BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015M06

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    230   1e-66   Solanum lycopersicum
ref|XP_006439905.1|  hypothetical protein CICLE_v10019394mg             223   2e-66   
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    229   3e-66   Solanum tuberosum [potatoes]
ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   3e-66   Sesamum indicum [beniseed]
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   6e-66   Sesamum indicum [beniseed]
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-65   Nicotiana tomentosiformis
gb|KDO69502.1|  hypothetical protein CISIN_1g013176mg                   221   3e-65   Citrus sinensis [apfelsine]
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   4e-65   Nicotiana sylvestris
emb|CDP12744.1|  unnamed protein product                                223   4e-64   Coffea canephora [robusta coffee]
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg             221   7e-64   Citrus clementina [clementine]
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    221   1e-63   Citrus sinensis [apfelsine]
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g             218   1e-62   Phaseolus vulgaris [French bean]
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                  215   5e-62   Glycine soja [wild soybean]
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    218   6e-62   Vitis vinifera
gb|KDP31038.1|  hypothetical protein JCGZ_11414                         216   8e-62   Jatropha curcas
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                   216   8e-62   Chorispora bungeana
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    216   1e-61   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                          216   1e-61   Brassica napus [oilseed rape]
emb|CDY48128.1|  BnaCnng15700D                                          215   1e-61   Brassica napus [oilseed rape]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg             215   1e-61   Eutrema salsugineum [saltwater cress]
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                  214   1e-61   Glycine soja [wild soybean]
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g             215   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    216   2e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    215   3e-61   
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    215   3e-61   Populus euphratica
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...    213   4e-61   
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...    214   4e-61   
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   8e-61   Glycine max [soybeans]
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   9e-61   Prunus mume [ume]
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg             214   1e-60   Prunus persica
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   1e-60   Populus euphratica
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   1e-60   Camelina sativa [gold-of-pleasure]
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein        213   2e-60   Medicago truncatula
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein                211   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30                211   4e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                    211   5e-60   Arabis alpina [alpine rockcress]
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg             211   5e-60   Capsella rubella
ref|XP_006845267.1|  hypothetical protein AMTR_s00005p00263980          212   6e-60   Amborella trichopoda
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494             210   1e-59   
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg                210   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    211   1e-59   Cicer arietinum [garbanzo]
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20             210   2e-59   Morus notabilis
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    208   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    209   6e-59   
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    210   6e-59   Nelumbo nucifera [Indian lotus]
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    209   1e-58   Phoenix dactylifera
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   2e-58   Fragaria vesca subsp. vesca
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   3e-58   Pyrus x bretschneideri [bai li]
gb|KJB40103.1|  hypothetical protein B456_007G047000                    207   3e-58   Gossypium raimondii
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    206   3e-58   Pyrus x bretschneideri [bai li]
emb|CAA09209.1|  RNA helicase                                           194   9e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    206   1e-57   Elaeis guineensis
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    206   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   2e-57   Cucumis sativus [cucumbers]
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   3e-57   Eucalyptus grandis [rose gum]
gb|EPS60527.1|  hypothetical protein M569_14276                         194   4e-57   Genlisea aurea
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    203   5e-57   Cucumis melo [Oriental melon]
ref|XP_006385358.1|  DEAD box RNA helicase family protein               200   1e-56   
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    199   3e-56   Populus euphratica
gb|ABR16327.1|  unknown                                                 198   5e-56   Picea sitchensis
gb|KHN39300.1|  DEAD-box ATP-dependent RNA helicase 20                  197   6e-56   Glycine soja [wild soybean]
gb|ACN39916.1|  unknown                                                 199   8e-56   Picea sitchensis
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   1e-55   Cicer arietinum [garbanzo]
ref|XP_006392681.1|  hypothetical protein EUTSA_v10011413mg             196   1e-55   Eutrema salsugineum [saltwater cress]
ref|XP_006426523.1|  hypothetical protein CICLE_v10025421mg             197   1e-55   
gb|KDO65284.1|  hypothetical protein CISIN_1g010649mg                   197   1e-55   Citrus sinensis [apfelsine]
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   2e-55   Glycine max [soybeans]
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg             197   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_003529884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   2e-55   Glycine max [soybeans]
ref|XP_007135556.1|  hypothetical protein PHAVU_010G139400g             197   2e-55   Phaseolus vulgaris [French bean]
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_006426526.1|  hypothetical protein CICLE_v10025421mg             196   3e-55   
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                   196   4e-55   Citrus sinensis [apfelsine]
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                   196   4e-55   Citrus sinensis [apfelsine]
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003531619.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   4e-55   Glycine max [soybeans]
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   4e-55   Citrus sinensis [apfelsine]
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   4e-55   Citrus sinensis [apfelsine]
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg             196   4e-55   Citrus clementina [clementine]
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg             196   4e-55   Citrus clementina [clementine]
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   5e-55   
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative      196   6e-55   Ricinus communis
gb|KHG24204.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein    196   6e-55   Gossypium arboreum [tree cotton]
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   6e-55   Camelina sativa [gold-of-pleasure]
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                    195   7e-55   Eucalyptus grandis [rose gum]
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700          195   7e-55   Amborella trichopoda
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    196   7e-55   Cucumis melo [Oriental melon]
gb|KJB70270.1|  hypothetical protein B456_011G066000                    195   9e-55   Gossypium raimondii
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   9e-55   Cucumis sativus [cucumbers]
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   1e-54   Prunus mume [ume]
ref|XP_008228303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   1e-54   Prunus mume [ume]
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   1e-54   Camelina sativa [gold-of-pleasure]
gb|KDP40778.1|  hypothetical protein JCGZ_24777                         195   1e-54   Jatropha curcas
gb|KHF98903.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein    195   1e-54   Gossypium arboreum [tree cotton]
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    196   1e-54   
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   1e-54   Eucalyptus grandis [rose gum]
ref|NP_001105241.1|  DEAD box RNA helicase1                             196   1e-54   
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   2e-54   Setaria italica
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   2e-54   Malus domestica [apple tree]
gb|KJB56890.1|  hypothetical protein B456_009G140700                    194   2e-54   Gossypium raimondii
gb|EEE54050.1|  hypothetical protein OsJ_00740                          194   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   2e-54   Pyrus x bretschneideri [bai li]
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20                194   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EEC70110.1|  hypothetical protein OsI_00766                          194   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_007215261.1|  hypothetical protein PRUPE_ppa004545mg             194   2e-54   Prunus persica
ref|XP_010106662.1|  DEAD-box ATP-dependent RNA helicase 20             194   2e-54   
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   2e-54   
gb|AFK42127.1|  unknown                                                 194   2e-54   Medicago truncatula
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase                194   2e-54   Medicago truncatula
ref|XP_006645603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   3e-54   Oryza brachyantha
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   3e-54   Nelumbo nucifera [Indian lotus]
gb|KJB56888.1|  hypothetical protein B456_009G140700                    194   3e-54   Gossypium raimondii
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    195   4e-54   Setaria italica
sp|Q5QMN3.2|RH20_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    193   4e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008805786.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   4e-54   Phoenix dactylifera
ref|XP_010242202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   4e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   4e-54   
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   5e-54   Fragaria vesca subsp. vesca
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein           193   5e-54   
ref|XP_002279117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   6e-54   Vitis vinifera
ref|XP_008805785.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   6e-54   Phoenix dactylifera
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570             192   8e-54   
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    194   8e-54   
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450          194   8e-54   Sorghum bicolor [broomcorn]
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    192   8e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001142117.1|  uncharacterized protein LOC100274281               192   1e-53   Zea mays [maize]
emb|CDO97919.1|  unnamed protein product                                192   1e-53   Coffea canephora [robusta coffee]
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_010314157.1|  PREDICTED: ethylene-responsive RNA helicase ...    192   2e-53   
ref|XP_009625322.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    192   2e-53   Nicotiana tomentosiformis
ref|XP_011072507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    192   2e-53   Sesamum indicum [beniseed]
emb|CDY02459.1|  BnaA08g00660D                                          191   2e-53   
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   2e-53   Solanum tuberosum [potatoes]
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   2e-53   Brassica rapa
ref|XP_001763089.1|  predicted protein                                  191   3e-53   
ref|XP_003564953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   3e-53   Brachypodium distachyon [annual false brome]
emb|CDY10596.1|  BnaC03g70180D                                          191   3e-53   Brassica napus [oilseed rape]
emb|CDM81540.1|  unnamed protein product                                191   4e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010534903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   5e-53   Tarenaya hassleriana [spider flower]
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                  192   5e-53   Triticum urartu
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                    190   6e-53   Arabis alpina [alpine rockcress]
emb|CDM85602.1|  unnamed protein product                                192   6e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010915213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   7e-53   Elaeis guineensis
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg             190   1e-52   Capsella rubella
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   1e-52   Tarenaya hassleriana [spider flower]
gb|AAG51573.1|AC027034_19  RNA helicase, 5' partial; 101954-101280      180   1e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD82427.1|  putative DEAD box RNA helicase                         191   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009802114.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Nicotiana sylvestris
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    191   3e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg                188   5e-52   Erythranthe guttata [common monkey flower]
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                  186   2e-51   Triticum urartu
gb|EMT09661.1|  DEAD-box ATP-dependent RNA helicase 20                  184   2e-51   
dbj|BAD73320.1|  putative ethylene-responsive RNA helicase              186   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005850349.1|  hypothetical protein CHLNCDRAFT_30080              186   6e-51   Chlorella variabilis
ref|NP_001234650.1|  ethylene-responsive RNA helicase                   182   3e-50   
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342             182   1e-49   
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552              182   2e-49   
ref|XP_002455005.1|  hypothetical protein SORBIDRAFT_03g002860          181   2e-49   
emb|CDI80731.1|  hypothetical protein, conserved                        171   1e-48   Eimeria acervulina
gb|KFG62415.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17               167   3e-47   Toxoplasma gondii RUB
emb|CAA09215.1|  RNA helicase                                           168   7e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002776976.1|  helicase, putative                                 164   2e-46   Perkinsus marinus ATCC 50983
ref|XP_005650016.1|  DEAD-box RNA helicase                              172   3e-46   Coccomyxa subellipsoidea C-169
emb|CCF73942.1|  unnamed protein product                                172   7e-46   Babesia microti strain RI
ref|XP_002780686.1|  DEAD box ATP-dependent RNA helicase, putative      163   7e-46   Perkinsus marinus ATCC 50983
ref|XP_004831007.1|  DEAD box ATP-dependent RNA helicase family m...    169   5e-45   Theileria equi strain WA
ref|XP_764197.1|  RNA helicase                                          169   1e-44   Theileria parva strain Muguga
ref|XP_009692285.1|  DEAD-box family RNA-dependent helicase             168   3e-44   Theileria orientalis strain Shintoku
ref|XP_953213.1|  DEAD-box family RNA-dependent helicase                168   3e-44   Theileria annulata
ref|XP_003884670.1|  hypothetical protein NCLIV_050680                  167   5e-44   Neospora caninum Liverpool
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative           168   5e-44   Acanthamoeba castellanii str. Neff
ref|XP_001690022.1|  DEAD-box RNA helicase                              166   6e-44   Chlamydomonas reinhardtii
ref|XP_008885470.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17          166   7e-44   
gb|EPR60274.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17               166   8e-44   Toxoplasma gondii GT1
ref|XP_002369028.1|  DEAD/DEAH box helicase, putative                   166   8e-44   Toxoplasma gondii ME49
ref|XP_002774608.1|  RNA helicase, putative                             166   9e-44   Perkinsus marinus ATCC 50983
ref|XP_002777393.1|  RNA helicase, putative                             166   9e-44   Perkinsus marinus ATCC 50983
ref|XP_002777392.1|  RNA helicase, putative                             166   1e-43   Perkinsus marinus ATCC 50983
ref|XP_002771918.1|  RNA helicase, putative                             165   2e-43   Perkinsus marinus ATCC 50983
dbj|BAN64363.1|  p68-like protein                                       160   2e-43   Babesia bovis
gb|KDP40781.1|  hypothetical protein JCGZ_24780                         162   3e-43   Jatropha curcas
gb|KHN25107.1|  DEAD-box ATP-dependent RNA helicase 20                  161   4e-43   Glycine soja [wild soybean]
emb|CDR95325.1|  p68-like protein, putative                             164   5e-43   Babesia bigemina
gb|KIZ00407.1|  ATP-dependent RNA helicase DDX5/DBP2                    164   6e-43   Monoraphidium neglectum
emb|CDJ62108.1|  MGC53795 protein, related                              155   3e-42   Eimeria necatrix
ref|XP_002955411.1|  DEAD-box RNA helicase, ATP-dependent               162   3e-42   Volvox carteri f. nagariensis
ref|XP_001609970.1|  p68-like protein                                   160   7e-42   Babesia bovis T2Bo
gb|ETW56550.1|  hypothetical protein PFUGPA_01340                       152   1e-41   Plasmodium falciparum Palo Alto/Uganda
ref|XP_003032253.1|  hypothetical protein SCHCODRAFT_82297              159   2e-41   Schizophyllum commune H4-8
ref|XP_736707.1|  helicase                                              150   2e-41   
ref|XP_744215.1|  helicase                                              151   4e-41   
ref|XP_006521353.1|  PREDICTED: probable ATP-dependent RNA helica...    155   1e-40   Mus musculus [mouse]
gb|KJA13443.1|  hypothetical protein HYPSUDRAFT_73013                   157   1e-40   Hypholoma sublateritium FD-334 SS-4
ref|XP_678450.1|  helicase                                              150   1e-40   
gb|EGN99017.1|  hypothetical protein SERLA73DRAFT_137127                153   2e-40   Serpula lacrymans var. lacrymans S7.3
gb|KIM84767.1|  hypothetical protein PILCRDRAFT_96565                   156   2e-40   Piloderma croceum F 1598
emb|CCM04686.1|  predicted protein                                      158   2e-40   Fibroporia radiculosa
gb|EXX56938.1|  Dbp2p                                                   157   3e-40   Rhizophagus irregularis DAOM 197198w
ref|XP_006958620.1|  p68 RNA helicase                                   156   3e-40   Wallemia mellicola CBS 633.66
ref|XP_729738.1|  hypothetical protein                                  149   3e-40   
ref|XP_007330446.1|  hypothetical protein AGABI1DRAFT_100622            155   4e-40   Agaricus bisporus var. burnettii JB137-S8
ref|XP_006459201.1|  hypothetical protein AGABI2DRAFT_65810             155   4e-40   Agaricus bisporus var. bisporus H97
gb|KDQ24573.1|  hypothetical protein PLEOSDRAFT_1090372                 155   4e-40   Pleurotus ostreatus PC15
ref|XP_008039863.1|  DEAD-domain-containing protein                     155   4e-40   Trametes versicolor FP-101664 SS1
ref|XP_002140793.1|  DEAD/DEAH box helicase family protein              156   4e-40   Cryptosporidium muris RN66
ref|XP_007008272.1|  hypothetical protein TREMEDRAFT_46029              155   5e-40   Tremella mesenterica DSM 1558
gb|KIK57769.1|  hypothetical protein GYMLUDRAFT_45959                   155   6e-40   Gymnopus luxurians FD-317 M1
ref|XP_007370735.1|  DEAD-domain-containing protein                     155   6e-40   Dichomitus squalens LYAD-421 SS1
ref|XP_007414813.1|  hypothetical protein MELLADRAFT_78893              155   6e-40   Melampsora larici-populina 98AG31
gb|KIM24458.1|  hypothetical protein M408DRAFT_75932                    155   7e-40   Serendipita vermifera MAFF 305830
gb|KIM40445.1|  hypothetical protein M413DRAFT_73199                    154   8e-40   Hebeloma cylindrosporum h7
gb|KII89609.1|  hypothetical protein PLICRDRAFT_158683                  154   9e-40   Plicaturopsis crispa FD-325 SS-3
gb|KGB75854.1|  ATP-dependent RNA helicase DBP2-A                       155   9e-40   Cryptococcus gattii VGII R265
gb|KIR99876.1|  ATP-dependent RNA helicase DBP2-A                       155   1e-39   Cryptococcus gattii VGII 2001/935-1
gb|KIR72047.1|  ATP-dependent RNA helicase DBP2-A                       155   1e-39   Cryptococcus gattii VGII CA1014
gb|EMS23120.1|  ATP-dependent rna helicase dbp2                         155   1e-39   Rhodotorula toruloides NP11
ref|XP_003745440.1|  PREDICTED: probable ATP-dependent RNA helica...    154   1e-39   Galendromus occidentalis
gb|KIK28896.1|  hypothetical protein PISMIDRAFT_90259                   154   1e-39   Pisolithus microcarpus 441
gb|KFP69316.1|  putative ATP-dependent RNA helicase DDX17               152   2e-39   Acanthisitta chloris
gb|EJU04549.1|  DEAD-domain-containing protein                          153   2e-39   Dacryopinax primogenitus
gb|EDM15798.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...    154   2e-39   Rattus norvegicus [brown rat]
gb|KIL67445.1|  hypothetical protein M378DRAFT_159266                   154   2e-39   Amanita muscaria Koide BX008
ref|XP_004224073.1|  helicase                                           153   3e-39   Plasmodium cynomolgi strain B
ref|XP_007318616.1|  hypothetical protein SERLADRAFT_449372             153   3e-39   Serpula lacrymans var. lacrymans S7.9
ref|XP_002769661.1|  RNA-dependent helicase, putative                   150   3e-39   Perkinsus marinus ATCC 50983
ref|XP_004563118.1|  PREDICTED: probable ATP-dependent RNA helica...    153   3e-39   
ref|NP_001082679.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17             154   3e-39   Xenopus laevis [clawed frog]
ref|XP_009073300.1|  PREDICTED: probable ATP-dependent RNA helica...    153   3e-39   Acanthisitta chloris
dbj|BAE87553.1|  unnamed protein product                                151   3e-39   Macaca fascicularis [crab eating macaque]
gb|EAW60248.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...    153   3e-39   Homo sapiens [man]
ref|XP_004700310.1|  PREDICTED: probable ATP-dependent RNA helica...    154   3e-39   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009436590.1|  PREDICTED: probable ATP-dependent RNA helica...    153   3e-39   
ref|XP_004610567.1|  PREDICTED: probable ATP-dependent RNA helica...    153   3e-39   Sorex araneus [Eurasian shrew]
ref|XP_006174954.1|  PREDICTED: probable ATP-dependent RNA helica...    153   3e-39   
ref|XP_010565532.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Haliaeetus leucocephalus
ref|XP_001880766.1|  predicted protein                                  153   4e-39   Laccaria bicolor S238N-H82
ref|XP_009880187.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Charadrius vociferus
ref|XP_004311417.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   
ref|XP_008067650.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Carlito syrichta
ref|XP_010341891.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Saimiri boliviensis boliviensis
gb|EMC76814.1|  putative ATP-dependent RNA helicase DDX17               152   4e-39   
ref|XP_010013794.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Nestor notabilis
ref|XP_008634834.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   
gb|KIJ66791.1|  hypothetical protein HYDPIDRAFT_180508                  153   4e-39   Hydnomerulius pinastri MD-312
ref|XP_010145760.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Eurypyga helias
ref|XP_006259008.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Alligator mississippiensis
ref|XP_009481222.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Pelecanus crispus
ref|XP_009805513.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Gavia stellata
ref|XP_006029913.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Alligator sinensis
ref|XP_009951301.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Leptosomus discolor
gb|ETE72827.1|  putative ATP-dependent RNA helicase DDX17               153   4e-39   Ophiophagus hannah
ref|XP_008939400.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Merops nubicus
ref|XP_009584901.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Fulmarus glacialis
ref|XP_009566745.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-39   Cuculus canorus
ref|XP_005940780.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Haplochromis burtoni
gb|EOB03912.1|  Putative ATP-dependent RNA helicase DDX17               153   4e-39   Anas platyrhynchos [duck]
ref|XP_010132422.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Buceros rhinoceros silvestris
ref|XP_416260.2|  PREDICTED: probable ATP-dependent RNA helicase ...    154   4e-39   Gallus gallus [bantam]
ref|XP_006865247.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Chrysochloris asiatica
ref|XP_005737995.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   
ref|XP_008494759.1|  PREDICTED: probable ATP-dependent RNA helica...    154   4e-39   Calypte anna
ref|XP_006865246.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   Chrysochloris asiatica
ref|XP_005150407.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    154   5e-39   Melopsittacus undulatus
ref|XP_004563117.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_010126497.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   Chlamydotis macqueenii
ref|XP_005354345.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   Microtus ochrogaster [prairie voles]
ref|XP_005514775.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   Columba livia [carrier pigeon]
ref|XP_008565102.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005488678.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   
ref|XP_005488677.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   Zonotrichia albicollis
ref|XP_005232953.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   Falco peregrinus [peregrine]
ref|XP_008565101.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005527672.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   
ref|XP_005446839.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   
ref|XP_010710490.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   
ref|XP_009330949.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_010185205.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_009085184.1|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   
ref|XP_010288347.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
gb|KFO61287.1|  putative ATP-dependent RNA helicase DDX17               152   5e-39   
gb|KFQ42674.1|  putative ATP-dependent RNA helicase DDX17               152   5e-39   
ref|XP_002195734.2|  PREDICTED: probable ATP-dependent RNA helica...    154   5e-39   
ref|XP_005737994.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_774668.1|  hypothetical protein CNBF3470                         153   5e-39   
ref|XP_008929884.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|NP_001035277.1|  probable ATP-dependent RNA helicase DDX17 is...    153   5e-39   
ref|XP_004650369.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|NP_951062.1|  probable ATP-dependent RNA helicase DDX17 isofo...    153   5e-39   
ref|XP_004563116.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_005302557.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_004650368.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
gb|KFO81715.1|  putative ATP-dependent RNA helicase DDX17               152   5e-39   
ref|XP_009502718.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
gb|AAD38874.1|AF110007_1  p68 RNA helicase                              153   5e-39   
gb|KFV68880.1|  putative ATP-dependent RNA helicase DDX17               152   5e-39   
ref|XP_010225318.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
ref|XP_003194936.1|  ATP-dependent RNA helicase DBP2 (p68-like pr...    153   5e-39   
ref|XP_774667.1|  hypothetical protein CNBF3470                         153   5e-39   
ref|XP_010168247.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
gb|KFZ49707.1|  putative ATP-dependent RNA helicase DDX17               152   5e-39   
ref|XP_009979992.1|  PREDICTED: probable ATP-dependent RNA helica...    153   5e-39   
gb|KFP74117.1|  putative ATP-dependent RNA helicase DDX17               152   5e-39   
ref|XP_010408888.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_009863069.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KFO95968.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_008142844.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_008142845.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_001615932.1|  helicase                                           152   6e-39   
gb|KGL73587.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_009924066.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_010307626.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_009933308.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KIY52138.1|  DEAD-domain-containing protein                          152   6e-39   
ref|XP_010208864.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    153   6e-39   
ref|XP_007622847.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_005883260.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_006752810.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KFW90864.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_007622846.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_008849476.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_007939858.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_005883259.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_009900873.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_008849475.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_007939857.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KFO06156.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_004373916.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_571268.1|  p68-like protein                                      152   6e-39   
gb|AFR96168.2|  ATP-dependent RNA helicase DBP2-A                       152   6e-39   
gb|KFQ18808.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
gb|KFZ60114.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_003264799.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KIR63992.1|  ATP-dependent RNA helicase DBP2-A                       152   6e-39   
gb|KIR45452.1|  ATP-dependent RNA helicase DBP2-A                       152   6e-39   
ref|XP_003514725.2|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_009972429.1|  PREDICTED: probable ATP-dependent RNA helica...    152   6e-39   
ref|XP_003227208.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_010004139.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_003964460.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_007652929.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_005040018.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_010085938.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KFO88513.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_005567355.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
gb|KFP10244.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
gb|KFQ23731.1|  putative ATP-dependent RNA helicase DDX17               152   6e-39   
ref|XP_005567354.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_009646040.1|  PREDICTED: probable ATP-dependent RNA helica...    153   6e-39   
ref|XP_571269.1|  p68-like protein                                      152   6e-39   
ref|XP_007189120.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006979214.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|KFV60123.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
ref|XP_007189119.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006979213.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_003321253.2|  hypothetical protein PGTG_02295                    152   7e-39   
ref|XP_006890184.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|AAP88874.1|  DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17, ...    153   7e-39   
ref|XP_006890183.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|KFQ77919.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
gb|KFV00645.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
ref|XP_008255265.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|KFP59950.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
gb|KFP53210.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
ref|XP_006675622.1|  hypothetical protein BATDEDRAFT_29115              152   7e-39   
ref|XP_009473564.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    153   7e-39   
gb|KFQ57153.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
ref|XP_007519377.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006155420.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_007519378.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_008977411.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006155419.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_007099364.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    153   7e-39   
gb|KFV75709.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
ref|XP_001092491.2|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_008977406.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|KGL90702.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
gb|KFR10998.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
gb|KFP37484.1|  putative ATP-dependent RNA helicase DDX17               152   7e-39   
ref|XP_004883536.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_003821639.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_010871155.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|KIR86321.1|  ATP-dependent RNA helicase DBP2-A                       152   7e-39   
ref|XP_007503261.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_005379316.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_003470541.2|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_004883535.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_005016061.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_005379315.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_005003904.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_008067649.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_004675717.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
gb|EUC64866.1|  ATP-dependent RNA helicase DBP2                         152   7e-39   
ref|XP_006071393.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006914795.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_004485165.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    153   7e-39   
ref|XP_008067648.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_004675716.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006071392.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_004410825.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_006102491.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_003783252.1|  PREDICTED: probable ATP-dependent RNA helica...    153   7e-39   
ref|XP_011476809.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
gb|KFM02164.1|  putative ATP-dependent RNA helicase DDX17               152   8e-39   
ref|XP_005322311.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|NP_001095463.1|  probable ATP-dependent RNA helicase DDX17          153   8e-39   
ref|XP_003126098.2|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|XP_005322310.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|XP_007111784.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
gb|KFR08900.1|  putative ATP-dependent RNA helicase DDX17               152   8e-39   
ref|XP_004589558.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
gb|KFQ80585.1|  putative ATP-dependent RNA helicase DDX17               152   8e-39   
ref|XP_004279534.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|XP_004589559.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|NP_001016781.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17             152   8e-39   
ref|XP_010597633.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   
ref|XP_007910174.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|XP_002260414.1|  helicase                                           152   8e-39   
ref|XP_005994328.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|XP_008849477.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|XP_005994327.1|  PREDICTED: probable ATP-dependent RNA helica...    153   8e-39   
ref|NP_006377.2|  probable ATP-dependent RNA helicase DDX17 isofo...    153   9e-39   
ref|NP_001091974.1|  probable ATP-dependent RNA helicase DDX17 is...    153   1e-38   
ref|XP_005606692.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|EMD33314.1|  hypothetical protein CERSUDRAFT_117934                  152   1e-38   
gb|AAD38876.1|AF110008_1  p68 RNA helicase                              152   1e-38   
ref|XP_006119019.1|  PREDICTED: probable ATP-dependent RNA helica...    153   1e-38   
dbj|BAD92832.1|  DEAD box polypeptide 17 isoform p82 variant            153   1e-38   
gb|ELR53727.1|  Putative ATP-dependent RNA helicase DDX17               153   1e-38   
ref|XP_008814168.1|  hypothetical protein C922_00329                    152   1e-38   
gb|KIY68841.1|  DEAD-domain-containing protein                          151   1e-38   
ref|XP_007069155.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    153   1e-38   
ref|XP_005681228.1|  PREDICTED: probable ATP-dependent RNA helica...    153   1e-38   
gb|EHH65839.1|  hypothetical protein EGM_02689                          153   1e-38   
emb|CDO66924.1|  DEAD/DEAH box ATP-dependent RNA helicase, putative     152   1e-38   
ref|XP_008509242.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009288378.1|  PREDICTED: probable ATP-dependent RNA helica...    153   1e-38   
ref|XP_008509240.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
emb|CAF95263.1|  unnamed protein product                                151   1e-38   
ref|XP_007867458.1|  DEAD-domain-containing protein                     151   1e-38   
ref|XP_009336746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    143   1e-38   
ref|XP_004743517.1|  PREDICTED: probable ATP-dependent RNA helica...    153   1e-38   
ref|XP_010225455.1|  PREDICTED: probable ATP-dependent RNA helica...    143   1e-38   
ref|XP_002914626.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    153   1e-38   
ref|XP_003771058.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_001348611.2|  helicase, putative                                 151   2e-38   
ref|XP_668411.1|  RNA-dependent helicase                                150   2e-38   
emb|CEJ03535.1|  Putative ATP-dependent RNA helicase dbp2 (Fragment)    144   2e-38   
gb|KDE07270.1|  ATP-dependent RNA helicase                              151   2e-38   
ref|XP_004007674.1|  PREDICTED: probable ATP-dependent RNA helica...    153   2e-38   
emb|CCA74151.1|  probable RNA helicase dbp2 (DEAD box protein)          151   2e-38   
gb|ETW58420.1|  hypothetical protein PFMC_05521                         151   2e-38   
ref|XP_010746314.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_860668.3|  PREDICTED: probable ATP-dependent RNA helicase ...    153   2e-38   
ref|XP_008294587.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007393238.1|  hypothetical protein PHACADRAFT_251816             151   2e-38   
gb|AAI34864.1|  LOC556764 protein                                       151   2e-38   
ref|XP_002402985.1|  ATP-dependent RNA helicase, putative               150   2e-38   
gb|AAI54494.1|  LOC556764 protein                                       151   2e-38   
gb|AAI17661.1|  LOC556764 protein                                       151   2e-38   
ref|XP_003321244.1|  hypothetical protein PGTG_02286                    151   2e-38   
ref|XP_006798015.1|  PREDICTED: probable ATP-dependent RNA helica...    151   2e-38   
ref|XP_007920211.1|  hypothetical protein MYCFIDRAFT_58038              150   2e-38   
emb|CCF44879.1|  ATP-dependent RNA helicase dbp2                        145   2e-38   
ref|XP_010895018.1|  PREDICTED: probable ATP-dependent RNA helica...    151   2e-38   
dbj|GAA97124.1|  hypothetical protein E5Q_03800                         151   2e-38   
ref|XP_009663625.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_003428757.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    153   2e-38   
gb|EPS96727.1|  hypothetical protein FOMPIDRAFT_1025306                 151   2e-38   
ref|XP_006934164.2|  PREDICTED: probable ATP-dependent RNA helica...    153   2e-38   
ref|XP_009545234.1|  hypothetical protein HETIRDRAFT_439534             151   3e-38   
gb|EMP27021.1|  Putative ATP-dependent RNA helicase DDX17               154   3e-38   
ref|XP_010764560.1|  PREDICTED: probable ATP-dependent RNA helica...    151   3e-38   
ref|NP_001267194.1|  probable ATP-dependent RNA helicase DDX17          151   3e-38   
ref|XP_010895017.1|  PREDICTED: probable ATP-dependent RNA helica...    151   3e-38   
ref|XP_007231410.1|  PREDICTED: probable ATP-dependent RNA helica...    151   3e-38   
ref|XP_006790684.1|  PREDICTED: probable ATP-dependent RNA helica...    150   3e-38   
ref|XP_004787459.1|  PREDICTED: probable ATP-dependent RNA helica...    153   4e-38   
ref|XP_005421988.1|  PREDICTED: probable ATP-dependent RNA helica...    152   4e-38   
gb|KGK38084.1|  hypothetical protein JL09_g2718                         149   4e-38   
ref|XP_008407161.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
ref|XP_007543657.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
ref|XP_007299379.1|  DEAD-domain-containing protein                     150   5e-38   
ref|XP_001388195.1|  hypothetical protein                               150   5e-38   
ref|XP_007262740.1|  DEAD-domain-containing protein                     150   5e-38   
ref|XP_001923830.1|  PREDICTED: probable ATP-dependent RNA helica...    151   5e-38   
gb|KIK77836.1|  hypothetical protein PAXRUDRAFT_165607                  149   5e-38   
gb|KFO36677.1|  Putative ATP-dependent RNA helicase DDX17               154   5e-38   
ref|XP_003453852.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
ref|XP_008278145.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
ref|XP_003443250.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
ref|XP_005468481.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
emb|CEL55341.1|  ATP-dependent RNA helicase DDX5/DBP2                   150   5e-38   



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FKSGRSP+
Sbjct  469  LKEVMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKSGRSPI  528

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAKF R
Sbjct  529  MIATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKFTR  588

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+KILQQAGQIVPPQLSALA
Sbjct  589  ELIKILQQAGQIVPPQLSALA  609



>ref|XP_006439905.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53145.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=389

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+
Sbjct  207  LKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPI  266

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR
Sbjct  267  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFAR  326

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
            +L+KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+K
Sbjct  327  DLIKILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSK  386

Query  249  RHW  241
            R W
Sbjct  387  RLW  389



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FK+GRSP+
Sbjct  467  LKEVMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKTGRSPI  526

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTA+TFFTH NAKF R
Sbjct  527  MIATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAYTFFTHANAKFTR  586

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+KILQQAGQIVPPQLSALA
Sbjct  587  ELIKILQQAGQIVPPQLSALA  607



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK+VMDGS+ILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+
Sbjct  418  LKDVMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKTGRSPI  477

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR
Sbjct  478  MIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYAR  537

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQQAGQ+VPPQL+ALA
Sbjct  538  DLIKILQQAGQVVPPQLAALA  558



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK+VMDGS+ILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+
Sbjct  444  LKDVMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKTGRSPI  503

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR
Sbjct  504  MIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYAR  563

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQQAGQ+VPPQL+ALA
Sbjct  564  DLIKILQQAGQVVPPQLAALA  584



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE+MDGSRILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+
Sbjct  467  LKEMMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKNGRSPI  526

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R
Sbjct  527  MIATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTR  586

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQQAGQIVPPQLSALA
Sbjct  587  QLIKILQQAGQIVPPQLSALA  607



>gb|KDO69502.1| hypothetical protein CISIN_1g013176mg [Citrus sinensis]
Length=448

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+
Sbjct  266  LKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPI  325

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR
Sbjct  326  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFAR  385

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
            +L+KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+K
Sbjct  386  DLIKILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSK  445

Query  249  RHW  241
            R W
Sbjct  446  RLW  448



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE+MDGSRILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+
Sbjct  467  LKEMMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKNGRSPI  526

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCV+NYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R
Sbjct  527  MIATDVAARGLDVKDIKCVVNYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTR  586

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQQAGQIVPPQLSALA
Sbjct  587  QLIKILQQAGQIVPPQLSALA  607



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FKSGR+P+
Sbjct  445  LKEVMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKSGRNPI  504

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH NAKFAR
Sbjct  505  MIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANAKFAR  564

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            +L+KIL+ AGQI+PP LSA+A     S+ G N       G      ISGSNT+PLGAK+ 
Sbjct  565  DLIKILRDAGQIIPPDLSAMAR-STGSTMGGNNFRSRGRGGFGNRGISGSNTIPLGAKKP  623

Query  243  W  241
            W
Sbjct  624  W  624



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+
Sbjct  417  LKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPI  476

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR
Sbjct  477  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFAR  536

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
            +L+KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+K
Sbjct  537  DLIKILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSK  596

Query  249  RHW  241
            R W
Sbjct  597  RLW  599



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+
Sbjct  417  LKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPI  476

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR
Sbjct  477  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFAR  536

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
            +L+KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R SISGSNT+PLG+K
Sbjct  537  DLIKILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSISGSNTIPLGSK  596

Query  249  RHW  241
            R W
Sbjct  597  RLW  599



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSR+LIF+ETKKGCDQ+TRQ+RMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  418  LKEVMDGSRVLIFMETKKGCDQVTRQMRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  477

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTHGNAKFAR
Sbjct  478  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHGNAKFAR  537

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KILQ AGQ+V P LSAL
Sbjct  538  DLIKILQDAGQVVSPALSAL  557



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  332  LKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  391

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR
Sbjct  392  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFAR  451

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KILQ AGQ+V P LSAL
Sbjct  452  DLIKILQDAGQVVSPALSAL  471



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score =   218 bits (556),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 157/184 (85%), Gaps = 3/184 (2%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQ+RMDGWP+LSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  535  LKEVMDGSRILIFMETKKGCDQVTRQMRMDGWPSLSIHGDKNQAERDWVLAEFKSGRSPI  594

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR
Sbjct  595  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFAR  654

Query  423  ELVKILQQAGQIVPPQLSALA---CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGA  253
            +L+KILQ+AGQ+V P LSA+A         SGGN       G FGNRG ISGSNT+PLGA
Sbjct  655  DLIKILQEAGQVVSPALSAMARSSGSAFGGSGGNFRSRGRGGSFGNRGLISGSNTIPLGA  714

Query  252  KRHW  241
            +R W
Sbjct  715  RRPW  718



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGS+ILIF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVLSEFK GRSP+
Sbjct  446  LKEVMDGSKILIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLSEFKCGRSPI  505

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA+GTA TFFTH NAKFAR
Sbjct  506  MTATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGARGTAITFFTHANAKFAR  565

Query  423  ELVKILQQAGQIVPPQLSALA-CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKR  247
            +L+KILQ+A QI+PP LSA+A   G     G NFRSRGRGGFGNR  ISGSNT+PLG++R
Sbjct  566  DLIKILQEARQILPPTLSAMARSAGTHGGSGGNFRSRGRGGFGNRSLISGSNTIPLGSRR  625

Query  246  HW  241
             W
Sbjct  626  PW  627



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+
Sbjct  406  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLSEFKSGRSPI  465

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  466  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  525

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  526  ELIKILQEAGQVVPPTLSAL  545



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+
Sbjct  405  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQTERDRVLSEFKSGRSPI  464

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAR
Sbjct  465  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFAR  524

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  525  ELIKILQEAGQVVPPTLSAL  544



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+
Sbjct  406  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQTERDRVLSEFKSGRSPI  465

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAR
Sbjct  466  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFAR  525

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  526  ELIKILQEAGQVVPPTLSAL  545



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+
Sbjct  408  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQTERDRVLSEFKSGRSPI  467

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAR
Sbjct  468  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFAR  527

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  528  ELIKILQEAGQVVPPTLSAL  547



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+
Sbjct  410  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQAERDRVLSEFKSGRSPI  469

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  470  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  529

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  530  ELIKILQEAGQVVPPTLSAL  549



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  332  LKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  391

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR
Sbjct  392  MTATDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFAR  451

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KILQ AGQ V P L+AL
Sbjct  452  DLIKILQDAGQTVSPALTAL  471



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQLRMDGW ALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  431  LKEVMDGSRILIFMETKKGCDQVTRQLRMDGWAALSIHGDKNQAERDWVLAEFKSGRSPI  490

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA+GTA TFFT  NAKFAR
Sbjct  491  MTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGARGTALTFFTESNAKFAR  550

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            +L+KILQ+AGQIVPP LSA+       S G NFRSRGRGGFGNRG ISGSNTVPLGA R 
Sbjct  551  DLIKILQEAGQIVPPSLSAMT--RSAGSFGGNFRSRGRGGFGNRGMISGSNTVPLGAGRP  608

Query  243  W  241
            W
Sbjct  609  W  609



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE+MD S+ILIFVETKKGCDQ+TRQLR+DGWPAL+IHG+K+Q ER WVLSEFKSGRSP+
Sbjct  465  LKEIMDRSKILIFVETKKGCDQVTRQLRVDGWPALAIHGDKDQSERDWVLSEFKSGRSPI  524

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGAKGTA+TFFTH NAKF R
Sbjct  525  MIATDVAARGLDVKDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGTAYTFFTHSNAKFTR  584

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+KIL++AGQ++PP LSA+A
Sbjct  585  ELIKILREAGQMIPPALSAMA  605



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  420  LKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  479

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR
Sbjct  480  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFAR  539

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KILQ AGQ+V P LSAL
Sbjct  540  DLIKILQDAGQVVSPALSAL  559



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRS +
Sbjct  443  LKEVMDGSRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSAI  502

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR
Sbjct  503  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFAR  562

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
             L++ILQ++GQIVPP LSALA        S GN       G FGNRGSISGSNTVPLGA+
Sbjct  563  GLIRILQESGQIVPPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGAR  622

Query  249  RHW  241
            R W
Sbjct  623  RPW  625



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSR+LIF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRS +
Sbjct  361  LKEVMDGSRLLIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSAI  420

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR
Sbjct  421  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFAR  480

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
             L++ILQ++GQIVPP LSALA        S GN       G FGNRGSISGSNTVPLGA+
Sbjct  481  GLIRILQESGQIVPPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGAR  540

Query  249  RHW  241
            R W
Sbjct  541  RPW  543



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 160/183 (87%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDG+RILIF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  444  LKEVMDGNRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFKSGRSPI  503

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR
Sbjct  504  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYAR  563

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
            +L+K+LQ AGQ+V P LS LA      F     NFRSRGRGG+GNR SISGSNT+PLGA+
Sbjct  564  DLIKLLQDAGQVVSPALSTLARSAASSFGGSRGNFRSRGRGGYGNRSSISGSNTIPLGAR  623

Query  249  RHW  241
            R W
Sbjct  624  RPW  626



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  417  LKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  476

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR
Sbjct  477  MTATDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFAR  536

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KILQ AGQ V P L+AL
Sbjct  537  DLIKILQDAGQTVSPALTAL  556



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE + GSRILIFVETKKGCDQ+T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+
Sbjct  429  LKEAIVGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPI  488

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR
Sbjct  489  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFAR  548

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            EL+KILQ+AGQ+V P L+A++   G   G          G G    ISGSNTVP+G KR 
Sbjct  549  ELIKILQEAGQVVSPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRP  608

Query  243  W  241
            W
Sbjct  609  W  609



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE + GSRILIFVETKKGCDQ+T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+
Sbjct  458  LKEAIVGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPI  517

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR
Sbjct  518  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFAR  577

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            EL+KILQ+AGQ+V P L+A++   G   G          G G    ISGSNTVP+G KR 
Sbjct  578  ELIKILQEAGQVVSPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRP  637

Query  243  W  241
            W
Sbjct  638  W  638



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+
Sbjct  406  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPI  465

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  466  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  525

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  526  ELIKILQEAGQVVPPTLSAL  545



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+
Sbjct  404  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPI  463

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  464  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  523

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  524  ELIKILQEAGQVVPPTLSAL  543



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF+ETKKGCDQ+TRQLRMDGW ALSIHG+KNQ ER WVL+EFKSGRS +
Sbjct  434  LKEVMDGSRILIFMETKKGCDQVTRQLRMDGWAALSIHGDKNQAERDWVLAEFKSGRSAI  493

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  NAKFAR
Sbjct  494  MTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTALTFFTESNAKFAR  553

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            +L+KILQ+AGQIVPP LSA+       S G NFRSRGRGGF NR  ISGSNTVPLGA R 
Sbjct  554  DLIKILQEAGQIVPPSLSAMT--RSAGSFGGNFRSRGRGGFSNRRMISGSNTVPLGAGRP  611

Query  243  W  241
            W
Sbjct  612  W  612



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+
Sbjct  410  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPI  469

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  470  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  529

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  530  ELIKILQEAGQVVPPTLSAL  549



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  440  LKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  499

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAK+AR
Sbjct  500  MTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTSANAKYAR  559

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KILQ AGQIV P LSAL
Sbjct  560  DLIKILQDAGQIVSPALSAL  579



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+
Sbjct  377  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPI  436

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  437  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  496

Query  423  ELVKILQQAGQIVPPQLSAL  364
            ELVKILQ+AGQ+VPP LSAL
Sbjct  497  ELVKILQEAGQVVPPTLSAL  516



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+
Sbjct  404  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPI  463

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  464  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  523

Query  423  ELVKILQQAGQIVPPQLSAL  364
            ELVKILQ+AGQ+VPP LSAL
Sbjct  524  ELVKILQEAGQVVPPTLSAL  543



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++ DGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VLSEFKSGRSP+
Sbjct  398  LKQLSDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLSEFKSGRSPI  457

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  458  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  517

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  518  ELIKILQEAGQVVPPTLSAL  537



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+
Sbjct  405  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPI  464

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  465  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  524

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ VPP LSAL
Sbjct  525  ELIKILQEAGQAVPPTLSAL  544



>ref|XP_006845267.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score =   212 bits (540),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF+ETKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVL+EFK+GRSP+
Sbjct  490  LQQIMDGSRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLAEFKNGRSPI  549

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT+ NA+FAR
Sbjct  550  MTATDVAARGLDVKDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTNANARFAR  609

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            EL+KILQ+AGQ V PQL+AL    G    G         G+GNR  ISGSNT+P+G KR 
Sbjct  610  ELIKILQEAGQAVSPQLAALGRSSGGGGSGGGNFRSRGRGYGNRSLISGSNTIPIGGKRP  669

Query  243  W  241
            W
Sbjct  670  W  670



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+
Sbjct  401  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQPERDRVLAEFKSGRSPI  460

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAR
Sbjct  461  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFAR  520

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KILQ+AGQ+VPP LSAL
Sbjct  521  ELIKILQEAGQVVPPTLSAL  540



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK+ MDGS+ILIFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FKSGRSP+
Sbjct  407  LKDFMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKSGRSPI  466

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH N K A 
Sbjct  467  MIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANVKSAG  526

Query  423  ELVKILQQAGQIVPPQLSALA  361
             L+KILQQA Q VPPQL+ALA
Sbjct  527  HLIKILQQARQAVPPQLAALA  547



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKEVMDGSRILIF ETKKGCDQ+T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  436  LKEVMDGSRILIFTETKKGCDQVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  495

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAKFAR
Sbjct  496  MTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTRANAKFAR  555

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQ AGQ+V P LS L+
Sbjct  556  DLIKILQDAGQVVSPALSELS  576



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE++D  +ILIF+ETKK CDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  443  LKEMVDSGKILIFIETKKACDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  502

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTA TFFTH NAKFAR
Sbjct  503  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTALTFFTHANAKFAR  562

Query  423  ELVKILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAK  250
            EL+KILQ+AGQ+V P LSAL           G +FRSRGRGGFGNR   SGSNTVPLG K
Sbjct  563  ELIKILQEAGQVVTPALSALVRSAGSSGGGSGGSFRSRGRGGFGNRALKSGSNTVPLGNK  622

Query  249  RHW  241
            R W
Sbjct  623  RSW  625



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETKKGCDQ+T+QLRMDGWPAL+IHG+K Q ER  VLSEFKSGRSP+
Sbjct  398  LKQLMDGSKILIFVETKKGCDQVTKQLRMDGWPALAIHGDKTQSERDRVLSEFKSGRSPI  457

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NA+FAR
Sbjct  458  MTATDVAARGLDVKDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNARFAR  517

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+KIL +AGQ+VPP LS L
Sbjct  518  ELIKILHEAGQVVPPSLSDL  537



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE M GSRILIFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+
Sbjct  461  LKEAMVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPI  520

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKF R
Sbjct  521  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAAGTALTFFTHANAKFTR  580

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQ+AGQ+V P L+A+A
Sbjct  581  DLIKILQEAGQVVSPALAAMA  601



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L E+MDGSR+LIF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  535  LTEMMDGSRVLIFLETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  594

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+G AFTFFTH NA+FAR
Sbjct  595  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGNAFTFFTHANARFAR  654

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQ  GQ+V P L+A+A
Sbjct  655  DLIKILQDCGQVVNPALAAMA  675



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L E+MDGSRILIF+ETKKGCDQ+TRQLRMDGWPALSIHG+K Q ER WVL+EFKSG+SP+
Sbjct  505  LGELMDGSRILIFLETKKGCDQVTRQLRMDGWPALSIHGDKAQAERDWVLAEFKSGKSPI  564

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA TFFTH NA+FAR
Sbjct  565  MTATDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTALTFFTHANARFAR  624

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            +L+KILQ+AG+ V P L+++A       G          G+GNR  ISGSNTVPLG +R 
Sbjct  625  DLIKILQEAGKSVTPALASMA--RSAGGGSVGNFRSRGRGYGNRSLISGSNTVPLGGRRA  682

Query  243  W  241
            W
Sbjct  683  W  683



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK+ + GSRILIFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVLSEFKSGRSP+
Sbjct  429  LKDSIVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLSEFKSGRSPI  488

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  N KFAR
Sbjct  489  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTESNGKFAR  548

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+KILQ+AGQ+V P LSA+A
Sbjct  549  ELIKILQEAGQVVSPALSAMA  569



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE M GSRILIFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+
Sbjct  430  LKEAMVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPI  489

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR
Sbjct  490  MTATDVAARGLDVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFAR  549

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQ+AGQ+V P L+A+A
Sbjct  550  DLIKILQEAGQVVSPALAAMA  570



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDG+RILIF+ETKKGCDQ+TR LRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+
Sbjct  440  LKDLMDGNRILIFMETKKGCDQVTRHLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPI  499

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR
Sbjct  500  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYAR  559

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+K+LQ AGQ+V P LS LA
Sbjct  560  DLIKLLQDAGQVVSPALSTLA  580



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LKE M GSRILIFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+
Sbjct  429  LKEAMVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPI  488

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR
Sbjct  489  MTATDVAARGLDVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFAR  548

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KILQ+AGQ+V P L+A+A
Sbjct  549  DLIKILQEAGQVVSPALAAMA  569



>emb|CAA09209.1| RNA helicase [Arabidopsis thaliana]
Length=187

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  24   LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  83

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  84   MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  143

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL  ILQ+AGQ V P+L+++ 
Sbjct  144  ELTNILQEAGQKVSPELASMG  164



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L E+MDGSRIL+F+ETKKGCDQ+TRQLRMDGWPALSIHG+K Q ER WVL+EFKSG SP+
Sbjct  523  LGELMDGSRILVFLETKKGCDQVTRQLRMDGWPALSIHGDKAQAERDWVLAEFKSGNSPI  582

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGAKGTAFTFFTH NA+FAR
Sbjct  583  MTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTHANARFAR  642

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            +L+KILQ+AGQ V P L+++A       G          G+GNR  +SGSN+VPLG +R 
Sbjct  643  DLIKILQEAGQSVTPALASMA--RSAGGGSGGNFRSRGRGYGNRALMSGSNSVPLGGRRP  700

Query  243  W  241
            W
Sbjct  701  W  701



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L EVMDGSRILIF+ETKKGCDQ+TRQLRMDGWPALSIHG+K Q ER WVL+EFKSGRSP+
Sbjct  519  LGEVMDGSRILIFLETKKGCDQVTRQLRMDGWPALSIHGDKAQSERDWVLAEFKSGRSPI  578

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCV+N+DFPT LEDYVHRIGRTGRAGAKGTAFTFFT  N +FAR
Sbjct  579  MTATDVAARGLDVKDIKCVVNFDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTQANIRFAR  638

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  244
            ELVKILQ AGQ V P L+++A     S GG+    R RG      SISGSNT+PLG +R 
Sbjct  639  ELVKILQDAGQNVSPALASMA----RSGGGSGGNFRSRGRGNGNRSISGSNTIPLGGRRP  694

Query  243  W  241
            W
Sbjct  695  W  695



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
 ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
Length=622

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L EVMDGSRILIFVETKKGCD++TRQLRMDGWPALSIHG+K Q ER  VLSEFKSGR+P+
Sbjct  440  LGEVMDGSRILIFVETKKGCDKVTRQLRMDGWPALSIHGDKKQAERDLVLSEFKSGRNPI  499

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR
Sbjct  500  MTATDVAARGLDVKDIKCVINFDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHAR  559

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KIL++AGQIV P LSALA
Sbjct  560  DLIKILREAGQIVTPALSALA  580



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK VMDGSRILIFVETKKGCDQ+T+QLRMDGWPALSIHG+K+Q ER WVL+EFKSGRS +
Sbjct  436  LKAVMDGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKSQSEREWVLAEFKSGRSLI  495

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTAFTFFT  N++FA 
Sbjct  496  MTATDVAARGLDVKDIKCVINYDFPMTLEDYVHRIGRTGRAGAKGTAFTFFTDSNSRFAG  555

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+KILQ AGQ+VPP LS LA
Sbjct  556  ELLKILQDAGQVVPPALSDLA  576



>gb|EPS60527.1| hypothetical protein M569_14276, partial [Genlisea aurea]
Length=230

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF++G+SP+
Sbjct  65   LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPI  124

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NAKFA+
Sbjct  125  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANAKFAK  184

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L A+ 
Sbjct  185  ELINILREAGQKVSPELVAMG  205



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L EVMDGSRILIFVETKKGCD++TRQLRMDGWPALSIHG+K Q ER  VLSEFKSGR+P+
Sbjct  440  LVEVMDGSRILIFVETKKGCDKVTRQLRMDGWPALSIHGDKKQAERDLVLSEFKSGRNPI  499

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR
Sbjct  500  MTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHAR  559

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KIL++AGQIV P LS LA
Sbjct  560  DLIKILREAGQIVTPALSTLA  580



>ref|XP_006385358.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|ERP63155.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=497

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  330  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  389

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+
Sbjct  390  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAK  449

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V P+L+A+A
Sbjct  450  ELVTILEEAGQKVSPELTAMA  470



>ref|XP_011000790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Populus euphratica]
Length=506

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  339  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  398

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  +EDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+
Sbjct  399  MTATDVAARGLDVKDVKYVINYDFPGSIEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAK  458

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V P+L+A+A
Sbjct  459  ELVTILEEAGQKVSPELTAMA  479



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+E+MDGSR+LIF+ETKKGCDQ+TR+LRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEEIMDGSRLLIFLETKKGCDQVTRKLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP  +EDYVHRIGRTGRAGAKGTA+T+FT  NA+FAR
Sbjct  398  MTATDVAARGLDVKDIKCVINYDFPGSMEDYVHRIGRTGRAGAKGTAYTYFTAANARFAR  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+KIL++AGQ + P L+ + 
Sbjct  458  DLIKILEEAGQSISPSLAEMG  478



>gb|KHN39300.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=433

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  266  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  325

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+
Sbjct  326  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAK  385

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  386  ELIAILEEAGQKVSPELAAMG  406



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+E+MDGSRILIF+ETKKGCDQ+T+QLRMDGWPALSIHG+K+Q ER WVL EFK+G+SP+
Sbjct  409  LEEIMDGSRILIFMETKKGCDQVTKQLRMDGWPALSIHGDKSQAERDWVLGEFKAGKSPI  468

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  N +FAR
Sbjct  469  MTATDVAARGLDVKDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANGRFAR  528

Query  423  ELVKILQQAGQIVPPQLSAL  364
            ELV ILQ+AGQ V P+L+A+
Sbjct  529  ELVGILQEAGQRVNPELAAM  548



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  336  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V P+L+A+ 
Sbjct  456  ELVSILEEAGQRVSPELAAMG  476



>ref|XP_006392681.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 ref|XP_006392682.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29967.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29968.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=429

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  266  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  325

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  326  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  385

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ ILQ+AGQ V P+LS++ 
Sbjct  386  ELISILQEAGQKVSPELSSMG  406



>ref|XP_006426523.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39763.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=473

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  307  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  366

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  367  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  426

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  427  ELITILEEAGQKVSPELAAMG  447



>gb|KDO65284.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=473

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  307  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  366

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  367  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  426

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  427  ELITILEEAGQKVSPELAAMG  447



>ref|XP_006583016.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Glycine max]
Length=496

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  340  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  399

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+
Sbjct  400  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAK  459

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  460  ELIAILEEAGQKVSPELAAMG  480



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ ILQ+AGQ V P+LS++ 
Sbjct  458  ELISILQEAGQKVSPELSSMG  478



>ref|XP_003529884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Glycine max]
Length=507

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  340  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  399

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+
Sbjct  400  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAK  459

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  460  ELIAILEEAGQKVSPELAAMG  480



>ref|XP_007135556.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
 gb|ESW07550.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
Length=507

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  340  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  399

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  400  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  459

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  460  ELIAILEEAGQKVSPELAAMG  480



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+ IL++AGQ V P+L+A+
Sbjct  458  ELISILEEAGQRVSPELAAM  477



>ref|XP_006426526.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39766.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=495

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  329  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  388

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  389  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  448

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  449  ELITILEEAGQKVSPELAAMG  469



>gb|KDO65287.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=491

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  325  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  384

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  385  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  444

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  445  ELITILEEAGQKVSPELAAMG  465



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  332  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  391

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  392  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  451

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  452  ELITILEEAGQKVSPELAAMG  472



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  337  LEDIMDGSRILVFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  396

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+
Sbjct  397  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAK  456

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  457  ELIAILEEAGQKVNPELAAMG  477



>ref|XP_003531619.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Glycine 
max]
 gb|KHN11290.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=507

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  340  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  399

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K V+NYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+
Sbjct  400  MTATDVAARGLDVKDVKYVVNYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAK  459

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  460  ELIAILEEAGQKVSPELAAMG  480



>ref|XP_006466041.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Citrus sinensis]
 gb|KDO65282.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=505

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELITILEEAGQKVSPELAAMG  478



>ref|XP_006466042.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Citrus sinensis]
 gb|KDO65283.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=504

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELITILEEAGQKVSPELAAMG  478



>ref|XP_006426525.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39765.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=505

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELITILEEAGQKVSPELAAMG  478



>ref|XP_006426524.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39764.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=504

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELITILEEAGQKVSPELAAMG  478



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  336  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V P+L+A+ 
Sbjct  456  ELVSILEEAGQRVSPELAAMG  476



>ref|XP_010480030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Camelina sativa]
Length=464

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  301  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  360

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  361  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  420

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+++ 
Sbjct  421  ELINILEEAGQKVSPELASMG  441



>ref|XP_002527412.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF34978.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=505

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELISILEEAGQKVSPELAAMG  478



>gb|KHG24204.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=505

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIAILEEAGQKVSPELAAMG  478



>ref|XP_010501121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Camelina 
sativa]
Length=502

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  339  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  398

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  399  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  458

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+++ 
Sbjct  459  ELINILEEAGQKVSPELASMG  479



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P L+A+ 
Sbjct  458  ELISILEEAGQKVSPDLAAMG  478



>ref|XP_006858286.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  334  LEDIMDGSRILIFIDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  393

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  N +FA+
Sbjct  394  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANGRFAK  453

Query  423  ELVKILQQAGQIVPPQLSAL  364
            EL+ ILQ+AGQ V P+L+A+
Sbjct  454  ELISILQEAGQKVSPELAAM  473



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIGILEEAGQKVSPELAAMG  478



>gb|KJB70270.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
 gb|KJB70271.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
Length=505

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIAILKEAGQKVSPELAAMG  478



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 ref|XP_004154799.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIGILEEAGQKVSPELAAMG  478



>ref|XP_010480028.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Camelina sativa]
Length=502

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  339  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  398

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  399  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  458

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+++ 
Sbjct  459  ELINILEEAGQKVSPELASMG  479



>ref|XP_008228305.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X3 
[Prunus mume]
Length=504

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  337  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  396

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  397  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  456

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ +L++AGQ V P+L+A+ 
Sbjct  457  ELIALLEEAGQKVSPELAAMG  477



>ref|XP_008228303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Prunus mume]
Length=504

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  337  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  396

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  397  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  456

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ +L++AGQ V P+L+A+ 
Sbjct  457  ELIALLEEAGQKVSPELAAMG  477



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  301  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  360

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  361  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  420

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+++ 
Sbjct  421  ELMNILEEAGQKVSPELASMG  441



>gb|KDP40778.1| hypothetical protein JCGZ_24777 [Jatropha curcas]
Length=503

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALS+HG+K+Q ER WVLSEFK+G+SP+
Sbjct  337  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSLHGDKSQAERDWVLSEFKAGKSPI  396

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  397  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAK  456

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  457  ELITILEEAGQKVSPELAAMG  477



>gb|KHF98903.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=519

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIAILKEAGQKVSPELAAMG  478



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  392  LSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI  451

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R
Sbjct  452  MAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSR  511

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L +++
Sbjct  512  NLVKILREAGQVVNPALESMS  532



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P L+A+ 
Sbjct  458  ELISILEEAGQKVSPDLAAMG  478



>ref|NP_001105241.1| DEAD box RNA helicase1 [Zea mays]
 gb|AAR29370.1| DEAD box RNA helicase [Zea mays]
Length=566

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF++TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  389  LSDLMDGSRILIFLQTKKDCDKITRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI  448

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R
Sbjct  449  MAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSR  508

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L +++
Sbjct  509  NLVKILREAGQVVNPALESMS  529



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  339  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  398

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  399  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  458

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+++ 
Sbjct  459  ELMNILEEAGQKVSPELASMG  479



>ref|XP_004968530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Setaria italica]
Length=492

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  328  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  387

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  388  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  447

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+A+ 
Sbjct  448  ELINILEEAGQKVSSELAAMG  468



>ref|XP_008391321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Malus domestica]
Length=505

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ +L++AGQ V P+L+A+ 
Sbjct  458  ELIALLEEAGQKVSPELAAMG  478



>gb|KJB56890.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=487

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWP LSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIAILEEAGQKVSPELAAMG  478



>gb|EEE54050.1| hypothetical protein OsJ_00740 [Oryza sativa Japonica Group]
Length=468

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  304  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  363

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  364  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  423

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+ + 
Sbjct  424  DLINILEEAGQKVSPELANMG  444



>ref|XP_009367550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Pyrus x bretschneideri]
Length=505

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ +L++AGQ V P+L+A+ 
Sbjct  458  ELIALLEEAGQKVSPELAAMG  478



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL  ILQ+AGQ V P+L+++ 
Sbjct  458  ELTNILQEAGQKVSPELASMG  478



>gb|EEC70110.1| hypothetical protein OsI_00766 [Oryza sativa Indica Group]
Length=470

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  306  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  365

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  366  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  425

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+ + 
Sbjct  426  DLINILEEAGQKVSPELANMG  446



>ref|XP_007215261.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16460.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=504

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  337  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  396

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  397  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  456

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ +L++AGQ V P+L+A+ 
Sbjct  457  ELIALLEEAGQKVSPELAAMG  477



>ref|XP_010106662.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXC11111.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=494

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  333  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  392

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  393  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  452

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+A+ 
Sbjct  453  DLITILEEAGQKVSPELAAMG  473



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  371  LSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI  430

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R
Sbjct  431  MAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHSNAKFSR  490

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L ++A
Sbjct  491  NLVKILREAGQVVNPALESMA  511



>gb|AFK42127.1| unknown [Medicago truncatula]
Length=499

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  334  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  393

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIG+TGRAGAKGTA+TFFT  NA+FA+
Sbjct  394  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGKTGRAGAKGTAYTFFTAANARFAK  453

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+A+ 
Sbjct  454  ELISILEEAGQRVSSELAAMG  474



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  334  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  393

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  394  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  453

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+A+ 
Sbjct  454  ELISILEEAGQRVSSELAAMG  474



>ref|XP_006645603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Oryza 
brachyantha]
Length=485

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  321  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  380

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  381  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  440

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+ + 
Sbjct  441  DLINILEEAGQKVSPELANMG  461



>ref|XP_010262147.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X3 [Nelumbo nucifera]
Length=505

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  339  LEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  398

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  399  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  458

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  459  ELITILEEAGQKVSPELAAMG  479



>gb|KJB56888.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
 gb|KJB56891.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=505

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWP LSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIAILEEAGQKVSPELAAMG  478



>ref|XP_010262145.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nelumbo nucifera]
Length=512

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  346  LEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  405

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  406  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  465

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  466  ELITILEEAGQKVSPELAAMG  486



>ref|XP_010262146.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nelumbo nucifera]
Length=511

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  345  LEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  404

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  405  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  464

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  465  ELITILEEAGQKVSPELAAMG  485



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  390  LSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQSERDYVLAEFKSGKSPI  449

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R
Sbjct  450  MAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSR  509

Query  423  ELVKILQQAGQIVPPQL  373
             LVKIL++AGQ+V P L
Sbjct  510  NLVKILREAGQVVNPAL  526



>sp|Q5QMN3.2|RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Oryza sativa 
Japonica Group]
Length=494

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  330  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  389

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  390  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  449

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+ + 
Sbjct  450  DLINILEEAGQKVSPELANMG  470



>ref|XP_008805786.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Phoenix dactylifera]
Length=498

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  331  LEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  390

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  391  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  450

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+A+ 
Sbjct  451  DLINILEEAGQKVSPELAAMG  471



>ref|XP_010242202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nelumbo nucifera]
Length=512

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  345  LEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  404

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  405  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  464

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  465  ELITILEEAGQKVSPELAAMG  485



>ref|XP_004968529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Setaria italica]
Length=517

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  328  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  387

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  388  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  447

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+A+ 
Sbjct  448  ELINILEEAGQKVSSELAAMG  468



>ref|XP_004297601.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAHTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ +L++AGQ V P L+A+ 
Sbjct  458  ELIGLLEEAGQKVSPDLAAMG  478



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITR+LRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  338  LEDIMDGSRILIFMDTKKGCDQITRRLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  458  ELIVILEEAGQKVSPELAAMG  478



>ref|XP_002279117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI35942.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDG RILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  339  LEDIMDGGRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  398

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  399  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  458

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V P+L+A+ 
Sbjct  459  ELITILEEAGQRVAPELAAMG  479



>ref|XP_008805785.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Phoenix dactylifera]
Length=530

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  363  LEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  422

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  423  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  482

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L+A+ 
Sbjct  483  DLINILEEAGQKVSPELAAMG  503



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  457

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL  IL++AGQ V P+L+++ 
Sbjct  458  ELSNILEEAGQKVSPELASMG  478



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  390  LSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQSERDYVLAEFKSGKSPI  449

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R
Sbjct  450  MAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSR  509

Query  423  ELVKILQQAGQIVPPQL  373
             LVKIL++AGQ+V P L
Sbjct  510  NLVKILREAGQVVNPAL  526



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  398  LSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI  457

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R
Sbjct  458  MAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSR  517

Query  423  ELVKILQQAGQIVPPQLSAL  364
             LVKIL++AGQ V P L ++
Sbjct  518  NLVKILREAGQAVNPALESM  537



>ref|XP_009380443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  334  LEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  393

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  394  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  453

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+KIL++AGQ V P+L+ +
Sbjct  454  DLIKILEEAGQKVNPELAKM  473



>ref|NP_001142117.1| uncharacterized protein LOC100274281 [Zea mays]
 gb|ACF86539.1| unknown [Zea mays]
 gb|ACF87679.1| unknown [Zea mays]
 tpg|DAA52978.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=494

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  330  LEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  389

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  390  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  449

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+A+ 
Sbjct  450  ELINILEEAGQKVSSELAAMG  470



>emb|CDO97919.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G++P+
Sbjct  337  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKNPI  396

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  397  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  456

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ ILQ+AGQ V P+L+++ 
Sbjct  457  DLINILQEAGQKVSPELASMG  477



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VLSEFKSG+SP+
Sbjct  396  LSDLMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKAQSERDYVLSEFKSGKSPI  455

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH N+K++R
Sbjct  456  MAATDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNSKYSR  515

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L A++
Sbjct  516  NLVKILREAGQVVNPALEAMS  536



>ref|XP_010314157.1| PREDICTED: ethylene-responsive RNA helicase isoform X1 [Solanum 
lycopersicum]
Length=501

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  335  LEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  394

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+
Sbjct  395  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAK  454

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +LV IL++AGQ V P+L+ +
Sbjct  455  DLVNILEEAGQKVSPELAKM  474



>ref|XP_009625322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=501

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  335  LEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  394

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA+
Sbjct  395  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAK  454

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+ IL++AGQ V P+L+ +
Sbjct  455  DLINILEEAGQKVSPELAKM  474



>ref|XP_011072507.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Sesamum indicum]
Length=507

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF++G+SP+
Sbjct  341  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPI  400

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  401  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  460

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V P+L A+ 
Sbjct  461  DLINILEEAGQKVSPELVAMG  481



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  336  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V  +L+++ 
Sbjct  456  ELVSILEEAGQKVSHELASMG  476



>ref|XP_006366150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum tuberosum]
Length=501

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  335  LEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  394

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+
Sbjct  395  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAK  454

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +LV IL++AGQ V P+L+ +
Sbjct  455  DLVNILEEAGQKVGPELAKM  474



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  336  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V  +L+++ 
Sbjct  456  ELVSILEEAGQKVSHELASMG  476



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+E+MDGSR+L+F+ETK+GCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  333  LEEIMDGSRLLVFMETKRGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  392

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVINYDFP   EDYVHRIGRTGRAGAKG A+TFFT  NAK A+
Sbjct  393  MTATDVAARGLDVKDIKCVINYDFPGSCEDYVHRIGRTGRAGAKGAAYTFFTAANAKHAK  452

Query  423  ELVKILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKR  247
            ELV IL +AGQ V  QL A+        GG   R RG GG G     SGSNT+PLG +R
Sbjct  453  ELVSILVEAGQPVSSQLQAMVGSSRGGGGGGFHRGRGFGGRGFGVQQSGSNTIPLGGQR  511



>ref|XP_003564953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brachypodium 
distachyon]
Length=496

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  332  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  391

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+
Sbjct  392  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAK  451

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL +AGQ V P+L+ + 
Sbjct  452  DLINILVEAGQKVSPELANMG  472



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  336  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+++ 
Sbjct  456  ELISILEEAGQKVSHELASMG  476



>emb|CDM81540.1| unnamed protein product [Triticum aestivum]
Length=496

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  332  LEDIMDGSRILVFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  391

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA+
Sbjct  392  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAK  451

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL +AGQ V P+L+ + 
Sbjct  452  DLISILVEAGQKVSPELANMG  472



>ref|XP_010534903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  266  LEDIMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  325

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F +
Sbjct  326  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVK  385

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+ IL++A Q V P+L+A+
Sbjct  386  DLINILEEAEQRVSPELAAM  405



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFK+G+SP+
Sbjct  393  LSDLMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKAQSERDYVLAEFKNGKSPI  452

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R
Sbjct  453  MAATDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSR  512

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L A++
Sbjct  513  NLVKILREAGQVVNPALEAMS  533



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  336  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+  VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVMYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV ILQ+AGQ V  +L+++ 
Sbjct  456  ELVNILQEAGQKVSSELASMG  476



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFK+G+SP+
Sbjct  393  LSDLMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKAQSERDYVLAEFKNGKSPI  452

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R
Sbjct  453  MAATDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSR  512

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L A++
Sbjct  513  NLVKILREAGQVVNPALEAMS  533



>ref|XP_010915213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Elaeis guineensis]
Length=498

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  331  LEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  390

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  391  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  450

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V  +L+A+ 
Sbjct  451  DLINILEEAGQKVSSELAAMG  471



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRIL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVL+EF+SG+SP+
Sbjct  336  LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLAEFRSGKSPI  395

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  396  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAK  455

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV IL++AGQ V  +L+++ 
Sbjct  456  ELVNILEEAGQKVSHELASMG  476



>ref|XP_010534902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Tarenaya hassleriana]
Length=504

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+
Sbjct  338  LEDIMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI  397

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F +
Sbjct  398  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVK  457

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+ IL++A Q V P+L+A+
Sbjct  458  DLINILEEAEQRVSPELAAM  477



>gb|AAG51573.1|AC027034_19 RNA helicase, 5' partial; 101954-101280 [Arabidopsis thaliana]
Length=155

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -1

Query  756  ILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAAR  577
            IL+F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M ATDVAAR
Sbjct  1    ILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAAR  60

Query  576  GLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQA  397
            GLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+A
Sbjct  61   GLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEA  120

Query  396  GQIVPPQLSALA  361
            GQ V P+L+++ 
Sbjct  121  GQKVSPELASMG  132



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  395  LSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI  454

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R
Sbjct  455  MAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSR  514

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L ++A
Sbjct  515  NLVKILREAGQVVNPALESMA  535



>ref|XP_009802114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=501

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQ+TR LRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  335  LEDIMDGSRILIFMDTKKGCDQVTRLLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  394

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA+
Sbjct  395  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAK  454

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +L+ IL++AGQ V P+L+ +
Sbjct  455  DLINILEEAGQKVSPELAKM  474



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGSRILIF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+
Sbjct  490  LSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI  549

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R
Sbjct  550  MAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSR  609

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LVKIL++AGQ+V P L ++A
Sbjct  610  NLVKILREAGQVVNPALESMA  630



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF++G+SP+
Sbjct  342  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPI  401

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+
Sbjct  402  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTVANARFAK  461

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ IL++AGQ V  +L A+ 
Sbjct  462  DLINILEEAGQKVSSELVAMG  482



>gb|EMS55994.1| DEAD-box ATP-dependent RNA helicase 20 [Triticum urartu]
Length=491

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  332  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  391

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA+
Sbjct  392  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAK  451

Query  423  ELVKILQQAGQIV  385
            +L+ IL +AGQ V
Sbjct  452  DLISILVEAGQKV  464



>gb|EMT09661.1| DEAD-box ATP-dependent RNA helicase 20 [Aegilops tauschii]
Length=431

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  266  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  325

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA+
Sbjct  326  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAK  385

Query  423  ELVKILQQAGQIV  385
            +L+ IL +AGQ V
Sbjct  386  DLISILVEAGQKV  398



>dbj|BAD73320.1| putative ethylene-responsive RNA helicase [Oryza sativa Japonica 
Group]
Length=521

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  304  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  363

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+
Sbjct  364  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK  423

Query  423  ELVKILQQAGQ  391
            +L+ IL++AGQ
Sbjct  424  DLINILEEAGQ  434



>ref|XP_005850349.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
 gb|EFN58247.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
Length=551

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L++ MDG RILIF+ETKKGCD +TRQLRMDGWPALSIHG+K+Q ER WVL+EFK+G+ P+
Sbjct  367  LEKEMDGRRILIFLETKKGCDAVTRQLRMDGWPALSIHGDKSQHERDWVLAEFKAGKHPI  426

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVAARGLDVKDIK VINYD P+C EDYVHRIGRTGRAGA G A++FFT  N + AR
Sbjct  427  MIATDVAARGLDVKDIKMVINYDMPSCAEDYVHRIGRTGRAGASGAAYSFFTAANGRMAR  486

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +LV+IL++A Q VPP+L   A
Sbjct  487  QLVQILEEASQAVPPELRQFA  507



>ref|NP_001234650.1| ethylene-responsive RNA helicase [Solanum lycopersicum]
 gb|AAD46404.1|AF096248_1 ethylene-responsive RNA helicase [Solanum lycopersicum]
Length=474

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF  T KGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  309  LEDIMDGSRILIF-RTLKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPI  367

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+
Sbjct  368  MTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAK  427

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +LV IL++AGQ V P+L+ +
Sbjct  428  DLVNILEEAGQKVSPELAKM  447



>ref|XP_002987999.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
 gb|EFJ10791.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
Length=505

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L E MDG +ILIF+ETK+GCDQ+T+QLRM+GWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  324  LDEFMDGGKILIFMETKRGCDQVTKQLRMEGWPALSIHGDKSQAERDWVLSEFKTGKSPI  383

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK AR
Sbjct  384  MTATDVAARGLDVKDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHAR  443

Query  423  ELVKILQQAGQIVPPQLSAL  364
            ELV IL +AGQ + P+L ++
Sbjct  444  ELVSILSEAGQRITPELQSM  463



>ref|XP_002972931.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
 gb|EFJ26152.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
Length=534

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L E MDG +ILIF+ETK+GCDQ+T+QLRM+GWPALSIHG+K+Q ER WVLSEFK+G+SP+
Sbjct  329  LDEFMDGGKILIFMETKRGCDQVTKQLRMEGWPALSIHGDKSQAERDWVLSEFKTGKSPI  388

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGLDVKDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK AR
Sbjct  389  MTATDVAARGLDVKDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHAR  448

Query  423  ELVKILQQAGQIVPPQLSAL  364
            ELV IL +AGQ + P+L ++
Sbjct  449  ELVSILSEAGQRITPELQSM  468



>ref|XP_002455005.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
 gb|EES00125.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
Length=488

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 4/141 (3%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDGSRILIF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+
Sbjct  330  LEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPI  389

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M ATDVAARGL    +K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+
Sbjct  390  MTATDVAARGL----VKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAK  445

Query  423  ELVKILQQAGQIVPPQLSALA  361
            EL+ IL++AGQ V  +L+A+ 
Sbjct  446  ELISILEEAGQKVSSELAAMG  466



>emb|CDI80731.1| hypothetical protein, conserved [Eimeria acervulina]
Length=199

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+IL+F ETK+G D +TR LRM+GWPALS+HG+K Q+ER WVL EFK GR+P+
Sbjct  14   LRRIMDGSKILVFAETKRGADNLTRDLRMEGWPALSLHGDKKQEERTWVLDEFKQGRNPI  73

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVA+RGLDVKDI+ VIN+D P  +EDYVHRIGRTGRAGAKG A+TFFT    + AR
Sbjct  74   MVATDVASRGLDVKDIRHVINFDMPNQIEDYVHRIGRTGRAGAKGNAYTFFTTDKQRLAR  133

Query  423  ELVKILQQAGQIVPPQLSAL  364
            +LV++L++A Q VPP+L AL
Sbjct  134  DLVRVLKEANQTVPPELEAL  153



>gb|KFG62415.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, partial [Toxoplasma 
gondii RUB]
Length=193

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+ILIF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+
Sbjct  12   LRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPI  71

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + AR
Sbjct  72   MVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLAR  131

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV++L+ A Q VPP+L +L 
Sbjct  132  ELVRVLRGANQPVPPELESLG  152



>emb|CAA09215.1| RNA helicase [Arabidopsis thaliana]
Length=263

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            LK++MDGS+ILIFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+
Sbjct  148  LKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPI  207

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVH  505
            M ATDVAARGLDVKDIKCV+NYDFP  LEDY+H
Sbjct  208  MTATDVAARGLDVKDIKCVVNYDFPNTLEDYIH  240



>ref|XP_002776976.1| helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER08792.1| helicase, putative [Perkinsus marinus ATCC 50983]
Length=181

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDGS+I+IF +TK+  D +TR LRMDGWPALSIHG+K Q+ER WVL EFKSG+SP+MIAT
Sbjct  1    MDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPIMIAT  60

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAGAKG+A++FFT    K A++L+ 
Sbjct  61   DVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAKDLIG  120

Query  411  ILQQAGQIVPPQLSALA  361
            +L++A Q VPP+L  +A
Sbjct  121  VLREAEQAVPPELEKIA  137



>ref|XP_005650016.1| DEAD-box RNA helicase [Coccomyxa subellipsoidea C-169]
 gb|EIE25472.1| DEAD-box RNA helicase [Coccomyxa subellipsoidea C-169]
Length=461

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+  MDGSR+LIF ETK+GCD +TRQLR +GWPALSIHG+K+Q ER WVL+EFK+G+SP+
Sbjct  282  LEREMDGSRLLIFCETKRGCDAVTRQLRTEGWPALSIHGDKSQQERDWVLAEFKAGKSPI  341

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVAARGLDVKDIK V+NYD P   EDYVHRIGRT RAGA G A +FFT  N + AR
Sbjct  342  MLATDVAARGLDVKDIKMVVNYDMPNTAEDYVHRIGRTARAGASGLAVSFFTSANGRMAR  401

Query  423  ELVKILQQAGQIVPPQLSALAC  358
            ++V IL +A Q VP QL   A 
Sbjct  402  QIVDILSEAHQTVPDQLRQYAS  423



>emb|CCF73942.1| unnamed protein product [Babesia microti strain RI]
Length=530

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGS+I+IF +TKKG D +TR+LRMDGWPALSIHG+K QDER WVL+EFKSG+ P+
Sbjct  360  LPKLMDGSKIIIFADTKKGADILTRELRMDGWPALSIHGDKKQDERTWVLNEFKSGKHPI  419

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAG KG A+TF T    K A+
Sbjct  420  MIATDVASRGLDVKDVRFVINYDFPNQIEDYVHRIGRTGRAGTKGVAYTFLTPDKHKVAK  479

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +LVKIL++A Q + P+LS +A
Sbjct  480  DLVKILREANQPISPELSRIA  500



>ref|XP_002780686.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER12481.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
Length=166

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDGS++LIF +TK+G D +TR LRMDGWPAL IHG+K Q+ER WVL EFKSG+SP+MIAT
Sbjct  1    MDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPIMIAT  60

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVA+RGLDVKDI+ V+NYDFP  +EDYVHRIGRTGRAG KG A+TFFT    K AR LV+
Sbjct  61   DVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTADKIKMARGLVQ  120

Query  411  ILQQAGQIVPPQLSALA  361
            IL++A Q V P+L  L+
Sbjct  121  ILREANQTVSPELERLS  137



>ref|XP_004831007.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi]
 gb|AFZ81341.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi strain WA]
Length=518

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L ++MDGS+ILIF ETKKG D +TR+LR+DGWPALSIHG+K Q+ER WVL+EFK G+ P+
Sbjct  343  LPKLMDGSKILIFTETKKGADSLTRELRLDGWPALSIHGDKKQEERNWVLNEFKLGKHPI  402

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVA+RGLDV D+K VINYDFP  +EDYVHRIGRTGRAG KG ++TF T    + AR
Sbjct  403  MIATDVASRGLDVHDVKYVINYDFPNQIEDYVHRIGRTGRAGTKGASYTFLTPDKNRIAR  462

Query  423  ELVKILQQAGQIVPPQLSALAC  358
            +LV++L++A Q V P+LS LA 
Sbjct  463  DLVRVLREANQPVSPELSRLAS  484



>ref|XP_764197.1| RNA helicase [Theileria parva strain Muguga]
 gb|EAN31914.1| RNA helicase, putative [Theileria parva]
Length=635

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDG +ILIF ETKKG D +TR+LR+DGWPAL IHG+K Q+ER WVL+EFKSG+ P+MIAT
Sbjct  454  MDGGKILIFSETKKGADTLTRELRLDGWPALCIHGDKKQEERTWVLNEFKSGKHPIMIAT  513

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVA+RGLDV+D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K ARELVK
Sbjct  514  DVASRGLDVRDVKYVINYDFPGQIEDYVHRIGRTGRAGMKGSSYTFLTPDKFKSARELVK  573

Query  411  ILQQAGQIVPPQLSALA  361
            ++++A Q +PP+L  LA
Sbjct  574  LMREANQEIPPELQKLA  590



>ref|XP_009692285.1| DEAD-box family RNA-dependent helicase [Theileria orientalis 
strain Shintoku]
 dbj|BAM41984.1| DEAD-box family RNA-dependent helicase [Theileria orientalis 
strain Shintoku]
Length=587

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDGS+ILIF ETKKG D +TR+LR+DGWPAL IHG+K Q+ER WVLSEFK+G+ P+MIAT
Sbjct  394  MDGSKILIFAETKKGADTLTRELRLDGWPALCIHGDKKQEERSWVLSEFKAGKHPIMIAT  453

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVA+RGLDV D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K AR+LVK
Sbjct  454  DVASRGLDVHDVKYVINYDFPAQIEDYVHRIGRTGRAGMKGSSYTFLTADKFKVARDLVK  513

Query  411  ILQQAGQIVPPQLSALA  361
            +L++A Q VP +L  LA
Sbjct  514  LLREANQPVPEELQKLA  530



>ref|XP_953213.1| DEAD-box family RNA-dependent helicase [Theileria annulata strain 
Ankara]
 emb|CAI76588.1| DEAD-box family RNA-dependent helicase, putative [Theileria annulata]
Length=616

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDG +ILIF ETKKG D +TR+LR+DGWPAL IHG+K Q+ER WVL+EFK+G+ P+MIAT
Sbjct  435  MDGGKILIFSETKKGADTLTRELRLDGWPALCIHGDKKQEERTWVLNEFKTGKHPIMIAT  494

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVA+RGLDV+D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K ARELVK
Sbjct  495  DVASRGLDVRDVKYVINYDFPGQIEDYVHRIGRTGRAGMKGSSYTFLTPDKFKSARELVK  554

Query  411  ILQQAGQIVPPQLSALA  361
            ++++A Q +PP+L  LA
Sbjct  555  LMREANQEIPPELLKLA  571



>ref|XP_003884670.1| hypothetical protein NCLIV_050680 [Neospora caninum Liverpool]
 emb|CBZ54640.1| hypothetical protein NCLIV_050680 [Neospora caninum Liverpool]
Length=578

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+ILIF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+
Sbjct  397  LRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPI  456

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT   ++ AR
Sbjct  457  MVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKSRLAR  516

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV++L+ A Q VPP+L +L 
Sbjct  517  ELVRVLRGANQPVPPELESLG  537



>ref|XP_004349647.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22559.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
Length=706

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDG RILIF +TKKG DQ+ R LR +GWPAL+IHG+K Q ER   L+EF+SGRSP+
Sbjct  441  LETIMDGGRILIFTQTKKGADQLQRALRGEGWPALAIHGDKTQQERDATLAEFRSGRSPI  500

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVAARGLDVKD++ VINYDF +  EDYVHRIGRTGRAGA GTA++FFT G+ K A+
Sbjct  501  MVATDVAARGLDVKDVRYVINYDFASTAEDYVHRIGRTGRAGATGTAYSFFTSGDFKLAK  560

Query  423  ELVKILQQAGQIVPPQLSALAC  358
             L+K+L +AGQ VPPQL   A 
Sbjct  561  RLIKVLSEAGQEVPPQLHQFAV  582



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDG RILIFVETK+GCD++ RQLR DG+PAL +HG+K+Q ER WVL EFK+G  P+M+AT
Sbjct  352  MDGRRILIFVETKRGCDELVRQLRTDGYPALGLHGDKSQQERDWVLQEFKNGTHPIMLAT  411

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVAARGLDVKDIK V+NYD P   EDYVHRIGRTGRAGA GTA++FFT+G+A+ AR++V 
Sbjct  412  DVAARGLDVKDIKVVVNYDMPKTAEDYVHRIGRTGRAGATGTAYSFFTNGDARLARQVVD  471

Query  411  ILQQAGQIVPPQL  373
            ++Q+AGQ  PP+L
Sbjct  472  VMQEAGQQPPPEL  484



>ref|XP_008885470.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Hammondia hammondi]
 gb|KEP63938.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Hammondia hammondi]
Length=550

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+ILIF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+
Sbjct  369  LRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPI  428

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + AR
Sbjct  429  MVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLAR  488

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV++L+ A Q VPP+L +L 
Sbjct  489  ELVRVLRGANQPVPPELESLG  509



>gb|EPR60274.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
GT1]
 gb|ESS30986.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
VEG]
 gb|KFG36774.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
p89]
 gb|KFG44036.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
FOU]
 gb|KFH07497.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
VAND]
Length=550

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+ILIF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+
Sbjct  369  LRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPI  428

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + AR
Sbjct  429  MVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLAR  488

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV++L+ A Q VPP+L +L 
Sbjct  489  ELVRVLRGANQPVPPELESLG  509



>ref|XP_002369028.1| DEAD/DEAH box helicase, putative [Toxoplasma gondii ME49]
 gb|EPT26653.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
ME49]
 gb|KFG31703.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
 gb|KFH16252.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
MAS]
Length=550

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+ILIF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+
Sbjct  369  LRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPI  428

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            M+ATDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + AR
Sbjct  429  MVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLAR  488

Query  423  ELVKILQQAGQIVPPQLSALA  361
            ELV++L+ A Q VPP+L +L 
Sbjct  489  ELVRVLRGANQPVPPELESLG  509



>ref|XP_002774608.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER06424.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=520

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ VMDGS++LIF +TK+G D +TR LRMDGWPAL IHG+K Q+ER WVL EFKSG+SP+
Sbjct  351  LERVMDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPI  410

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVA+RGLDVKDI+ V+NYDFP  +EDYVHRIGRTGRAG KG A+TFFT    K AR
Sbjct  411  MIATDVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTPDKIKMAR  470

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +LV+IL++A Q V P+L  L+
Sbjct  471  DLVQILREANQTVSPELERLS  491



>ref|XP_002777393.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER09209.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=515

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+I+IF +TK+  D +TR LRMDGWPALSIHG+K Q+ER WVL EFKSG+SP+
Sbjct  341  LERIMDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPI  400

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAGAKG+A++FFT    K A+
Sbjct  401  MIATDVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAK  460

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ +L++A Q VPP+L  +A
Sbjct  461  DLIGVLREAEQAVPPELEKIA  481



>ref|XP_002777392.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER09208.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=531

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ +MDGS+I+IF +TK+  D +TR LRMDGWPALSIHG+K Q+ER WVL EFKSG+SP+
Sbjct  357  LERIMDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPI  416

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAGAKG+A++FFT    K A+
Sbjct  417  MIATDVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAK  476

Query  423  ELVKILQQAGQIVPPQLSALA  361
            +L+ +L++A Q VPP+L  +A
Sbjct  477  DLIGVLREAEQAVPPELEKIA  497



>ref|XP_002771918.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03734.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=521

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+ VMDGS++LIF +TK+G D +TR LRMDGWPAL IHG+K Q+ER WVL EFKSG+SP+
Sbjct  356  LERVMDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPI  415

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFAR  424
            MIATDVA+RGLDVKDI+ V+NYDFP  +EDYVHRIGRTGRAG KG A+TFFT    K AR
Sbjct  416  MIATDVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTADKIKMAR  475

Query  423  ELVKILQQAGQIVPPQLSALA  361
             LV+IL++A Q V P+L  L+
Sbjct  476  GLVQILREANQTVSPELERLS  496



>dbj|BAN64363.1| p68-like protein [Babesia bovis]
Length=305

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -1

Query  798  QVDWTLKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKS  619
            Q+   L ++  G++ILIF +TKK  D IT++LR+DGWPALSIHG+K Q+ER WVL+EFKS
Sbjct  119  QLKKILGQIGQGTKILIFTDTKKTADSITKELRLDGWPALSIHGDKKQEERNWVLNEFKS  178

Query  618  GRSPVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGN  439
            G+ P+M+ATDVA+RGLDV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T   
Sbjct  179  GKHPIMVATDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDK  238

Query  438  AKFARELVKILQQAGQIVPPQLSALA  361
             + ARELVK++++A Q + P+LS LA
Sbjct  239  NRVARELVKLMREAKQQISPELSKLA  264



>gb|KDP40781.1| hypothetical protein JCGZ_24780 [Jatropha curcas]
Length=361

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -1

Query  783  LKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPV  604
            L+++MDG RILIF++TKKGCDQI RQLRMDGWPALS HG+K+Q ER WVLSEFK+G+SP+
Sbjct  266  LEDIMDGCRILIFMDTKKGCDQIIRQLRMDGWPALSFHGDKSQAERDWVLSEFKAGKSPI  325

Query  603  MIATDVAARGLDVKDIKCVINYDFPTCLEDYVH  505
            M ATDVAARGLDVKD+K VINYDFP  LEDYVH
Sbjct  326  MTATDVAARGLDVKDVKYVINYDFPGSLEDYVH  358



>gb|KHN25107.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=378

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 10/141 (7%)
 Frame = -1

Query  780  KEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVM  601
            +++MDGSRILIF+ TKKGCDQITRQLRMDGWPALSIHG+K+  ER WVLSEFKSG+SP  
Sbjct  233  EDIMDGSRILIFMGTKKGCDQITRQLRMDGWPALSIHGDKSHAERDWVLSEFKSGKSP--  290

Query  600  IATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARE  421
                    GLDVKD+K VINYDF   LEDYVHRIGR GRAGAKGTA+ +FT  NA+FA++
Sbjct  291  --------GLDVKDVKYVINYDFRGSLEDYVHRIGRIGRAGAKGTAYPYFTAANARFAKD  342

Query  420  LVKILQQAGQIVPPQLSALAC  358
            L+ IL++AGQ V P+L+A+  
Sbjct  343  LIAILEEAGQKVSPELAAMGS  363



>emb|CDR95325.1| p68-like protein, putative [Babesia bigemina]
Length=535

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  798  QVDWTLKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKS  619
            Q+   L ++ +G+++LIF +TKK  D +TR+LR+DGWPALSIHG+K Q+ER WVL+EFKS
Sbjct  346  QLKKILTKISEGTKVLIFADTKKTADSLTRELRLDGWPALSIHGDKKQEERNWVLNEFKS  405

Query  618  GRSPVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGN  439
            G+ P+M+ATDVA+RGLDV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T   
Sbjct  406  GKHPIMVATDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDK  465

Query  438  AKFARELVKILQQAGQIVPPQLSALA  361
             + ARELVK++++A Q + P+LS LA
Sbjct  466  GRIARELVKLMREANQTISPELSKLA  491



>gb|KIZ00407.1| ATP-dependent RNA helicase DDX5/DBP2 [Monoraphidium neglectum]
Length=552

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = -1

Query  783  LKEVMD----GSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSG  616
            LK+VM     GS++LIF ETK+GCD++TR LR +GWPAL++HG+K Q ER WVL+EFKSG
Sbjct  379  LKQVMATSGAGSKVLIFCETKRGCDEVTRSLRAEGWPALALHGDKQQRERDWVLAEFKSG  438

Query  615  RSPVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNA  436
            + P+M+ATDVAARGLDVKDIK V+N+D P   EDYVHRIGRTGRAGA GTA++FFT  N 
Sbjct  439  KHPLMLATDVAARGLDVKDIKVVVNFDMPNNAEDYVHRIGRTGRAGATGTAYSFFTAANG  498

Query  435  KFARELVKILQQAGQIVPPQLSALAC  358
            + ARE++KI+ +A Q+VP +L ++A 
Sbjct  499  RLAREIIKIMNEANQVVPTELQSIAS  524



>emb|CDJ62108.1| MGC53795 protein, related [Eimeria necatrix]
Length=216

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 35/171 (20%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDGS+IL+F ETK+G D +TR LRM+GWPALS+HG+K Q+ER WVL EFK GR+P+M+AT
Sbjct  1    MDGSKILVFAETKRGADNLTRDLRMEGWPALSLHGDKKQEERTWVLDEFKQGRNPIMVAT  60

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftff-------------  451
            DVA+RGLDVKDI+ VINYD P  +EDYVHRIGRTGRAGAKG                   
Sbjct  61   DVASRGLDVKDIRHVINYDMPNQIEDYVHRIGRTGRAGAKGQQQQQQQQQQRQQQQGPLL  120

Query  450  -------------THGNA---------KFARELVKILQQAGQIVPPQLSAL  364
                           GNA         + AR+LV++L++A Q+VPP+L AL
Sbjct  121  PLLRARRGSGRVCAGGNAYTFFTTDKQRLARDLVRVLKEASQVVPPELEAL  171



>ref|XP_002955411.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
 gb|EFJ43482.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
Length=535

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  771  MDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  592
            MDG RILIF ETK+GCD++ RQLR DG+PAL +HG+K+Q ER WVL EFK+G  P+M+AT
Sbjct  356  MDGRRILIFCETKRGCDELVRQLRTDGYPALGLHGDKSQQERDWVLQEFKNGTHPIMLAT  415

Query  591  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  412
            DVAARGLDVKDIK V+NYD P   EDYVHRIGRTGRAGA GTA++FFT  +A+ AR++V+
Sbjct  416  DVAARGLDVKDIKVVVNYDMPKTAEDYVHRIGRTGRAGAHGTAYSFFTGADARLARQVVE  475

Query  411  ILQQAGQIVPPQL  373
            ++Q+AGQ  PP+L
Sbjct  476  VMQEAGQQPPPEL  488



>ref|XP_001609970.1| p68-like protein [Babesia bovis]
 gb|EDO06402.1| p68-like protein [Babesia bovis]
Length=529

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -1

Query  798  QVDWTLKEVMDGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKS  619
            Q+   L ++  G++ILIF +TKK  D IT++LR+DGWPALSIHG+K Q+ER WVL+EFKS
Sbjct  343  QLKKILGQIGQGTKILIFTDTKKTADSITKELRLDGWPALSIHGDKKQEERNWVLNEFKS  402

Query  618  GRSPVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGN  439
            G+ P+M+ATDVA+RGLDV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T   
Sbjct  403  GKHPIMVATDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDK  462

Query  438  AKFARELVKILQQAGQIVPPQLSALA  361
             + ARELVK++++A Q + P+LS LA
Sbjct  463  NRVARELVKLMREAKQQISPELSKLA  488



>gb|ETW56550.1| hypothetical protein PFUGPA_01340 [Plasmodium falciparum Palo 
Alto/Uganda]
Length=193

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            D  RI++FVETKK  D IT+ LR+DG PAL IHG+K Q+ER WVL+EFK+G+SP+MIATD
Sbjct  25   DNDRIIVFVETKKNADFITKALRLDGMPALCIHGDKKQEERRWVLNEFKTGKSPIMIATD  84

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLD+K++K VIN+DFP  +EDYVHRIGRTGRAG+ G +FTF T    + A++LVKI
Sbjct  85   VASRGLDIKNVKYVINFDFPNQIEDYVHRIGRTGRAGSHGASFTFLTADKYRLAKDLVKI  144

Query  408  LQQAGQIVPPQLSALA  361
            L+++ Q VPPQL  ++
Sbjct  145  LRESEQPVPPQLEKIS  160



>ref|XP_003032253.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
 gb|EFI97350.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
Length=488

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D ITR LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRVADDITRYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKDI  VINYDFP   EDY+HRIGRTGRAGAKGTA+T+FT  NAK ARELV I
Sbjct  366  VASRGLDVKDIGYVINYDFPNNCEDYIHRIGRTGRAGAKGTAYTYFTTENAKSARELVSI  425

Query  408  LQQAGQIVPPQLSALAC  358
            L +A Q+VPP+L  +A 
Sbjct  426  LTEAKQVVPPELQEMAA  442



>ref|XP_736707.1| helicase [Plasmodium chabaudi chabaudi]
 emb|CAH85853.1| helicase, putative [Plasmodium chabaudi chabaudi]
Length=158

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  RI++FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATD
Sbjct  5    ENDRIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATD  64

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLD+KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKI
Sbjct  65   VASRGLDIKDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKI  124

Query  408  LQQAGQIVPPQLSALA  361
            L+++ Q +PPQL  ++
Sbjct  125  LRESEQPIPPQLEKIS  140



>ref|XP_744215.1| helicase  [Plasmodium chabaudi chabaudi]
 emb|CAH74440.1| helicase, truncated, putative [Plasmodium chabaudi chabaudi]
Length=186

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  RI++FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATD
Sbjct  18   ENDRIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATD  77

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLD+KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKI
Sbjct  78   VASRGLDIKDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKI  137

Query  408  LQQAGQIVPPQLSALA  361
            L+++ Q +PPQL  ++
Sbjct  138  LRESEQPIPPQLEKIS  153



>ref|XP_006521353.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Mus musculus]
Length=378

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  57   MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  116

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  117  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  176

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  177  ARELIKVLEEANQAINPKLMQL  198



>gb|KJA13443.1| hypothetical protein HYPSUDRAFT_73013 [Hypholoma sublateritium 
FD-334 SS-4]
Length=482

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATD
Sbjct  290  ENAKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATD  349

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  N+K ARELV I
Sbjct  350  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNSKCARELVGI  409

Query  408  LQQAGQIVPPQLSALAC  358
            L++A  IVPPQL  +A 
Sbjct  410  LKEAKAIVPPQLEEMAS  426



>ref|XP_678450.1| helicase  [Plasmodium berghei strain ANKA]
 emb|CAH99688.1| helicase, truncated, putative [Plasmodium berghei]
Length=187

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  RI++FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATD
Sbjct  18   ENDRIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATD  77

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLD+K++K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKI
Sbjct  78   VASRGLDIKNVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKI  137

Query  408  LQQAGQIVPPQLSALA  361
            L+++ Q +PPQL  ++
Sbjct  138  LRESEQPIPPQLEKIS  153



>gb|EGN99017.1| hypothetical protein SERLA73DRAFT_137127 [Serpula lacrymans var. 
lacrymans S7.3]
Length=332

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  187  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  246

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ I
Sbjct  247  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELIGI  306

Query  408  LQQAGQIVPPQLSALA  361
            L++A   VPPQL  +A
Sbjct  307  LREAKANVPPQLEEMA  322



>gb|KIM84767.1| hypothetical protein PILCRDRAFT_96565 [Piloderma croceum F 1598]
Length=482

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELVTI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A  +VPPQL  +A
Sbjct  426  LREAKAVVPPQLEEMA  441



>emb|CCM04686.1| predicted protein [Fibroporia radiculosa]
Length=755

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATD
Sbjct  572  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATD  631

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ I
Sbjct  632  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELISI  691

Query  408  LQQAGQIVPPQLSALA  361
            L++A  IVPPQL  +A
Sbjct  692  LREAKAIVPPQLEEMA  707



>gb|EXX56938.1| Dbp2p [Rhizophagus irregularis DAOM 197198w]
Length=601

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -1

Query  783  LKEVMD--GSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            L+ +MD   ++ LIF  TK+  D+IT+ LR DGWPAL+IHG+K Q ER WVLSEF+SG+S
Sbjct  432  LERIMDQKDNKTLIFTGTKRTADEITKYLRQDGWPALAIHGDKAQSERDWVLSEFRSGKS  491

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P+M+ATDVA+RG+DVKD+K VINYDFPT +EDYVHRIGRTGR GAKG+A TFFT  NAK 
Sbjct  492  PIMVATDVASRGIDVKDVKLVINYDFPTNVEDYVHRIGRTGRGGAKGSATTFFTMDNAKQ  551

Query  429  ARELVKILQQAGQIVPPQLSALA  361
            A++LV IL++A Q V P+L+ LA
Sbjct  552  AKDLVNILREANQEVDPKLADLA  574



>ref|XP_006958620.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
 gb|EIM21267.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
Length=546

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIF+ TK+  D +T+ LR DGWPAL+IHG+K Q ER WVLSEFKSGRSP+M+ATD
Sbjct  366  ENAKVLIFIGTKRIADDLTKYLRQDGWPALAIHGDKQQQERDWVLSEFKSGRSPIMLATD  425

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKDI  VINYDF + +EDY+HRIGRTGRAG KGT+ TFFT  NAK +R+LVKI
Sbjct  426  VASRGLDVKDIGYVINYDFSSNVEDYIHRIGRTGRAGTKGTSITFFTTENAKSSRDLVKI  485

Query  408  LQQAGQIVPPQLSALAC  358
            L++A Q VPP+L  +A 
Sbjct  486  LREANQNVPPELEEMAS  502



>ref|XP_729738.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21303.1| Helicase conserved C-terminal domain, putative [Plasmodium yoelii 
yoelii]
Length=212

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  RI++FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATD
Sbjct  31   ENDRIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATD  90

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLD+K++K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKI
Sbjct  91   VASRGLDIKNVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKI  150

Query  408  LQQAGQIVPPQLSALA  361
            L+++ Q +PPQL  ++
Sbjct  151  LRESEQPIPPQLEKIS  166



>ref|XP_007330446.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78570.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=494

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRIADDITKYLRTDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINI  425

Query  408  LQQAGQIVPPQLSALAC  358
            L++A  ++PPQL  +A 
Sbjct  426  LREAKAVIPPQLEEMAA  442



>ref|XP_006459201.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49124.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
Length=494

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRIADDITKYLRTDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINI  425

Query  408  LQQAGQIVPPQLSALAC  358
            L++A  ++PPQL  +A 
Sbjct  426  LREAKAVIPPQLEEMAA  442



>gb|KDQ24573.1| hypothetical protein PLEOSDRAFT_1090372 [Pleurotus ostreatus 
PC15]
Length=523

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATD
Sbjct  341  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATD  400

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK ARELV I
Sbjct  401  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKSARELVGI  460

Query  408  LQQAGQIVPPQLSALA  361
            L++A  ++PPQL  + 
Sbjct  461  LREAKAVIPPQLEEMT  476



>ref|XP_008039863.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW57832.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=494

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD++ VINYDFP   EDY+HRIGRTGRAG  GT+FT+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVRYVINYDFPNNCEDYIHRIGRTGRAGTTGTSFTYFTTDNAKQARELIGI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A  +VPPQL  ++
Sbjct  426  LKEAKAVVPPQLEEMS  441



>ref|XP_002140793.1| DEAD/DEAH box helicase family protein [Cryptosporidium muris 
RN66]
 gb|EEA06444.1| DEAD/DEAH box helicase family protein [Cryptosporidium muris 
RN66]
Length=562

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -1

Query  783  LKEVMDG--SRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            L +VM+   S++LIF ETKKG D +TR+LR++GWPAL IHG+K Q+ER WVL+EF++G S
Sbjct  388  LNQVMNSPTSKVLIFCETKKGADILTRELRLEGWPALCIHGDKKQEERTWVLNEFRNGTS  447

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P+MIATDVAARGLDVKDI  V+NYDFP  +EDY+HRIGRTGRAGA G + +FFT    + 
Sbjct  448  PIMIATDVAARGLDVKDITFVVNYDFPNQMEDYIHRIGRTGRAGASGVSLSFFTADKCRL  507

Query  429  ARELVKILQQAGQIVPPQLSALAC  358
            A +LV++L++A Q +PP+L+ L  
Sbjct  508  ANDLVRVLREAKQDIPPELTKLGT  531



>ref|XP_007008272.1| hypothetical protein TREMEDRAFT_46029 [Tremella mesenterica DSM 
1558]
 gb|EIW65766.1| hypothetical protein TREMEDRAFT_46029 [Tremella mesenterica DSM 
1558]
Length=558

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D +T+ LR DGWPAL+IHG+K Q ER WVLSEFKSGRSP+MIATD
Sbjct  374  ENAKVLIFVGTKRVADDLTKHLRTDGWPALAIHGDKQQGERDWVLSEFKSGRSPIMIATD  433

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RG+DV+DIK VINYDFP   EDYVHRIGRTGRAG  GTA+TFFT  N+K ARELV I
Sbjct  434  VASRGIDVRDIKYVINYDFPNNCEDYVHRIGRTGRAGQTGTAYTFFTADNSKSARELVGI  493

Query  408  LQQAGQIVPPQLSALA  361
            L+++   +PP+L+ +A
Sbjct  494  LRESKADIPPELAEMA  509



>gb|KIK57769.1| hypothetical protein GYMLUDRAFT_45959 [Gymnopus luxurians FD-317 
M1]
Length=492

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATD
Sbjct  306  ENAKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT+FT+FT  N+K ARELV I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSFTYFTTDNSKQARELVSI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A   +PPQL  +A
Sbjct  426  LKEAKATIPPQLEEMA  441



>ref|XP_007370735.1| DEAD-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF56503.1| DEAD-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=487

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD++ VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVRYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKQARELIGI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A   VPPQL  ++
Sbjct  426  LREAKAHVPPQLEEMS  441



>ref|XP_007414813.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
 gb|EGG01979.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
Length=537

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D +T+ LR DGWP+L+IHG+K Q ER WVL EFKSGRSP+MIATD
Sbjct  352  ESAKVLIFVGTKRVADDLTKYLRQDGWPSLAIHGDKQQTERDWVLGEFKSGRSPIMIATD  411

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYD P  +EDY+HRIGRTGRAG  GTA+++ +    K ARELVKI
Sbjct  412  VASRGLDVKDVAYVINYDMPNGIEDYIHRIGRTGRAGRTGTAYSYISADQGKLARELVKI  471

Query  408  LQQAGQIVPPQLSALAC  358
            LQ A Q+VPP L  L+ 
Sbjct  472  LQDAKQVVPPALVELSS  488



>gb|KIM24458.1| hypothetical protein M408DRAFT_75932 [Serendipita vermifera MAFF 
305830]
Length=493

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  ++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL+EFK+GRSP++IATD
Sbjct  306  ENGKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLAEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG  GTA+T+ T  N+K A ELV I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGKFGTAYTYLTTENSKIAHELVAI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A Q+VPPQL  ++
Sbjct  426  LREAKQVVPPQLEEMS  441



>gb|KIM40445.1| hypothetical protein M413DRAFT_73199 [Hebeloma cylindrosporum 
h7]
Length=489

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR +GWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVATKRVADDITKYLRQEGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELIGI  425

Query  408  LQQAGQIVPPQLSALAC  358
            L++A  IVPPQL  +A 
Sbjct  426  LREAKAIVPPQLEEMAS  442



>gb|KII89609.1| hypothetical protein PLICRDRAFT_158683 [Plicaturopsis crispa 
FD-325 SS-3]
Length=493

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RG+DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV I
Sbjct  366  VASRGIDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGNKGISYTYFTTDNAKSARELVGI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A  ++PPQL  +A
Sbjct  426  LREANAVIPPQLEEMA  441



>gb|KGB75854.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii R265]
 gb|KIR28590.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii LA55]
 gb|KIR35255.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii MMRL2647]
 gb|KIR40335.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii Ram5]
 gb|KIR93608.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii CBS 10090]
 gb|KIY58576.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii 99/473]
Length=539

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  ++LIFV TK+  D +T+ LRMDGWPAL+IHG+K Q ER WVL+EFKSGRSP+M+ATD
Sbjct  353  ENGKVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATD  412

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDV+DI  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  N+K ARELV+I
Sbjct  413  VASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKSARELVQI  472

Query  408  LQQAGQIVPPQLSALA  361
            L+++  ++PP+L  +A
Sbjct  473  LRESKAVIPPELEEMA  488



>gb|KIR99876.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii 2001/935-1]
Length=543

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  ++LIFV TK+  D +T+ LRMDGWPAL+IHG+K Q ER WVL+EFKSGRSP+M+ATD
Sbjct  357  ENGKVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATD  416

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDV+DI  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  N+K ARELV+I
Sbjct  417  VASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKSARELVQI  476

Query  408  LQQAGQIVPPQLSALA  361
            L+++  ++PP+L  +A
Sbjct  477  LRESKAVIPPELEEMA  492



>gb|KIR72047.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii CA1014]
Length=612

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            +  ++LIFV TK+  D +T+ LRMDGWPAL+IHG+K Q ER WVL+EFKSGRSP+M+ATD
Sbjct  426  ENGKVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATD  485

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDV+DI  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  N+K ARELV+I
Sbjct  486  VASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKSARELVQI  545

Query  408  LQQAGQIVPPQLSALA  361
            L+++  ++PP+L  +A
Sbjct  546  LRESKAVIPPELEEMA  561



>gb|EMS23120.1| ATP-dependent rna helicase dbp2 [Rhodosporidium toruloides NP11]
 emb|CDR46482.1| RHTO0S12e04984g1_1 [Rhodosporidium toruloides]
Length=547

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIF+ TK+  D +T+ LR DGWPAL+IHG+K Q ER WVL EFKSGRSP+MIATD
Sbjct  362  ENAKVLIFIATKRVADDLTKYLRQDGWPALAIHGDKAQQERDWVLGEFKSGRSPIMIATD  421

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKDI  VINYD P  +EDY+HRIGRTGRAGAKGTA+++ T    + A++LVKI
Sbjct  422  VASRGLDVKDIGYVINYDMPNGIEDYIHRIGRTGRAGAKGTAYSYVTPDQGRIAKDLVKI  481

Query  408  LQQAGQIVPPQLSALA  361
            LQ A Q+VPPQL  +A
Sbjct  482  LQDAKQVVPPQLQEIA  497



>ref|XP_003745440.1| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Metaseiulus 
occidentalis]
Length=510

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -1

Query  783  LKEVMDG--SRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            L+E+M+   ++ ++F ETK+  D+ITR++R DGWPA+ IHG+K Q ER WVL EF+SG+S
Sbjct  328  LEEIMNEKENKTIVFAETKRKVDEITRRMRRDGWPAMCIHGDKAQQERDWVLHEFRSGKS  387

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P+++ATDVAARGLDV D+K VINYD+P C EDYVHRIGRT R+   GTA+TFFT  NAK 
Sbjct  388  PILVATDVAARGLDVDDVKFVINYDYPNCSEDYVHRIGRTARSNKTGTAYTFFTSNNAKQ  447

Query  429  ARELVKILQQAGQIVPPQLSALA  361
            A+EL+ +LQ+A Q+V P+L  LA
Sbjct  448  AQELIDVLQEAKQVVNPKLYELA  470



>gb|KIK28896.1| hypothetical protein PISMIDRAFT_90259 [Pisolithus microcarpus 
441]
Length=484

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK ARELV I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELVSI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A   +PPQL  +A
Sbjct  426  LREARANIPPQLEEMA  441



>gb|KFP69316.1| putative ATP-dependent RNA helicase DDX17, partial [Acanthisitta 
chloris]
Length=415

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  263  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  322

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  323  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  382

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  383  ARELIKVLEEANQAINPKLMQL  404



>gb|EJU04549.1| DEAD-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
Length=486

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+ RSP++IATD
Sbjct  306  ENAKVLIFVGTKRTADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKASRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP  +EDY+HRIGRTGRAG  G ++T+FT  NAK AREL+KI
Sbjct  366  VASRGLDVKDVGYVINYDFPNNIEDYIHRIGRTGRAGNTGVSYTYFTTDNAKQARELIKI  425

Query  408  LQQAGQIVPPQL  373
            L+ A   VPPQL
Sbjct  426  LRDAQMNVPPQL  437



>gb|EDM15798.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isoform CRA_b [Rattus 
norvegicus]
Length=523

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  202  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  261

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  262  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  321

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  322  ARELIKVLEEANQAINPKLMQL  343



>gb|KIL67445.1| hypothetical protein M378DRAFT_159266 [Amanita muscaria Koide 
BX008]
Length=506

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  330  ENAKVLIFVSTKRIADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  389

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ I
Sbjct  390  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGVSYTYFTTENAKSARELLNI  449

Query  408  LQQAGQIVPPQLSALA  361
            L++A   VPPQL  +A
Sbjct  450  LREAKAAVPPQLEEMA  465



>ref|XP_004224073.1| helicase [Plasmodium cynomolgi strain B]
 dbj|GAB68126.1| helicase [Plasmodium cynomolgi strain B]
Length=465

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            D  RI++FVETKK  D IT+ LR+DG PAL IHG+K QDER WVL++FK+G+SP++IATD
Sbjct  296  DNDRIIVFVETKKNADFITKALRLDGVPALCIHGDKKQDERRWVLNDFKTGKSPILIATD  355

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLD+KD+K VIN+DFP  +EDYVHRIGRTGRAGA G +FTF T    + AR+LVKI
Sbjct  356  VASRGLDIKDVKYVINFDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLARDLVKI  415

Query  408  LQQAGQIVPPQLSALA  361
            L+++ Q VPPQL  ++
Sbjct  416  LRESEQPVPPQLEKIS  431



>ref|XP_007318616.1| hypothetical protein SERLADRAFT_449372 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO24597.1| hypothetical protein SERLADRAFT_449372 [Serpula lacrymans var. 
lacrymans S7.9]
Length=487

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELIGI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A   VPPQL  +A
Sbjct  426  LREAKANVPPQLEEMA  441



>ref|XP_002769661.1| RNA-dependent helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER02379.1| RNA-dependent helicase, putative [Perkinsus marinus ATCC 50983]
Length=310

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -1

Query  762  SRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  583
            ++ LIF +TK+G D ITR LR DGWPALSIHG+K Q ER WVL++FK+GRS +MIATDVA
Sbjct  100  AKTLIFCDTKRGADDITRLLRRDGWPALSIHGDKKQSERDWVLNQFKTGRSAIMIATDVA  159

Query  582  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  403
            +RGLDVKD+K VINYDFP  +EDYVHRIGRTGRAGA G A++FF+    K AR+LV  L+
Sbjct  160  SRGLDVKDVKYVINYDFPGTIEDYVHRIGRTGRAGASGVAYSFFSPDKGKLARQLVNCLR  219

Query  402  QAGQIVPPQLSALA  361
            +A Q VP  L  +A
Sbjct  220  EANQSVPEALETIA  233



>ref|XP_004563118.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X3 [Maylandia zebra]
Length=498

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETKK CD +TR++R DGWPA+ IHG+K+Q ER WVLSEF+SG++
Sbjct  333  MEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKA  392

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDY+HRIGRT R+  KGTA+TFFT GN + 
Sbjct  393  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTNKGTAYTFFTPGNLRQ  452

Query  429  ARELVKILQQAGQIVPPQLSALA  361
            AREL+++L++A Q + P+L  LA
Sbjct  453  ARELIRVLEEARQAINPKLLQLA  475



>ref|NP_001082679.1| DEAD (Asp-Glu-Ala-Asp) box helicase 17 [Xenopus laevis]
 gb|AAH80992.1| LOC398649 protein [Xenopus laevis]
Length=610

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD++TR++R DGWPA+ IHG+K+Q ER WVL EF++G++
Sbjct  321  MEEIMAEKENKTIIFVETKRRCDELTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKA  380

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+DIK VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  381  PILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  440

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            ARELVK+L++A Q + P+L  L
Sbjct  441  ARELVKVLEEANQTINPKLMQL  462



>ref|XP_009073300.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Acanthisitta chloris]
Length=476

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  264  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  323

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  324  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  383

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  384  ARELIKVLEEANQAINPKLMQL  405



>dbj|BAE87553.1| unnamed protein product [Macaca fascicularis]
Length=396

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKGQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>gb|EAW60248.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isoform CRA_h [Homo 
sapiens]
Length=547

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_004700310.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Echinops 
telfairi]
Length=558

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_009436590.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X3 [Pan troglodytes]
Length=549

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_004610567.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Sorex araneus]
Length=547

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_006174954.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Camelus 
ferus]
 ref|XP_006207147.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Vicugna 
pacos]
Length=549

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_010565532.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Haliaeetus leucocephalus]
Length=574

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  248  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  307

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  308  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  367

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  368  ARELIKVLEEANQAINPKLMQL  389



>ref|XP_001880766.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR08541.1| predicted protein [Laccaria bicolor S238N-H82]
Length=498

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -1

Query  768  DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  589
            + +++LIFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATD
Sbjct  306  ENAKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATD  365

Query  588  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  409
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELIGI  425

Query  408  LQQAGQIVPPQLSALA  361
            L++A   VPPQL  ++
Sbjct  426  LREAKATVPPQLEEMS  441



>ref|XP_009880187.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Charadrius 
vociferus]
Length=569

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_004311417.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Tursiops 
truncatus]
Length=549

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_008067650.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X3 [Tarsius syrichta]
Length=550

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  228  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  287

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  288  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  347

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  348  ARELIKVLEEANQAINPKLMQL  369



>ref|XP_010341891.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Saimiri 
boliviensis boliviensis]
Length=587

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  266  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  325

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  326  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  385

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  386  ARELIKVLEEANQAINPKLMQL  407



>gb|EMC76814.1| putative ATP-dependent RNA helicase DDX17, partial [Columba livia]
Length=481

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  314  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  373

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  374  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  433

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  434  ARELIKVLEEANQAINPKLMQL  455



>ref|XP_010013794.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Nestor notabilis]
Length=597

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  314  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  373

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  374  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  433

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  434  ARELIKVLEEANQAINPKLMQL  455



>ref|XP_008634834.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Corvus 
brachyrhynchos]
Length=607

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  783  LKEVM--DGSRILIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRS  610
            ++E+M    ++ +IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++
Sbjct  327  MEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKA  386

Query  609  PVMIATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKF  430
            P++IATDVA+RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K 
Sbjct  387  PILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQ  446

Query  429  ARELVKILQQAGQIVPPQLSAL  364
            AREL+K+L++A Q + P+L  L
Sbjct  447  ARELIKVLEEANQAINPKLMQL  468



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195