct  490  KTIRPDKRKLAILFDNPKLGWRSFKRQMLNMRSHSDSKGFELKRSSDSIYIFPCPDCMCR  549

Query  561  LNKTKDS  541
             NKT  +
Sbjct  550  RNKTTGT  556



>ref|XP_008776785.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=563

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNP + WK+ KRQ+LNMRAHSD+KGIE+KRPNDSIY++PCPDCMCR
Sbjct  491  KTIKPDKRKLALLFDNPKVSWKALKRQLLNMRAHSDAKGIEIKRPNDSIYTYPCPDCMCR  550

Query  561  LNKTKDSKLSPG  526
             NK++  K  P 
Sbjct  551  SNKSEVLKSPPA  562



>emb|CAN77011.1| hypothetical protein VITISV_036881 [Vitis vinifera]
Length=575

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCM  568
            +T+RPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSD+KG ELKRPNDSIY+FPCPDC+
Sbjct  489  KTVRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDAKGFELKRPNDSIYTFPCPDCI  546



>ref|XP_006307153.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
 gb|EOA40051.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
Length=555

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GWKSFKRQML+MR+HSDSKG  LKRP+DSIY FPCPDCMCR
Sbjct  487  KTIRPDKRKLAVLFDNPKLGWKSFKRQMLSMRSHSDSKGFVLKRPSDSIYIFPCPDCMCR  546

Query  561  LNKTKDS  541
             NKT  S
Sbjct  547  KNKTTAS  553



>ref|XP_002892842.1| hypothetical protein ARALYDRAFT_471685 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69101.1| hypothetical protein ARALYDRAFT_471685 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GWKSFKRQML+MR+HSDSKG ELKR +DSIY FPCPDCMCR
Sbjct  493  KTIRPDKRKLAVLFDNPKLGWKSFKRQMLSMRSHSDSKGFELKRSSDSIYIFPCPDCMCR  552

Query  561  LNKTKDS  541
             NKT  S
Sbjct  553  KNKTTAS  559



>ref|XP_010476573.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=558

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSD KG ELKRP+DSIY FPCPDCMCR
Sbjct  490  KTIRPDKRKLAVLFDNPKLGWRSFKRQMLSMRSHSDYKGFELKRPSDSIYIFPCPDCMCR  549

Query  561  LNKTKDS  541
             NKT  S
Sbjct  550  KNKTTAS  556



>ref|XP_010476572.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=564

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSD KG ELKRP+DSIY FPCPDCMCR
Sbjct  496  KTIRPDKRKLAVLFDNPKLGWRSFKRQMLSMRSHSDYKGFELKRPSDSIYIFPCPDCMCR  555

Query  561  LNKTKDS  541
             NKT  S
Sbjct  556  KNKTTAS  562



>ref|XP_010459016.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSDSKG ELKRP+ SIY FPCPDCMCR
Sbjct  481  KTIRPDKRKLAVLFDNPKLGWRSFKRQMLSMRSHSDSKGFELKRPSGSIYIFPCPDCMCR  540

Query  561  LNKTKDS  541
             NKT  S
Sbjct  541  KNKTTAS  547



>ref|XP_010459015.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFKRQML+MR+HSDSKG ELKRP+ SIY FPCPDCMCR
Sbjct  488  KTIRPDKRKLAVLFDNPKLGWRSFKRQMLSMRSHSDSKGFELKRPSGSIYIFPCPDCMCR  547

Query  561  LNKTKDS  541
             NKT  S
Sbjct  548  KNKTTAS  554



>ref|XP_008655749.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
Length=269

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LF+NP IGW + KR +LNMRAHSD KGIE+KRPN+SIY+F CPDCMCR
Sbjct  197  KTIKPDKRRLAVLFNNPRIGWTALKRHLLNMRAHSDVKGIEMKRPNESIYTFRCPDCMCR  256

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  257  LNRTEHSK  264



>ref|XP_008645342.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
Length=270

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LF+NP IGW + K+ +LNMRAHSD KGIE+KRPN+SIY+FPCPDCMC 
Sbjct  198  KTIKPDKRRLAVLFNNPRIGWTALKQHLLNMRAHSDVKGIEMKRPNESIYTFPCPDCMCH  257

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  258  LNRTEHSK  265



>gb|AAF79229.1|AC006917_14 F10B6.36 [Arabidopsis thaliana]
Length=483

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLA+LFDNP +GWKSFKRQML+MR+HSDSKG ELKR +DSIY FPCPDCMCR
Sbjct  415  KTIQPDKRKLAVLFDNPKLGWKSFKRQMLSMRSHSDSKGFELKRSSDSIYIFPCPDCMCR  474

Query  561  LNKTKDS  541
             NKT  S
Sbjct  475  KNKTTAS  481



>dbj|BAD81763.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAG87369.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ++NMR HSD+KGIE+KR N+SIY+FPCPDCMCR
Sbjct  262  KTIKPDKRRLAILFDSPRIGWKSLKRQLVNMRTHSDAKGIEMKRANESIYTFPCPDCMCR  321

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  322  SNKSEHSK  329



>ref|XP_010931259.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Elaeis guineensis]
Length=497

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALL DNP + WK+ KRQ+LNMRAHSD+KGIE+KRPNDSIY++PCPDCMCR
Sbjct  425  KTIKPDKRKLALLLDNPKVSWKALKRQLLNMRAHSDAKGIEIKRPNDSIYTYPCPDCMCR  484

Query  561  LNKTKDSKLSPG  526
             NK++  K  P 
Sbjct  485  SNKSEVLKSPPA  496



>ref|NP_001044765.1| Os01g0841200 [Oryza sativa Japonica Group]
 dbj|BAF06679.1| Os01g0841200, partial [Oryza sativa Japonica Group]
Length=381

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ++NMR HSD+KGIE+KR N+SIY+FPCPDCMCR
Sbjct  309  KTIKPDKRRLAILFDSPRIGWKSLKRQLVNMRTHSDAKGIEMKRANESIYTFPCPDCMCR  368

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  369  SNKSEHSK  376



>gb|EEE55649.1| hypothetical protein OsJ_04031 [Oryza sativa Japonica Group]
Length=422

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ++NMR HSD+KGIE+KR N+SIY+FPCPDCMCR
Sbjct  350  KTIKPDKRRLAILFDSPRIGWKSLKRQLVNMRTHSDAKGIEMKRANESIYTFPCPDCMCR  409

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  410  SNKSEHSK  417



>ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKL  +F NPNIGWK+FKRQML MR+HSD+KG+E++RPNDSIY+FPCPDCMCR
Sbjct  482  KTIRPDKRKLVQIFGNPNIGWKNFKRQMLVMRSHSDAKGMEIRRPNDSIYTFPCPDCMCR  541

Query  561  LNKTKDSK  538
             N   DS+
Sbjct  542  ANNLDDSQ  549



>gb|EEC71770.1| hypothetical protein OsI_04380 [Oryza sativa Indica Group]
Length=440

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ++NMR HSD+KGIE+KR N+SIY+FPCPDCMCR
Sbjct  368  KTIKPDKRRLAILFDSPRIGWKSLKRQLVNMRTHSDAKGIEMKRANESIYTFPCPDCMCR  427

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  428  SNKSEHSK  435



>ref|NP_172950.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE29248.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=562

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLA+LFDNP +GWKSFKRQML+MR+HSDSKG ELKR +DSIY FPCPDCMCR
Sbjct  494  KTIQPDKRKLAVLFDNPKLGWKSFKRQMLSMRSHSDSKGFELKRSSDSIYIFPCPDCMCR  553

Query  561  LNKTKDS  541
             NKT  S
Sbjct  554  KNKTTAS  560



>ref|XP_003564587.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=573

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+LNMR+HSD+KGIE+KR N+SIY+FPCPDCMCR
Sbjct  501  KTIKPDKRRLAILFDSPRIGWKSLKRQLLNMRSHSDAKGIEMKRANESIYTFPCPDCMCR  560

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  561  SNKSEQSK  568



>ref|XP_011070621.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=558

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTIRPDKRKLA LF +P+IGWKSFK QMLNMRA+S+ KG+E++R NDSIYSFPCPDCMC+
Sbjct  487  RTIRPDKRKLAFLFGSPSIGWKSFKHQMLNMRAYSEFKGVEVRRSNDSIYSFPCPDCMCK  546

Query  561  LNKTKDSKLS  532
            +NK +D + S
Sbjct  547  VNKMEDLRSS  556



>ref|XP_010931258.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Elaeis guineensis]
Length=563

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALL DNP + WK+ KRQ+LNMRAHSD+KGIE+KRPNDSIY++PCPDCMCR
Sbjct  491  KTIKPDKRKLALLLDNPKVSWKALKRQLLNMRAHSDAKGIEIKRPNDSIYTYPCPDCMCR  550

Query  561  LNKTKDSKLSPG  526
             NK++  K  P 
Sbjct  551  SNKSEVLKSPPA  562



>ref|XP_006644988.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=448

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ++NMR HSD+KGIE+KR N+SIY+FPCPDCMCR
Sbjct  376  KTIKPDKRRLAILFDSPRIGWKSLKRQLVNMRTHSDAKGIEMKRANESIYTFPCPDCMCR  435

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  436  SNKSEHSK  443



>ref|XP_004970534.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=564

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+ NMRAHSD+KGIE+KR N+S+Y+FPCPDCMCR
Sbjct  492  KTIKPDKRRLAILFDSPRIGWKSLKRQLFNMRAHSDAKGIEIKRANESVYTFPCPDCMCR  551

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  552  SNKSEHSK  559



>ref|XP_010922337.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=563

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNP + WK+ KRQ+LNMRAHSD+KGIE+KR NDSIY++PCPDCMCR
Sbjct  491  KTIKPDKRKLALLFDNPKVSWKALKRQLLNMRAHSDAKGIEIKRSNDSIYTYPCPDCMCR  550

Query  561  LNKTKDSKLSPGT  523
             N+++  K  P +
Sbjct  551  SNRSEVLKSPPAS  563



>gb|AFW78262.1| hypothetical protein ZEAMMB73_416738, partial [Zea mays]
Length=556

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+L DNP IGWK+ KR +LNMRAHSD+KGIE+KRPN+SIY+FPCPDCMCR
Sbjct  494  KTIKPDKRRLAVLLDNPRIGWKALKRHLLNMRAHSDAKGIEMKRPNESIYTFPCPDCMCR  553

Query  561  LNK  553
            LN+
Sbjct  554  LNR  556



>gb|AFW80351.1| hypothetical protein ZEAMMB73_842533 [Zea mays]
Length=443

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LF+NP IGW + KR +LNMRAHSD KGIE+KRPN+SIY+F CPDCMCR
Sbjct  371  KTIKPDKRRLAVLFNNPRIGWTALKRHLLNMRAHSDVKGIEMKRPNESIYTFRCPDCMCR  430

Query  561  LNKTKDSK  538
            LN+T+ SK
Sbjct  431  LNRTEHSK  438



>ref|XP_002458744.1| hypothetical protein SORBIDRAFT_03g039450 [Sorghum bicolor]
 gb|EES03864.1| hypothetical protein SORBIDRAFT_03g039450 [Sorghum bicolor]
Length=568

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+ NMRAHSD KGIE+KR N+S+Y+FPCPDCMCR
Sbjct  496  KTIKPDKRRLAILFDSPRIGWKSLKRQLFNMRAHSDVKGIEIKRANESVYTFPCPDCMCR  555

Query  561  LNKTKDSK  538
             NK + SK
Sbjct  556  SNKQEHSK  563



>emb|CDY33727.1| BnaA09g45330D [Brassica napus]
Length=557

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFK QMLNMR+HSDSKG +LKR +DSIY FPCPDCMCR
Sbjct  490  KTIRPDKRKLAVLFDNPKLGWRSFKHQMLNMRSHSDSKGFKLKRASDSIYIFPCPDCMCR  549

Query  561  LNKTKDS  541
             NKT  +
Sbjct  550  RNKTTAT  556



>ref|XP_009416135.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNP IGWKS KRQ+L MRA SD+KGIE+KRPN+SIY++PCP CMCR
Sbjct  497  KTIKPDKRKLALLFDNPTIGWKSLKRQLLIMRAQSDAKGIEMKRPNESIYTYPCPHCMCR  556

Query  561  LNKTKDSK  538
             N+T+ S+
Sbjct  557  SNRTEVSR  564



>emb|CDX81687.1| BnaC08g39140D [Brassica napus]
Length=558

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFK QMLNMR+HSDSKG +LKR +DSIY FPCPDCMCR
Sbjct  490  KTIRPDKRKLAVLFDNPKLGWRSFKHQMLNMRSHSDSKGFKLKRASDSIYIFPCPDCMCR  549

Query  561  LNKTKDS  541
             NKT  +
Sbjct  550  KNKTTAT  556



>ref|XP_009117860.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=558

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP +GW+SFK QMLNMR+HSDSKG +LKR +DSIY FPCPDCMCR
Sbjct  490  KTIRPDKRKLAVLFDNPKLGWRSFKHQMLNMRSHSDSKGFKLKRASDSIYIFPCPDCMCR  549

Query  561  LNKTKDS  541
             NKT  +
Sbjct  550  KNKTTAT  556



>ref|XP_009148881.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 ref|XP_009148882.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 ref|XP_009148883.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=556

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP + W+SFK QMLNMR+HSDSKG ELKR +DSIY FPCPDCMCR
Sbjct  489  KTIRPDKRKLAVLFDNPKLSWRSFKHQMLNMRSHSDSKGFELKRSSDSIYIFPCPDCMCR  548

Query  561  LNKT  550
             NKT
Sbjct  549  RNKT  552



>emb|CDY36519.1| BnaA06g09720D [Brassica napus]
Length=556

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA+LFDNP + W+SFK QMLNMR+HSDSKG ELKR +DSIY FPCPDCMCR
Sbjct  489  KTIRPDKRKLAVLFDNPKLSWRSFKHQMLNMRSHSDSKGFELKRSSDSIYIFPCPDCMCR  548

Query  561  LNKTKDS  541
             NKT  +
Sbjct  549  RNKTTAT  555



>gb|AES59903.2| O-fucosyltransferase family protein [Medicago truncatula]
Length=549

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+ NIGWKS K Q+L+MR+HSDSKG+ELKRPNDS YSFPCPDCMC 
Sbjct  488  KTIKPDKRKLALLFDSTNIGWKSLKHQLLSMRSHSDSKGVELKRPNDSTYSFPCPDCMCH  547

Query  561  LN  556
             N
Sbjct  548  AN  549



>ref|XP_003589652.1| hypothetical protein MTR_1g031590 [Medicago truncatula]
Length=614

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+ NIGWKS K Q+L+MR+HSDSKG+ELKRPNDS YSFPCPDCMC 
Sbjct  553  KTIKPDKRKLALLFDSTNIGWKSLKHQLLSMRSHSDSKGVELKRPNDSTYSFPCPDCMCH  612

Query  561  LN  556
             N
Sbjct  613  AN  614



>ref|XP_008674839.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=502

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+ NMRAHSD KGIE+KR N+S+Y+FPCPDCMCR
Sbjct  440  KTIKPDKRRLAILFDSPRIGWKSLKRQLFNMRAHSDVKGIEIKRANESVYTFPCPDCMCR  499

Query  561  LNK  553
             NK
Sbjct  500  SNK  502



>ref|XP_008674838.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
 gb|ACR35648.1| unknown [Zea mays]
 tpg|DAA56900.1| TPA: hypothetical protein ZEAMMB73_118496 [Zea mays]
Length=558

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+ NMRAHSD KGIE+KR N+S+Y+FPCPDCMCR
Sbjct  496  KTIKPDKRRLAILFDSPRIGWKSLKRQLFNMRAHSDVKGIEIKRANESVYTFPCPDCMCR  555

Query  561  LNK  553
             NK
Sbjct  556  SNK  558



>gb|EMT14891.1| hypothetical protein F775_28466 [Aegilops tauschii]
Length=426

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+LNMR+HSD+KGI++KR N+S+Y+FP PDCMC 
Sbjct  354  KTIKPDKRRLAILFDSPRIGWKSLKRQLLNMRSHSDAKGIQMKRANESVYTFPSPDCMCH  413

Query  561  LNKTKDSK  538
             NK++  K
Sbjct  414  PNKSERPK  421



>dbj|BAJ88036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LA+LFD+P IGWKS KRQ+L+MR+HSD+KGI++KR N+S+Y+FP PDCMC 
Sbjct  481  KTIKPDKRRLAILFDSPRIGWKSLKRQLLSMRSHSDAKGIQIKRANESVYTFPSPDCMCH  540

Query  561  LNKTKDSK  538
             NK++ SK
Sbjct  541  PNKSEHSK  548



>ref|XP_009362464.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=442

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNI W+ FKRQM +M  HSD KG+ELK+P+ S+Y+FP PDCMC+
Sbjct  373  KTIKPDKRKLALLFDNPNIRWEDFKRQMQDMLRHSDQKGVELKKPSASLYTFPMPDCMCK  432



>ref|XP_009362462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=582

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNI W+ FKRQM +M  HSD KG+ELK+P+ S+Y+FP PDCMC+
Sbjct  513  KTIKPDKRKLALLFDNPNIRWEDFKRQMQDMLRHSDQKGVELKKPSASLYTFPMPDCMCK  572



>ref|XP_008378761.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=455

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+PNI W+ FKRQM +M  HSD KG ELK+P+ S+Y+FP PDCMC+
Sbjct  377  KTIKPDKRKLALLFDBPNIRWEDFKRQMQDMLRHSDQKGFELKKPSASLYTFPMPDCMCK  436



>ref|XP_010104478.1| hypothetical protein L484_025447 [Morus notabilis]
 gb|EXC01079.1| hypothetical protein L484_025447 [Morus notabilis]
Length=256

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLA+LFDNP I W+ FKRQM +M  HSD KGIEL++P+ S+Y+FP PDCMC+
Sbjct  182  KTIKPDKRKLAVLFDNPKIRWEDFKRQMRDMLRHSDQKGIELRKPSGSLYTFPMPDCMCK  241



>ref|XP_010246043.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Nelumbo 
nucifera]
Length=456

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+PNI W+ FKRQM  M  HSD KGIE+K+P+ S+Y+FP PDCMC+
Sbjct  382  KTIKPDKRKLALLFDSPNIRWEYFKRQMQEMLHHSDLKGIEMKKPSSSLYTFPIPDCMCK  441



>ref|XP_010246041.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=532

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+PNI W+ FKRQM  M  HSD KGIE+K+P+ S+Y+FP PDCMC+
Sbjct  458  KTIKPDKRKLALLFDSPNIRWEYFKRQMQEMLHHSDLKGIEMKKPSSSLYTFPIPDCMCK  517



>ref|XP_010246042.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
Length=510

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+PNI W+ FKRQM  M  HSD KGIE+K+P+ S+Y+FP PDCMC+
Sbjct  436  KTIKPDKRKLALLFDSPNIRWEYFKRQMQEMLHHSDLKGIEMKKPSSSLYTFPIPDCMCK  495



>ref|XP_010246040.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=576

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+PNI W+ FKRQM  M  HSD KGIE+K+P+ S+Y+FP PDCMC+
Sbjct  502  KTIKPDKRKLALLFDSPNIRWEYFKRQMQEMLHHSDLKGIEMKKPSSSLYTFPIPDCMCK  561



>ref|XP_004299893.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=564

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNP+I W+ FKRQM +M  HSD KG+E+++P+ S+Y+FP PDCMC+
Sbjct  491  KTIKPDKRKLALLFDNPSIRWEDFKRQMQDMLRHSDQKGVEVRKPSASLYTFPMPDCMCK  550

Query  561  LNKTKD  544
              +  D
Sbjct  551  EGEAID  556



>ref|XP_010061979.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69026.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=562

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLALLFDNP I W++FKRQM +M   SD KG ELK+P  S+Y+FP PDCMC+
Sbjct  495  KTIRPDKRKLALLFDNPKIRWENFKRQMQDMLHRSDVKGSELKKPGGSLYTFPMPDCMCK  554

Query  561  LNKTK  547
             NK +
Sbjct  555  QNKMR  559



>ref|XP_009379518.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=571

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T++PDKRKLALLFDNP+I W+ FKRQM +M  HSD KG ELK+P+ S+Y+FP PDCMC+
Sbjct  493  KTVKPDKRKLALLFDNPSIRWEDFKRQMQDMLRHSDQKGFELKKPSASLYTFPMPDCMCK  552



>ref|XP_006579000.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG ELK+  +S+Y+FP PDCMCR
Sbjct  424  KTIKPDKRRLALLFDNPNIRWEVFKQQMKDMLRHSDQKGTELKKAGESLYTFPMPDCMCR  483

Query  561  LNKTKD  544
              + K 
Sbjct  484  QAEPKS  489



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNI WK FKRQ+ +M  HSD KG+E ++P+ S+Y++P PDCMC+
Sbjct  499  KTIKPDKRKLALLFDNPNIRWKDFKRQLQDMLRHSDVKGVETRKPSGSLYTYPMPDCMCK  558



>ref|XP_007222464.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
 gb|EMJ23663.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
Length=569

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDKRKLALLFDNP+I W+ FKRQ+ +M  HSD KG+ELK+P+ S+Y+FP PDCMC+
Sbjct  491  KTINPDKRKLALLFDNPSIRWEDFKRQVQDMLRHSDQKGVELKKPSASLYTFPMPDCMCK  550

Query  561  LNKTKD  544
              + ++
Sbjct  551  EAEARN  556



>gb|KHN47089.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG ELK+  +S+Y+FP PDCMCR
Sbjct  490  KTIKPDKRRLALLFDNPNIRWEVFKQQMKDMLRHSDQKGTELKKAGESLYTFPMPDCMCR  549



>ref|XP_006578999.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=566

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG ELK+  +S+Y+FP PDCMCR
Sbjct  490  KTIKPDKRRLALLFDNPNIRWEVFKQQMKDMLRHSDQKGTELKKAGESLYTFPMPDCMCR  549



>ref|XP_007148603.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
 gb|ESW20597.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
Length=565

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNPNI W+ FK+QM +M  HSD KG ELK+   S+Y+FP PDCMC+
Sbjct  494  KTIKPDKRKLALLFDNPNIRWEEFKQQMKDMLRHSDQKGTELKKVGGSVYTFPMPDCMCK  553

Query  561  LNKTK  547
              + K
Sbjct  554  QAELK  558



>emb|CBI18521.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W +FK QM +M  HSDSKG EL++P+ S+Y+FP PDCMC+
Sbjct  418  KTIKPDKRKLALLFDSPDISWDNFKSQMQDMLRHSDSKGSELRKPSSSLYTFPMPDCMCK  477

Query  561  LNKT  550
              +T
Sbjct  478  QAET  481



>gb|EMT10519.1| hypothetical protein F775_32922 [Aegilops tauschii]
Length=157

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK  ML +  HSD +GI  ++PNDSIY+FP PDCMC+
Sbjct  94   KTIKPDKRKLVLSFDDPNIRWSRFKHHMLEILHHSDIRGIAFRKPNDSIYTFPMPDCMCQ  153



>ref|XP_006434582.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47822.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=445

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD PNI W  FKRQM +M +HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  370  KTIKPDKRKLALLFDRPNIRWDDFKRQMKDMLSHSDVKGSELRKPSASLYTFPMPDCMCK  429



>ref|XP_006473173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
 gb|KDO83869.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=445

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD PNI W  FKRQM +M +HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  370  KTIKPDKRKLALLFDRPNIRWDDFKRQMKDMLSHSDVKGSELRKPSASLYTFPMPDCMCK  429



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W +FK QM +M  HSDSKG EL++P+ S+Y+FP PDCMC+
Sbjct  508  KTIKPDKRKLALLFDSPDISWDNFKSQMQDMLRHSDSKGSELRKPSSSLYTFPMPDCMCK  567

Query  561  LNKT  550
              +T
Sbjct  568  QAET  571



>gb|KJB28879.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=547

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W++F+RQM +M  HSD KG ELK+P+ S+Y+FP PDCMC+
Sbjct  475  KTIKPDKRKLALLFDSPHIRWETFRRQMKDMLRHSDVKGGELKKPSGSVYTFPMPDCMCK  534

Query  561  LNKTKDSKLS  532
              +   ++ S
Sbjct  535  QTEAAANESS  544



>gb|KJB28877.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=575

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W++F+RQM +M  HSD KG ELK+P+ S+Y+FP PDCMC+
Sbjct  503  KTIKPDKRKLALLFDSPHIRWETFRRQMKDMLRHSDVKGGELKKPSGSVYTFPMPDCMCK  562

Query  561  LNKTKDSKLS  532
              +   ++ S
Sbjct  563  QTEAAANESS  572



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD PNI W  FKRQM +M +HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  581  KTIKPDKRKLALLFDRPNIRWDDFKRQMKDMLSHSDVKGSELRKPSASLYTFPMPDCMCK  640



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD PNI W  FKRQM +M +HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  495  KTIKPDKRKLALLFDRPNIRWDDFKRQMKDMLSHSDVKGSELRKPSASLYTFPMPDCMCK  554



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD PNI W  FKRQM +M +HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  495  KTIKPDKRKLALLFDRPNIRWDDFKRQMKDMLSHSDVKGSELRKPSASLYTFPMPDCMCK  554



>ref|XP_010319880.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=568

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W  FK Q+ +M  HSD+KG+ELK+P+ S+Y+FP PDCMC+
Sbjct  494  KTIKPDKRKLALLFDSPDIRWNDFKSQLQDMLHHSDTKGVELKKPSSSLYTFPMPDCMCK  553

Query  561  LNKTKDS  541
                K +
Sbjct  554  HADVKSA  560



>ref|XP_004237568.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=571

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W  FK Q+ +M  HSD+KG+ELK+P+ S+Y+FP PDCMC+
Sbjct  497  KTIKPDKRKLALLFDSPDIRWNDFKSQLQDMLHHSDTKGVELKKPSSSLYTFPMPDCMCK  556

Query  561  LNKTKDS  541
                K +
Sbjct  557  HADVKSA  563



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W  FK Q+ +M  HSD+KG+ELK+P+ S+Y+FP PDCMC+
Sbjct  497  KTIKPDKRKLALLFDSPDIRWNDFKSQLQDMLHHSDTKGVELKKPSSSLYTFPMPDCMCK  556

Query  561  LNKTKDS  541
                K +
Sbjct  557  HADVKSA  563



>gb|KHG28222.1| hypothetical protein F383_11890 [Gossypium arboreum]
Length=444

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W++F+RQM +M  HSD KG ELK+P+ S+Y+FP PDC+C+
Sbjct  372  KTIKPDKRKLALLFDSPHIRWETFRRQMKDMLRHSDVKGGELKKPSGSVYTFPMPDCLCK  431

Query  561  LNKTKDSKLS  532
              +   ++ S
Sbjct  432  QTEAAANESS  441



>ref|XP_006841300.1| hypothetical protein AMTR_s00134p00086190 [Amborella trichopoda]
 gb|ERN02975.1| hypothetical protein AMTR_s00134p00086190 [Amborella trichopoda]
Length=471

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALL DNPNI W++FKRQM  M  HSDSKGIE+++ N S ++FP PDCMC 
Sbjct  397  KTIKPDKRKLALLLDNPNIRWENFKRQMQAMLRHSDSKGIEMRKTNGSPFTFPMPDCMCH  456

Query  561  LNKT  550
              +T
Sbjct  457  HMET  460



>ref|XP_007020035.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY17260.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=588

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFDNP+I W++FKRQM +M  HSD KG E+K+ + S+Y+FP PDCMC+
Sbjct  505  KTIKPDKRKLALLFDNPHIRWETFKRQMRDMLHHSDVKGGEVKKASGSVYTFPMPDCMCK  564



>ref|XP_009781764.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=565

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+PNI W  FKRQ+ +M  HSD KG+ELK+ + S+Y+FP PDCMC+
Sbjct  491  KTIKPDKRKLALLFDSPNIRWNDFKRQLQDMLHHSDLKGVELKKSSSSLYTFPMPDCMCK  550

Query  561  LNKTKDS  541
                K +
Sbjct  551  QADVKSA  557



>gb|AFK46212.1| unknown [Medicago truncatula]
Length=359

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG  +K+ ++S+Y+FP PDCMC+
Sbjct  283  KTIKPDKRRLALLFDNPNIRWEVFKQQMKDMLRHSDQKGTGVKKASESLYTFPMPDCMCK  342

Query  561  LNKTKDSKLSPG  526
              + K+   + G
Sbjct  343  QVEPKNENANIG  354



>ref|XP_002325978.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
 gb|EEF00360.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
Length=584

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDKRKLALLFD P I W+ FKRQM NM  HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  514  KTINPDKRKLALLFDKPTIRWEVFKRQMQNMLRHSDVKGSELRKPSASLYTFPMPDCMCK  573

Query  561  LNKTKD  544
              + + 
Sbjct  574  QTEARQ  579



>ref|XP_011003993.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=590

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDKRKLALLFD P I W+ FKRQM NM  HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  520  KTINPDKRKLALLFDKPTIRWEVFKRQMQNMLRHSDVKGSELRKPSASLYTFPMPDCMCK  579

Query  561  LNKTKD  544
              + + 
Sbjct  580  QTEARQ  585



>ref|XP_006582446.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG E+K+   S+Y+FP PDCMC+
Sbjct  424  KTIKPDKRRLALLFDNPNIRWEVFKQQMTDMLRHSDQKGTEIKKAGGSLYTFPMPDCMCK  483



>ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES68269.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=577

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG E+K+ ++S+Y+FP PDCMC+
Sbjct  486  KTIKPDKRRLALLFDNPNIRWEVFKQQMKDMLRHSDQKGTEVKKASESLYTFPMPDCMCK  545

Query  561  LNKTKDSKL  535
              + K+  +
Sbjct  546  QVEPKNENI  554



>ref|XP_003526401.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN20543.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LALLFDNPNI W+ FK+QM +M  HSD KG E+K+   S+Y+FP PDCMC+
Sbjct  490  KTIKPDKRRLALLFDNPNIRWEVFKQQMTDMLRHSDQKGTEIKKAGGSLYTFPMPDCMCK  549



>ref|XP_004499553.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=553

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKR+LAL+FDNPN+ W+ FK+QM +M  HSD KG E+K+   S+Y+FP PDCMC+
Sbjct  477  KTIKPDKRRLALIFDNPNVRWEVFKQQMEDMLHHSDQKGTEVKKAAGSLYTFPMPDCMCK  536

Query  561  LNKTKDSKLSPG  526
              + K+   + G
Sbjct  537  QVEPKNENANTG  548



>ref|XP_009594772.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=564

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD+P+I W  FKRQ+ +M  HSD KG+ELK+ + S+Y+FP PDCMC+
Sbjct  490  KTIKPDKRKLALLFDSPDIRWNEFKRQLQDMLHHSDLKGVELKKSSSSLYTFPMPDCMCK  549

Query  561  LNKTKDS  541
                K +
Sbjct  550  QVDVKSA  556



>gb|KDP34835.1| hypothetical protein JCGZ_11197 [Jatropha curcas]
Length=594

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLALLFD P+I W+ FKRQM +M  HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  514  KTIKPDKRKLALLFDKPSIRWEVFKRQMKDMLRHSDHKGSELRKPSGSLYTFPMPDCMCK  573



>ref|XP_008459666.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
 ref|XP_008459667.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=556

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T++PDKRKLAL+FD+PNI W++F +QM +M  H+D KG+E+K+ + S+Y+FP PDCMC+
Sbjct  489  KTVKPDKRKLALIFDDPNIRWQNFAQQMQDMLRHNDQKGMEMKKSSGSLYTFPMPDCMCK  548

Query  561  LNKTKD  544
            +  TK+
Sbjct  549  VPNTKN  554



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL  LFDNPNI W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  504  KTIKPDKRKLVQLFDNPNIRWDYFKKQMQDMLRHNDAKGVELRKPASSLYTFPMPDCMCK  563



>ref|XP_008219032.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=503

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDKRKLALLFDNP+I W+ FK+Q+ +M  HSD KG+ELK+P+ S+Y+FP PDCM +
Sbjct  425  KTINPDKRKLALLFDNPSIRWEDFKKQVQDMLRHSDQKGVELKKPSASLYTFPMPDCMFK  484

Query  561  LNKTKD  544
              + ++
Sbjct  485  EAEARN  490



>ref|XP_004141562.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004162859.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN52707.1| hypothetical protein Csa_5G651650 [Cucumis sativus]
Length=573

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T++PDKRKLAL+FD+PNI W++F +QM +M  H+D KG+E+K+ + S+Y+FP PDCMC+
Sbjct  506  KTVKPDKRKLALIFDDPNIRWQNFAQQMQDMLRHNDQKGMEMKKSSGSLYTFPMPDCMCK  565

Query  561  LNKTKD  544
            +  +K+
Sbjct  566  VPNSKN  571



>ref|XP_002533585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28803.1| conserved hypothetical protein [Ricinus communis]
Length=587

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T++PDKRKLA+LFD P+I W+ FKRQM +M  HSD KG EL++P+ S+Y+FP PDCMC+
Sbjct  510  KTLKPDKRKLAVLFDKPSIRWEVFKRQMQDMLRHSDLKGSELRKPSGSLYTFPMPDCMCK  569

Query  561  LNKTK  547
              +T+
Sbjct  570  PPETR  574



>gb|EMT33054.1| hypothetical protein F775_09106 [Aegilops tauschii]
Length=463

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK  ML +  HSD +GI  ++PNDSIY+FP PDCMC+
Sbjct  400  KTIKPDKRKLVLSFDDPNIRWSRFKHHMLEILHHSDIRGIAFRKPNDSIYTFPMPDCMCQ  459



>gb|EMS55867.1| hypothetical protein TRIUR3_34733 [Triticum urartu]
Length=463

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK  ML +  HSD +GI  ++PNDSIY+FP PDCMC+
Sbjct  400  KTIKPDKRKLVLSFDDPNIRWSRFKHHMLEILHHSDIRGIAFRKPNDSIYTFPMPDCMCQ  459



>gb|EMT24938.1| hypothetical protein F775_20364 [Aegilops tauschii]
Length=404

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  F   ML +  HSD +GI  ++PNDSIY+FP PDCMC+
Sbjct  341  KTIKPDKRKLVLSFDDPNIRWNRFNHHMLEILHHSDIRGITFRKPNDSIYTFPMPDCMCQ  400



>ref|NP_001066285.2| Os12g0174100 [Oryza sativa Japonica Group]
 gb|ABA96586.1| Growth regulator protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29304.2| Os12g0174100 [Oryza sativa Japonica Group]
Length=491

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTI+PDKRKL L FD+PNI W  FKR M ++  HSD +G  L++PNDSIY+FP P+CMC+
Sbjct  427  RTIKPDKRKLVLSFDDPNIRWNRFKRHMQDILHHSDMRGTALRKPNDSIYTFPMPECMCQ  486



>gb|EEE52851.1| hypothetical protein OsJ_35390 [Oryza sativa Japonica Group]
Length=562

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTI+PDKRKL L FD+PNI W  FKR M ++  HSD +G  L++PNDSIY+FP P+CMC+
Sbjct  498  RTIKPDKRKLVLSFDDPNIRWNRFKRHMQDILHHSDMRGTALRKPNDSIYTFPMPECMCQ  557



>ref|NP_001132122.1| uncharacterized protein LOC100193539 [Zea mays]
 gb|ACF80826.1| unknown [Zea mays]
Length=313

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK+ M  +  HSD + I L++PNDS+Y+FP PDCMC+
Sbjct  249  KTIKPDKRKLVLSFDDPNIRWDQFKQNMQEILQHSDMRSIALRKPNDSVYTFPMPDCMCK  308



>ref|XP_003578848.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=558

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FKR M  +  HSD K I  ++PNDSIY+FP PDCMC+
Sbjct  495  KTIKPDKRKLVLSFDDPNIRWSQFKRHMQEILHHSDIKSIAFRKPNDSIYTFPMPDCMCQ  554



>ref|XP_008669808.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Zea mays]
Length=488

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL  LFDNPNI W  FK  M +MR HS+ KG  L++P +SIY+ P PDCMC+
Sbjct  417  KTIKPDKRKLVQLFDNPNIRWDRFKHHMQDMRRHSEMKGFALRKPQESIYTLPMPDCMCQ  476



>ref|XP_010478945.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=571

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D P+IGW  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  505  ETIKPDKRKLVQLLDKPSIGWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  564



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKLA LFD P+I W+ FKRQ+ +M  H+D KG EL++P++S+Y +P PDCMCR
Sbjct  512  KTIRPDKRKLAQLFDKPSIRWQDFKRQLQDMLRHNDVKGSELRKPSNSLYMYPMPDCMCR  571



>gb|EEC68940.1| hypothetical protein OsI_37646 [Oryza sativa Indica Group]
Length=566

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FKR M ++  HSD +G  L++PNDSIY+FP P+CMC+
Sbjct  502  KTIKPDKRKLVLSFDDPNIRWNRFKRHMQDILHHSDMRGTALRKPNDSIYTFPMPECMCQ  561



>ref|XP_008669806.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=497

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL  LFDNPNI W  FK  M +MR HS+ KG  L++P +SIY+ P PDCMC+
Sbjct  426  KTIKPDKRKLVQLFDNPNIRWDRFKHHMQDMRRHSEMKGFALRKPQESIYTLPMPDCMCQ  485



>ref|XP_008669805.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=544

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL  LFDNPNI W  FK  M +MR HS+ KG  L++P +SIY+ P PDCMC+
Sbjct  473  KTIKPDKRKLVQLFDNPNIRWDRFKHHMQDMRRHSEMKGFALRKPQESIYTLPMPDCMCQ  532



>ref|XP_006664382.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=431

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FKR M ++  HSD +G   ++PNDSIY+FP P+CMC+
Sbjct  367  KTIKPDKRKLVLSFDDPNIRWNRFKRHMQDILHHSDMRGTAFRKPNDSIYTFPMPECMCQ  426



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKLA LFD P+I W+ FKRQ+ +M  H+D KGIEL++ + S+Y +P PDCMCR
Sbjct  506  KTIKPDKRKLAQLFDKPSIRWQDFKRQLQDMLHHNDVKGIELRKSSSSLYMYPMPDCMCR  565

Query  561  LNKTK  547
                K
Sbjct  566  KTDAK  570



>gb|AFW56213.1| hypothetical protein ZEAMMB73_697257 [Zea mays]
Length=518

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK+ M  +  HSD + I L++PNDS+Y+FP PDCMC+
Sbjct  454  KTIKPDKRKLVLSFDDPNIRWDQFKQNMQEILQHSDMRSIALRKPNDSVYTFPMPDCMCK  513



>ref|XP_006397450.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
 gb|ESQ38903.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
Length=571

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  LFD P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  501  ETIKPDKRKLVQLFDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  560



>ref|XP_008661414.1| PREDICTED: uncharacterized protein LOC100193539 isoform X1 [Zea 
mays]
Length=564

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK+ M  +  HSD + I L++PNDS+Y+FP PDCMC+
Sbjct  500  KTIKPDKRKLVLSFDDPNIRWDQFKQNMQEILQHSDMRSIALRKPNDSVYTFPMPDCMCK  559



>ref|XP_010461317.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D PNI W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  507  ETIKPDKRKLVQLLDKPNIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  566



>ref|XP_010500036.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D PNI W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  507  ETIKPDKRKLVQLLDKPNIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  566



>ref|XP_009390063.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=541

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDK+KL L FDNPNI W  FKR M  +  HSD KGI L++P+ S+Y+FP PDCMC+
Sbjct  478  KTINPDKKKLVLSFDNPNIRWDKFKRNMQEVLHHSDLKGITLRKPDASLYTFPMPDCMCQ  537



>ref|XP_009390064.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=521

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDK+KL L FDNPNI W  FKR M  +  HSD KGI L++P+ S+Y+FP PDCMC+
Sbjct  458  KTINPDKKKLVLSFDNPNIRWDKFKRNMQEVLHHSDLKGITLRKPDASLYTFPMPDCMCQ  517



>ref|XP_004977274.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=511

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK+ M  +  HSD + I  ++PNDSIY+FP PDCMC+
Sbjct  447  KTIKPDKRKLVLSFDDPNIRWDRFKQNMQEILQHSDVRSIAFRKPNDSIYTFPMPDCMCQ  506



>ref|XP_002450409.1| hypothetical protein SORBIDRAFT_05g004890 [Sorghum bicolor]
 gb|EES09397.1| hypothetical protein SORBIDRAFT_05g004890 [Sorghum bicolor]
Length=544

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL  LFDNPNI W  FK  M +MR HS+ KG+ L++P +S+Y+ P PDCMC+
Sbjct  473  KTIKPDKRKLVQLFDNPNIRWDRFKHYMEDMRRHSEMKGLGLRKPQESMYNLPMPDCMCQ  532



>ref|XP_006304663.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
 gb|EOA37561.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
Length=580

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  738  TIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KGIEL++P  S+Y+FP PDCMC+
Sbjct  509  TIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGIELRKPAASLYTFPMPDCMCK  567



>gb|KFK27807.1| hypothetical protein AALP_AA8G431600 [Arabis alpina]
Length=569

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  738  TIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            TI+PDKRKL  LFD P+I W  FK+QM ++  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  500  TIKPDKRKLVQLFDRPSIRWDYFKKQMQDILRHNDAKGVELRKPAASLYTFPMPDCMCK  558



>gb|EEE51747.1| hypothetical protein OsJ_33163 [Oryza sativa Japonica Group]
Length=479

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPND--SIYSFPCPDCM  568
            +TI+PDKRKL  LFDNPNI W  FKRQM ++  HS+SKG  +++PN   SIY+ P PDCM
Sbjct  414  KTIKPDKRKLVALFDNPNIRWDRFKRQMQDIHRHSESKGFGVRKPNGSISIYTLPMPDCM  473

Query  567  CR  562
            C+
Sbjct  474  CQ  475



>gb|EEC67779.1| hypothetical protein OsI_35317 [Oryza sativa Indica Group]
Length=544

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPND--SIYSFPCPDCM  568
            +TI+PDKRKL  LFDNPNI W  FKRQM ++  HS+SKG  +++PN   SIY+ P PDCM
Sbjct  479  KTIKPDKRKLVALFDNPNIRWDRFKRQMQDIHRHSESKGFGVRKPNGSISIYTLPMPDCM  538

Query  567  CR  562
            C+
Sbjct  539  CQ  540



>ref|XP_002441904.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
 gb|EES15742.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
Length=533

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FD+PNI W  FK+ M  +  HSD K I  ++PNDS+Y+FP P+CMC+
Sbjct  469  KTIKPDKRKLVLSFDDPNIRWDQFKQNMQEILHHSDMKSIAFRKPNDSVYTFPMPECMCQ  528



>ref|XP_010543593.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
Length=577

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T++PDKRKL  L D PNI W  FK+QM +M  HSD+KGIEL++P  S+Y+FP PDCM +
Sbjct  498  KTVKPDKRKLVQLLDIPNIRWDYFKKQMQDMLRHSDAKGIELRKPASSLYTFPMPDCMYK  557



>gb|AAK93632.1| putative growth regulator protein [Arabidopsis thaliana]
Length=568

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  498  ETIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  557



>ref|NP_564461.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN12984.1| putative growth regulator [Arabidopsis thaliana]
 gb|AEE31802.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=568

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  498  ETIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  557



>ref|XP_010543575.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543584.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=587

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +T++PDKRKL  L D PNI W  FK+QM +M  HSD+KGIEL++P  S+Y+FP PDCM +
Sbjct  508  KTVKPDKRKLVQLLDIPNIRWDYFKKQMQDMLRHSDAKGIELRKPASSLYTFPMPDCMYK  567



>ref|XP_002891187.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67446.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  499  ETIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  558



>emb|CDY66921.1| BnaAnng23210D [Brassica napus]
Length=564

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
             TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  492  ETIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  551



>ref|XP_009114709.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=562

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  738  TIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  493  TIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  551



>gb|AAF79365.1|AC007887_24 F15O4.45 [Arabidopsis thaliana]
Length=668

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  738  TIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            TI+PDKRKL  L D P+I W  FK+QM +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  599  TIKPDKRKLVQLLDKPSIRWDYFKKQMQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  657



>emb|CDY03127.1| BnaC06g08460D [Brassica napus]
Length=560

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  738  TIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            TI+PDKRKL  L D P+I W  FK+Q+ +M  H+D+KG+EL++P  S+Y+FP PDCMC+
Sbjct  491  TIKPDKRKLVQLLDKPSIRWDYFKKQLQDMLRHNDAKGVELRKPAASLYTFPMPDCMCK  549



>ref|XP_010680244.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDK+KLALLFDNP++ W++F  QM +M   SDSKG E+K+   S+Y+FP PDCMC+
Sbjct  523  KTIIPDKKKLALLFDNPDVRWETFIYQMQDMLYRSDSKGREMKKVTASLYTFPMPDCMCQ  582

Query  561  LNKTKDSKLS  532
               T  + ++
Sbjct  583  EADTNTTDVN  592



>ref|XP_010680324.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=596

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDK+KLALLFDNP++ W++F  QM +M   SDSKG E+K+   S+Y+FP PDCMC+
Sbjct  523  KTIIPDKKKLALLFDNPDVRWETFIYQMQDMLYRSDSKGREMKKVTASLYTFPMPDCMCQ  582

Query  561  LNKTKDSKLS  532
               T  + ++
Sbjct  583  EADTNTTDVN  592



>dbj|BAJ97328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDK KL L FD+PNI W  FK  M  +  +SD +GI  ++PNDSIY+FP PDCMC+
Sbjct  494  KTIKPDKWKLVLSFDDPNIRWSRFKHHMQEILHNSDIRGIAFRKPNDSIYTFPMPDCMCQ  553

Query  561  LNKT  550
             + T
Sbjct  554  QDGT  557



>gb|EPS68582.1| hypothetical protein M569_06186, partial [Genlisea aurea]
Length=117

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            RTI+PDKRKL  LFD+ NI W+ FK+ + +M   +D KG+EL++P  S+Y  P PDCMC 
Sbjct  47   RTIKPDKRKLVQLFDDTNIRWQDFKKHLRDMLRRNDLKGVELRKPGGSLYMHPMPDCMCN  106

Query  561  LNKT  550
              K+
Sbjct  107  AKKS  110



>ref|XP_009379852.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDKRKL L FDNPNI W  FK  M  +  HSD KG+ L++ + S+YSFP PDCMC+
Sbjct  473  KTIKPDKRKLVLSFDNPNIRWDRFKHHMQEIFRHSDLKGVGLRKRDASLYSFPMPDCMCQ  532



>ref|XP_008784225.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=552

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMC  565
            +TI+PDKR+L L FDNPNI W  F+R M  M  +SD KG+ L++ N ++Y+FP PDCMC
Sbjct  489  KTIKPDKRRLVLSFDNPNIRWDRFERNMQEMLHYSDLKGVALRKSNATLYTFPMPDCMC  547



>ref|XP_002984324.1| hypothetical protein SELMODRAFT_268854 [Selaginella moellendorffii]
 gb|EFJ14834.1| hypothetical protein SELMODRAFT_268854 [Selaginella moellendorffii]
Length=570

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKL  L D P+I W+SF + +  M+ H+D KG E+++ + SIY++P PDCMC 
Sbjct  484  KTIRPDKRKLVQLLDRPSISWESFSKHLQAMQRHNDVKGHEMRKSSASIYTYPAPDCMCL  543

Query  561  LN  556
             N
Sbjct  544  EN  545



>ref|XP_010930789.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910-like 
[Elaeis guineensis]
Length=553

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMC  565
            +TI+PDK++L L FDNPNI W  FK  M  +  HSDSKG+ L++ + S+Y+ P PDCMC
Sbjct  490  KTIKPDKKRLVLSFDNPNIRWDRFKHNMQEVLHHSDSKGVGLRKSDASLYALPMPDCMC  548



>ref|XP_002972493.1| hypothetical protein SELMODRAFT_441812 [Selaginella moellendorffii]
 gb|EFJ26579.1| hypothetical protein SELMODRAFT_441812 [Selaginella moellendorffii]
Length=870

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TIRPDKRKL  L D P+I W+SF + +  M+ H+D KG E+++ + SIY++P PDCMC 
Sbjct  449  KTIRPDKRKLVQLLDRPSISWESFSKHLQAMQRHNDVKGHEMRKSSASIYTYPAPDCMCL  508

Query  561  LN  556
             N
Sbjct  509  EN  510



>emb|CDY39592.1| BnaC05g11210D, partial [Brassica napus]
Length=561

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKR  610
            +TIRPDKRKLA+LFDNP + W+SFK QML MR+HSDSKG ELKR
Sbjct  517  KTIRPDKRKLAVLFDNPKLSWRSFKHQMLIMRSHSDSKGFELKR  560



>ref|XP_010912508.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=550

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMC  565
            +TI+PDKR+L L FDNPNI W  FK  M  +  +SD KG+ L++ + S+Y+FP PDCMC
Sbjct  487  KTIKPDKRRLVLSFDNPNIRWDRFKHNMQEVLHYSDLKGVGLRKSDASLYTFPMPDCMC  545



>gb|EMT11808.1| hypothetical protein F775_16126 [Aegilops tauschii]
Length=517

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDK+K+ LLFDNP+I W  F+  M ++R HS+SKG   ++ + SIY+ P PDCMC+
Sbjct  454  KTITPDKQKMVLLFDNPDIRWDRFRHLMQDIRRHSESKGFGFRKHSGSIYNLPMPDCMCQ  513



>gb|EMS47472.1| hypothetical protein TRIUR3_14732 [Triticum urartu]
Length=440

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI PDKRK+ LLFDNP+I W  F+  M ++R  S+SKG   ++ + SIY+ P PDCMC+
Sbjct  377  KTITPDKRKMVLLFDNPDIRWDRFRHLMQDIRRQSESKGFGFRKQHGSIYNLPMPDCMCQ  436



>ref|XP_001760728.1| predicted protein [Physcomitrella patens]
 gb|EDQ74467.1| predicted protein [Physcomitrella patens]
Length=558

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 13/72 (18%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKR-------------PND  601
            +TI PDKR+L LL DNP+I W +F++ +++MR HSD KG++ ++             P  
Sbjct  470  KTINPDKRRLVLLLDNPHIEWDAFRKILVDMRRHSDFKGLQPRKSFPVSPKAYFTNPPKA  529

Query  600  SIYSFPCPDCMC  565
            S+Y+FP P+CMC
Sbjct  530  SVYTFPAPECMC  541



>ref|XP_006847061.1| hypothetical protein AMTR_s00017p00201590 [Amborella trichopoda]
 gb|ERN08642.1| hypothetical protein AMTR_s00017p00201590 [Amborella trichopoda]
Length=539

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -1

Query  738  TIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            TI+PDKRKL +L D+P I W++FK  M  M   SD  G  +++P  SIY  P P+CMCR
Sbjct  479  TIKPDKRKLVVLLDDPGIRWETFKANMTLMLHKSDHTGFAIRKPKGSIYGHPFPECMCR  537



>ref|XP_009390143.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=553

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+P+K KLA+LF + NI WK+F+ Q+  M   S+ KG+ L++ + S+YSFP PDC C 
Sbjct  474  KTIKPNKPKLAVLFQDTNISWKAFRGQLEVMLDESERKGMVLRKSSQSVYSFPSPDCACL  533

Query  561  LNKTKDSKL  535
             +   +S L
Sbjct  534  HDHQANSTL  542



>gb|KEH40566.1| receptor-like kinase [Medicago truncatula]
Length=828

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  681  WKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCRLNKTKDS  541
            WK  K Q+ +M +HSDSKG+ELKR NDSIY FP PDCMC  N   DS
Sbjct  776  WKILKHQLQSMMSHSDSKGVELKRHNDSIYIFPYPDCMCHANGIYDS  822



>ref|XP_010930931.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=545

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCR  562
            +TI+PDK+KLA+L  +P+I WK FK +M  M   S+ KG+  ++   SIY++P PDC C 
Sbjct  468  KTIKPDKQKLAVLLHDPSISWKVFKEEMETMLHESNRKGMTFRKSKQSIYAYPSPDCTCH  527



>ref|XP_003589648.1| Receptor serine/threonine kinase [Medicago truncatula]
Length=1129

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  681   WKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCRLNKTKDS  541
             WK  K Q+ +M +HSDSKG+ELKR NDSIY FP PDCMC  N   DS
Sbjct  1077  WKILKHQLQSMMSHSDSKGVELKRHNDSIYIFPYPDCMCHANGIYDS  1123



>gb|AES59899.2| receptor-like kinase [Medicago truncatula]
Length=1120

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  681   WKSFKRQMLNMRAHSDSKGIELKRPNDSIYSFPCPDCMCRLNKTKDS  541
             WK  K Q+ +M +HSDSKG+ELKR NDSIY FP PDCMC  N   DS
Sbjct  1068  WKILKHQLQSMMSHSDSKGVELKRHNDSIYIFPYPDCMCHANGIYDS  1114



>gb|KDP32763.1| hypothetical protein JCGZ_12055 [Jatropha curcas]
Length=594

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TIRPDKRKL +L  +  I WK+FK QM  M A SD KG+ + R        SIY++P P
Sbjct  510  KTIRPDKRKLVVLLQDMEISWKTFKDQMGAMLAESDRKGVMVPRVRKINRKTSIYTYPLP  569

Query  576  DCMCRLNKTKDSKLSPGT  523
            +C C L+     KL+  T
Sbjct  570  ECGCLLSHNSSLKLTHTT  587



>ref|XP_001753325.1| predicted protein [Physcomitrella patens]
 gb|EDQ81954.1| predicted protein [Physcomitrella patens]
Length=510

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 13/72 (18%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKR-------------PND  601
            +TI PDKR+L  L D+P+I W+ F++ + +MR HSD KG++ ++             P  
Sbjct  419  KTINPDKRRLVRLLDDPHIAWEVFRKNLEDMRRHSDFKGLQPRKALSVKKNAFYTVPPKA  478

Query  600  SIYSFPCPDCMC  565
            S+Y+FP P+CMC
Sbjct  479  SLYTFPAPECMC  490



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-IELKRPNDSIYSFPCPDCMC  565
            +TIRP+ R L  LF N +IGW  F+  +L+   H + +G I L++ N SIY++P PDCMC
Sbjct  451  KTIRPNMRLLGQLFQNKSIGWSEFQLAVLD--GHKNRQGQIRLRKENQSIYTYPAPDCMC  508

Query  564  R  562
            R
Sbjct  509  R  509



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-IELKRPNDSIYSFPCPDCMC  565
            +TIRP+ R L  LF N +IGW  F+  +L+   H + +G I L++ N SIY++P PDCMC
Sbjct  452  KTIRPNMRLLGQLFQNKSIGWSEFQLAVLD--GHKNRQGQIRLRKENQSIYTYPAPDCMC  509

Query  564  R  562
            R
Sbjct  510  R  510



>ref|XP_010272863.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=587

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 41/75 (55%), Gaps = 5/75 (7%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGI-----ELKRPNDSIYSFPCP  577
            +TIRPDK KL +L  N +I WK FK  M  M   SD KGI     E +R   SIY++P P
Sbjct  506  KTIRPDKHKLVVLLHNTSISWKDFKEHMDEMLVDSDHKGITVPTTEKERKRSSIYAYPFP  565

Query  576  DCMCRLNKTKDSKLS  532
            +C C   +   S  S
Sbjct  566  ECRCLHGQQNSSVWS  580



>gb|KDO80742.1| hypothetical protein CISIN_1g047008mg [Citrus sinensis]
Length=227

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 6/75 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL LLF + NI W +FK QM  M + +D KGI + R        SIY++P P
Sbjct  148  KTINPDKRKLVLLFQDMNISWVTFKDQMEIMLSENDRKGIIVPRVRKINRKTSIYTYPLP  207

Query  576  DCMCRLNKTKDSKLS  532
            +C C L ++ ++ L 
Sbjct  208  ECRC-LQQSHNTTLQ  221



>ref|XP_010091349.1| hypothetical protein L484_020151 [Morus notabilis]
 gb|EXB44339.1| hypothetical protein L484_020151 [Morus notabilis]
Length=1270

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKR-----PNDSIYSFPCP  577
            RTI PDKRKL +L ++ NI W+ FK +M  M A SD KG+ + R        S+Y++P P
Sbjct  483  RTIIPDKRKLVVLLEDRNISWQGFKDEMEAMLAESDRKGMIIPRVKKINRKSSVYTYPLP  542

Query  576  DCMC  565
            +C C
Sbjct  543  ECSC  546



>ref|XP_004513833.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=580

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL +LF+N +I W  FK QM +M + SD KGI + R        S+Y++P P
Sbjct  492  KTIIPDKRKLVVLFENTSISWSVFKDQMDDMLSESDRKGIMVPRVRKINRKTSVYTYPLP  551

Query  576  DCMC  565
            +C C
Sbjct  552  ECRC  555



>ref|XP_007136337.1| hypothetical protein PHAVU_009G0371001g, partial [Phaseolus vulgaris]
 gb|ESW08331.1| hypothetical protein PHAVU_009G0371001g, partial [Phaseolus vulgaris]
Length=69

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-IELKRPNDSIYSFPCPDCMC  565
            +TIRP    L  LF N ++ W  F+R +L+   H + +G I L++   SIY++P PDCMC
Sbjct  10   KTIRPSMGSLGHLFQNKSVSWSEFQRVVLD--GHKNRQGQIRLRKEKQSIYTYPAPDCMC  67

Query  564  R  562
            R
Sbjct  68   R  68



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-IELKRPNDSIYSFPCPDCMC  565
            +TIRP+   L  LF N ++GW  F+R +L    H D +G I LK+   SIY++P PDCMC
Sbjct  454  KTIRPNMALLGQLFLNKSMGWSDFQRAVLE--GHKDRQGQIRLKKEKQSIYTYPAPDCMC  511

Query  564  RLNKTKD  544
            R + ++ 
Sbjct  512  RASTSRQ  518



>ref|XP_002513766.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48349.1| conserved hypothetical protein [Ricinus communis]
Length=591

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            RTI+PDKRKL +L  +  I WK+FK QM  M   SD KG+ + R        SIY +P P
Sbjct  504  RTIKPDKRKLVVLLQDMEISWKAFKDQMEIMLTESDRKGLLVPRVRKINRKTSIYMYPLP  563

Query  576  DCMCRLNKTKDSKLS  532
            +C C ++     KL+
Sbjct  564  ECGCLMSHNSSLKLT  578



>ref|XP_003614789.1| Growth regulator-related protein [Medicago truncatula]
 gb|AES97747.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=589

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 9/78 (12%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL +LF+N  I W + K QM +M + SD KGI + R        S+Y++P P
Sbjct  496  KTIIPDKRKLVVLFENTTISWSALKDQMDDMLSESDRKGIMVPRVRKINRKTSVYTYPLP  555

Query  576  DCMC----RLNKTKDSKL  535
            +C C     +NKT D  +
Sbjct  556  ECRCLQESLVNKTIDHNV  573



>ref|XP_006434133.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
 gb|ESR47373.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
Length=595

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL LLF + NI W +FK QM  M + +D KGI + R        SIY++P P
Sbjct  516  KTINPDKRKLVLLFQDMNISWVTFKDQMEIMLSENDRKGIMVPRVRKINRKTSIYTYPLP  575

Query  576  DCMCRLNKTKDSKL  535
            +C C L ++ ++ L
Sbjct  576  ECRC-LQQSHNTTL  588



>ref|XP_006434132.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
 gb|ESR47372.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
Length=529

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL LLF + NI W +FK QM  M + +D KGI + R        SIY++P P
Sbjct  450  KTINPDKRKLVLLFQDMNISWVTFKDQMEIMLSENDRKGIMVPRVRKINRKTSIYTYPLP  509

Query  576  DCMCRLNKTKDSKL  535
            +C C L ++ ++ L
Sbjct  510  ECRC-LQQSHNTTL  522



>ref|XP_006472723.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
Length=595

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL LLF + NI W +FK QM  M + +D KGI + R        SIY++P P
Sbjct  516  KTINPDKRKLVLLFQDMNISWVTFKDQMEIMLSENDRKGIIVPRVRKINRKTSIYTYPLP  575

Query  576  DCMCRLNKTKDSKL  535
            +C C L ++ ++ L
Sbjct  576  ECRC-LQQSHNTTL  588



>gb|KHN26036.1| DUF246 domain-containing protein, partial [Glycine soja]
Length=489

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL +L D+ +I W++FK QM +M   SD KGI + R        S+Y++P P
Sbjct  402  KTIIPDKRKLVVLLDDVSISWRAFKDQMEDMLTESDRKGIMVPRVRKINRKTSVYTYPLP  461

Query  576  DCMC  565
            +C C
Sbjct  462  ECRC  465



>ref|XP_006472724.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=529

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL LLF + NI W +FK QM  M + +D KGI + R        SIY++P P
Sbjct  450  KTINPDKRKLVLLFQDMNISWVTFKDQMEIMLSENDRKGIIVPRVRKINRKTSIYTYPLP  509

Query  576  DCMCRLNKTKDSKL  535
            +C C L ++ ++ L
Sbjct  510  ECRC-LQQSHNTTL  522



>ref|XP_010274355.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=599

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKR-----PNDSIYSFPCP  577
            +TIRPDKRKL +L  N +I WK FK  +  M   SD KGI + R        SIY++P P
Sbjct  510  KTIRPDKRKLVVLLHNTSISWKDFKVHVEEMLVESDRKGIMVPRMGQESKQTSIYAYPFP  569

Query  576  DCMCRLNKTKDSKLS  532
            +C C L+ +++  LS
Sbjct  570  ECRC-LHGSQNLTLS  583



>ref|XP_007141089.1| hypothetical protein PHAVU_008G166600g [Phaseolus vulgaris]
 gb|ESW13083.1| hypothetical protein PHAVU_008G166600g [Phaseolus vulgaris]
Length=582

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL +L D+ +I W++FK QM +M + SD KGI + R        S+Y++P P
Sbjct  495  KTIIPDKRKLVVLLDDLSISWRAFKDQMEDMLSESDRKGIMVPRVRKINRKTSVYTYPLP  554

Query  576  DCMC  565
            +C C
Sbjct  555  ECRC  558



>ref|XP_006596302.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=584

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI PDKRKL +L D+ +I W++FK QM +M   SD KGI + R        S+Y++P P
Sbjct  497  KTIIPDKRKLVVLLDDVSISWRAFKDQMEDMLTESDRKGIMVPRVRKINRKTSVYTYPLP  556

Query  576  DCMC  565
            +C C
Sbjct  557  ECRC  560



>emb|CBI19065.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-----IELKRPNDSIYSFPCP  577
            +TI+PDKRKL +L  + +I WK+FK +M +M   SD KG     I+  R   SIY++P P
Sbjct  496  KTIQPDKRKLVILLQDMDISWKAFKNEMESMLIESDRKGMNVPRIKKSRRKSSIYTYPLP  555

Query  576  DCMCRLNKTKDS  541
            +C C L     +
Sbjct  556  ECRCLLESQNST  567



>ref|XP_002284399.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=585

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIEL-----KRPNDSIYSFPCP  577
            +TI+PDKRKL +L  + +I WK+FK +M +M   SD KG+ +      R   SIY++P P
Sbjct  496  KTIQPDKRKLVILLQDMDISWKAFKNEMESMLIESDRKGMNVPRIKKSRRKSSIYTYPLP  555

Query  576  DCMCRLNKTKDS  541
            +C C L     +
Sbjct  556  ECRCLLESQNST  567



>ref|XP_010664246.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
Length=588

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIEL-----KRPNDSIYSFPCP  577
            +TI+PDKRKL +L  + +I WK+FK +M +M   SD KG+ +      R   SIY++P P
Sbjct  499  KTIQPDKRKLVILLQDMDISWKAFKNEMESMLIESDRKGMNVPRIKKSRRKSSIYTYPLP  558

Query  576  DCMCRLNKTKDS  541
            +C C L     +
Sbjct  559  ECRCLLESQNST  570



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-IELKRPNDSIYSFPCPDCMC  565
            +TIRP+   L  LF N +IGW  F+R +L+   H + +G I L++   SIY++P PDCMC
Sbjct  458  KTIRPNMALLGQLFQNKSIGWSDFQRAVLD--GHKNRQGQIRLRKEKQSIYTYPAPDCMC  515

Query  564  R  562
            R
Sbjct  516  R  516



>gb|KJB59186.1| hypothetical protein B456_009G243300 [Gossypium raimondii]
Length=435

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 5/64 (8%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKGIELKRP-----NDSIYSFPCP  577
            +TI+PDKRKL +L  + +I WK+FK +M  M A SD KG+ + R        SIY++P P
Sbjct  346  KTIKPDKRKLVVLLQDMDISWKAFKDEMEVMLAESDRKGMMVPRVKKFNRKTSIYTYPLP  405

Query  576  DCMC  565
            +C C
Sbjct  406  ECAC  409



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -1

Query  741  RTIRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDSKG-IELKRPNDSIYSFPCPDCMC  565
            +TIRP    L  LF N +IGW  F+R +L+   H + +G I L++   SIY++P PDCMC
Sbjct  452  KTIRPSMGLLGQLFQNKSIGWSEFQRAILD--GHKNRQGQIRLRKEKQSIYTYPAPDCMC  509

Query  564  R  562
            R
Sbjct  510  R  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210