BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015K16

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    415   9e-142   Elaeis guineensis
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    415   1e-141   Oryza brachyantha
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     414   2e-141   Sesamum indicum [beniseed]
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                412   6e-141   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     413   9e-141   Solanum lycopersicum
gb|KJB83533.1|  hypothetical protein B456_013G252200                    410   1e-140   Gossypium raimondii
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    412   2e-140   
gb|AAL47679.1|  aminotransferase 1                                      411   3e-140   Cucumis melo [Oriental melon]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             411   3e-140   Prunus persica
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    411   3e-140   Cucumis sativus [cucumbers]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    408   4e-140   Gossypium raimondii
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     411   4e-140   Prunus mume [ume]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    411   5e-140   Solanum tuberosum [potatoes]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     410   7e-140   Gossypium hirsutum [American cotton]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     410   8e-140   Pyrus x bretschneideri [bai li]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     410   9e-140   Fragaria vesca subsp. vesca
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     410   1e-139   Nicotiana tomentosiformis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     410   1e-139   Nicotiana sylvestris
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       409   2e-139   Gossypium arboreum [tree cotton]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     409   3e-139   Malus domestica [apple tree]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    409   4e-139   Gossypium raimondii
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     409   4e-139   
gb|AAQ56192.1|  aminotransferase 1                                      409   4e-139   Cucumis melo [Oriental melon]
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                408   6e-139   Cucumis melo [Oriental melon]
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             402   7e-139   
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         408   7e-139   Ricinus communis
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      407   1e-138   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     407   2e-138   Tarenaya hassleriana [spider flower]
ref|NP_001062170.1|  Os08g0502700                                       407   2e-138   
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             403   2e-138   
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          407   3e-138   Amborella trichopoda
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     407   3e-138   Elaeis guineensis
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    406   3e-138   Sesamum indicum [beniseed]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     406   3e-138   Nelumbo nucifera [Indian lotus]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     406   3e-138   Eucalyptus grandis [rose gum]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             406   4e-138   Fritillaria agrestis
dbj|BAJ90006.1|  predicted protein                                      406   4e-138   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     406   5e-138   Phoenix dactylifera
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         405   6e-138   Jatropha curcas
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  405   9e-138   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    405   9e-138   Citrus sinensis [apfelsine]
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     404   1e-137   Peperomia schizandra
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     405   1e-137   Triticum urartu
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    405   1e-137   Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      405   1e-137   Cucumis sativus [cucumbers]
gb|ABQ81924.1|  aminotransferase 2                                      404   2e-137   Cucumis sativus [cucumbers]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       404   2e-137   Gossypium arboreum [tree cotton]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    399   2e-137   
gb|AAL62332.1|AF461048_1  aminotransferase 2                            404   2e-137   Cucumis melo [Oriental melon]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     402   4e-137   Peperomia bracteata
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             403   5e-137   Citrus clementina [clementine]
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     402   5e-137   Peperomia cerrateae
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     403   6e-137   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     402   6e-137   Peperomia cerrateae
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           403   7e-137   Cucumis melo [Oriental melon]
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     401   8e-137   Peperomia cerrateae
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             402   1e-136   Populus trichocarpa [western balsam poplar]
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     401   1e-136   Peperomia bracteata
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     400   1e-136   Peperomia cavispicata
gb|ACN39798.1|  unknown                                                 402   1e-136   Picea sitchensis
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     400   1e-136   Peperomia radiatinervosa
gb|ABK24112.1|  unknown                                                 402   2e-136   Picea sitchensis
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia bracteata
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia ayacuchoana
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia radiatinervosa
gb|ABQ81925.1|  aminotransferase 2                                      402   2e-136   Cucumis melo [Oriental melon]
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia bracteata
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     402   2e-136   Populus euphratica
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia bracteata
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     400   3e-136   Peperomia parvisagittata
gb|AFK37194.1|  unknown                                                 395   3e-136   Medicago truncatula
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     400   3e-136   Peperomia radiatinervosa
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    401   3e-136   Glycine max [soybeans]
gb|AAQ56193.1|  aminotransferase 2                                      401   4e-136   Cucumis melo [Oriental melon]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    401   4e-136   Cucumis sativus [cucumbers]
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     399   5e-136   Peperomia bracteata
ref|NP_001237048.1|  enzymatic resistance protein                       400   6e-136   
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      400   6e-136   Genlisea aurea
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     400   6e-136   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI24214.3|  unnamed protein product                                399   7e-136   Vitis vinifera
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     399   7e-136   Peperomia parvisagittata
emb|CDP08481.1|  unnamed protein product                                400   8e-136   Coffea canephora [robusta coffee]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    400   8e-136   Glycine max [soybeans]
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                400   1e-135   Medicago truncatula
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     398   1e-135   Peperomia pseudoverruculosa
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     398   1e-135   Peperomia andina
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     399   2e-135   Vitis vinifera
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    399   2e-135   Setaria italica
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     397   2e-135   Peperomia verruculosa
gb|ACN36238.1|  unknown                                                 396   2e-135   Zea mays [maize]
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     397   3e-135   Peperomia questionis
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    399   3e-135   
emb|CAN84001.1|  hypothetical protein VITISV_007680                     399   3e-135   Vitis vinifera
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     399   3e-135   Glycine soja [wild soybean]
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    399   3e-135   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      399   3e-135   Spirodela polyrhiza
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           399   4e-135   Glycine max [soybeans]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     400   4e-135   Brachypodium distachyon [annual false brome]
gb|AFK40703.1|  unknown                                                 398   4e-135   Medicago truncatula
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     397   4e-135   Peperomia verruculosa
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     396   6e-135   Peperomia bracteata
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    398   7e-135   Glycine max [soybeans]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    399   7e-135   
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     396   1e-134   Peperomia peruviana
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     396   1e-134   Peperomia parvifolia
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             397   1e-134   Phaseolus vulgaris [French bean]
ref|NP_001148339.1|  LOC100281949                                       397   1e-134   Zea mays [maize]
ref|XP_002313371.1|  aminotransferase 2 family protein                  397   2e-134   
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia rupiseda
gb|KJB54391.1|  hypothetical protein B456_009G074800                    389   3e-134   Gossypium raimondii
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    396   3e-134   Phaseolus vulgaris [French bean]
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     394   5e-134   Peperomia sp. JN-2011
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    395   5e-134   Populus euphratica
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     394   5e-134   Peperomia chutanka
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          395   6e-134   Sorghum bicolor [broomcorn]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             395   6e-134   
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     395   7e-134   Brassica rapa
emb|CDX81443.1|  BnaC09g08540D                                          395   8e-134   
emb|CDY37208.1|  BnaA09g08290D                                          395   9e-134   Brassica napus [oilseed rape]
dbj|BAJ33858.1|  unnamed protein product                                396   1e-133   Eutrema halophilum
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     393   1e-133   Peperomia aff. gracillima JN-2011
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     393   2e-133   Peperomia cyclaminoides
gb|ABK96624.1|  unknown                                                 394   2e-133   Populus trichocarpa x Populus deltoides
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     392   5e-133   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    392   8e-133   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     390   2e-132   Peperomia peruviana
emb|CDX89604.1|  BnaC03g45180D                                          391   4e-132   
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     389   4e-132   Peperomia pugnicaudex
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     388   8e-132   Peperomia polycephala
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    390   1e-131   Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     388   1e-131   Peperomia peruviana
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    389   1e-131   Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  389   3e-131   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      387   1e-130   Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             387   2e-130   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             384   3e-129   Capsella rubella
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     375   6e-127   Peperomia putlaensis
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     376   6e-127   Peperomia cyclaminoides
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    379   1e-126   Camelina sativa [gold-of-pleasure]
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     374   2e-126   Peperomia cyclaminoides
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     373   3e-126   Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     374   4e-126   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     373   7e-126   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     372   1e-125   Peperomia aff. ovatopeltata JN-2011
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     371   2e-125   Peperomia cyclaminoides
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     371   2e-125   Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     371   3e-125   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     371   3e-125   Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     369   2e-124   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     368   4e-124   Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     366   3e-123   Peperomia sp. JN-2011
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     365   8e-123   Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     365   9e-123   Peperomia exclamationis
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    358   2e-119   Cicer arietinum [garbanzo]
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     353   9e-119   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     354   2e-118   Peperomia aff. pinoi JN-2011
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                354   7e-118   Medicago truncatula
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     350   3e-117   Peperomia jalcaensis
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     350   5e-117   Peperomia elatior
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     350   5e-117   Peperomia parvisagittata
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     348   2e-116   Peperomia wernerrauhii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     347   8e-116   Peperomia schizandra
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             349   9e-116   Selaginella moellendorffii
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     347   1e-115   Peperomia cerrateae
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             348   3e-115   
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     345   4e-115   Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     344   5e-115   Peperomia dolabella
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     344   8e-115   Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     343   2e-114   Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     343   3e-114   Peperomia wernerrauhii
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     327   1e-108   Peperomia sp. JN-2011
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             330   2e-108   Selaginella moellendorffii
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                328   4e-108   Morus notabilis
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             329   6e-108   Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                  329   9e-108   
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     325   2e-107   Peperomia aff. ovatopeltata JN-2011
ref|XP_001783551.1|  predicted protein                                  327   3e-107   
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             323   7e-106   
gb|ABR16109.1|  unknown                                                 322   2e-105   Picea sitchensis
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              317   2e-105   
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                323   2e-105   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  320   7e-105   Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              315   9e-103   
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                306   1e-99    
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     298   3e-97    
gb|AEA48973.1|  glyoxylate aminotransferase                             290   8e-96    Rosa roxburghii [chestnut rose]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                293   9e-95    
ref|XP_001763095.1|  predicted protein                                  293   9e-94    
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   5e-88    
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   9e-84    Oryza sativa Indica Group [Indian rice]
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     256   6e-83    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     254   5e-82    Phaseolus vulgaris [French bean]
gb|AGN53916.1|  glyoxylate aminotransferase                             244   3e-78    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             243   8e-78    Silene latifolia
gb|AGN53915.1|  glyoxylate aminotransferase                             243   9e-78    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             242   1e-77    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             241   3e-77    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             241   4e-77    Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             241   6e-77    Silene latifolia
gb|AGN53897.1|  glyoxylate aminotransferase                             240   9e-77    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             240   1e-76    Silene vulgaris [maiden's-tears]
gb|AGN53921.1|  glyoxylate aminotransferase                             239   2e-76    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             239   2e-76    Silene vulgaris [maiden's-tears]
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     247   3e-76    Methyloceanibacter caenitepidi
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                247   5e-76    
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                245   6e-75    Methylocapsa aurea
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    243   1e-74    Methylobacterium aquaticum
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    241   8e-74    Methylocystaceae
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                240   2e-73    Methylosinus sp. LW4
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                240   3e-73    Methylosinus
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 238   8e-73    Auxenochlorella protothecoides
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                239   9e-73    Methylocaldum szegediense
gb|AEW08188.1|  hypothetical protein 2_2585_01                          230   1e-72    Pinus lambertiana
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                238   1e-72    Methylocapsa acidiphila
ref|XP_005709273.1|  serine--glyoxylate transaminase                    238   2e-72    Galdieria sulphuraria
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                237   3e-72    Methylocella silvestris
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                237   5e-72    Methylosinus
gb|AFG57258.1|  hypothetical protein 2_2585_01                          227   1e-71    Pinus taeda
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                236   2e-71    Paraburkholderia sacchari
gb|AEW08187.1|  hypothetical protein 2_2585_01                          226   2e-71    Pinus radiata
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              236   5e-71    Volvox carteri f. nagariensis
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      234   8e-71    Hyphomicrobium nitrativorans NL23
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                233   9e-71    Hyphomicrobium nitrativorans
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                233   3e-70    Methylobacterium nodulans
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                232   4e-70    Paraburkholderia phymatum
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     231   5e-70    Methylorubrum extorquens DM4
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                231   9e-70    Methylorubrum extorquens
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                231   9e-70    Methylobacteriaceae
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                231   1e-69    Methylobacterium sp. MB200
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                230   2e-69    Methylocystis parvus
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                230   2e-69    Methylorubrum populi
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                231   2e-69    Paraburkholderia terrae
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                231   2e-69    Methylobacterium sp. WSM2598
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                231   2e-69    Methylobacterium sp. 4-46
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                230   2e-69    Methylobacteriaceae
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                231   2e-69    Caballeronia glathei
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                229   4e-69    Methyloversatilis universalis
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                230   4e-69    Paraburkholderia hospita
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                230   5e-69    Burkholderia sp. UYPR1.413
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                230   5e-69    Paraburkholderia caribensis
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                229   6e-69    Burkholderiaceae
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                228   7e-69    Dongia sp. URHE0060
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                229   8e-69    Paraburkholderia mimosarum
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                228   1e-68    Methylocystis sp. ATCC 49242
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    227   3e-68    Methylobacterium
gb|KIZ03753.1|  serine--glyoxylate transaminase                         228   3e-68    Monoraphidium neglectum
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    227   5e-68    Methylibium
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                226   5e-68    Granulibacter bethesdensis
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                226   6e-68    
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                226   6e-68    Granulibacter bethesdensis
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                226   6e-68    Ferrovum
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      226   7e-68    Methylibium petroleiphilum PM1
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                226   1e-67    Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                           226   1e-67    Methylobacterium mesophilicum
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                226   1e-67    Hyphomicrobium zavarzinii
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                225   1e-67    Methyloversatilis universalis
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     226   1e-67    Granulibacter bethesdensis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        226   1e-67    Granulibacter bethesdensis CGDNIH4
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    216   1e-67    Prunus avium [gean]
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                224   3e-67    Granulibacter bethesdensis
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                225   3e-67    Paraburkholderia oxyphila
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                224   3e-67    Methylohalobius crimeensis
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                224   4e-67    Methyloversatilis discipulorum
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                224   4e-67    Methylobacterium sp. 88A
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        225   6e-67    Granulibacter bethesdensis
gb|AID30749.1|  serine--glyoxylate aminotransferase                     219   7e-67    Mesorhizobium huakuii 7653R
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                223   8e-67    Sinorhizobium fredii
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                223   8e-67    Sinorhizobium fredii
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                223   8e-67    Methyloversatilis discipulorum
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    223   8e-67    Hyphomicrobium methylovorum
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                223   9e-67    Ensifer sojae
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                223   1e-66    Rhizobium leucaenae
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                223   1e-66    Lutibaculum baratangense
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    214   1e-66    Hedera helix [English ivy]
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                218   1e-66    
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                218   2e-66    Sinorhizobium fredii
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                218   2e-66    Sinorhizobium fredii
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                218   2e-66    
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                222   2e-66    
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                222   2e-66    
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                218   2e-66    
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                222   3e-66    
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                221   4e-66    
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                221   5e-66    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                221   5e-66    
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    212   5e-66    
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                221   5e-66    
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 222   5e-66    
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    211   8e-66    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                221   9e-66    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    220   1e-65    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                219   2e-65    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                219   2e-65    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                219   2e-65    
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                220   2e-65    
emb|CAM59877.2|  alanine:glyoxylate aminotransferase                    210   2e-65    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                219   2e-65    
emb|CAM59872.1|  alanine:glyoxylate aminotransferase                    210   3e-65    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                219   4e-65    
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                219   4e-65    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                219   5e-65    
gb|AIQ91949.1|  Aminotransferase class V                                220   5e-65    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    219   5e-65    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    218   5e-65    
ref|WP_020592928.1|  hypothetical protein                               218   6e-65    
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                218   7e-65    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                218   7e-65    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                218   8e-65    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                218   8e-65    
ref|WP_020188076.1|  hypothetical protein                               218   1e-64    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    218   1e-64    
emb|CAM84338.1|  alanine:glyoxylate aminotransferase                    209   1e-64    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                217   2e-64    
emb|CAM59873.1|  alanine:glyoxylate aminotransferase                    208   2e-64    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                216   2e-64    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                217   3e-64    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                216   3e-64    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                216   7e-64    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                216   7e-64    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                216   8e-64    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                216   9e-64    
emb|CAM59868.2|  alanine:glyoxylate aminotransferase                    206   9e-64    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                215   2e-63    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                214   2e-63    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                214   2e-63    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                214   2e-63    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   4e-63    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                213   5e-63    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            213   5e-63    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                213   6e-63    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                213   6e-63    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                213   6e-63    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                213   7e-63    
emb|CAM59871.2|  alanine:glyoxylate aminotransferase                    204   7e-63    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 214   8e-63    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                213   8e-63    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 214   8e-63    
emb|CAM59869.2|  alanine:glyoxylate aminotransferase                    204   9e-63    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                213   9e-63    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                212   1e-62    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                212   1e-62    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                212   1e-62    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                212   2e-62    
emb|CAM59870.2|  alanine:glyoxylate aminotransferase                    202   3e-62    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   4e-62    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                211   4e-62    
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     208   4e-62    
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     208   4e-62    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   4e-62    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   4e-62    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   5e-62    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   6e-62    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   6e-62    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   6e-62    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                211   7e-62    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                210   7e-62    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 211   8e-62    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                210   8e-62    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                210   9e-62    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                209   1e-61    
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     207   1e-61    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_020058450.1|  hypothetical protein                               210   1e-61    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                210   1e-61    
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     206   1e-61    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                209   1e-61    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    209   2e-61    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                209   2e-61    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    210   2e-61    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                209   3e-61    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         209   3e-61    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                209   3e-61    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                209   3e-61    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                208   4e-61    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                208   4e-61    
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     205   5e-61    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                208   5e-61    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                208   5e-61    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                208   6e-61    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    208   6e-61    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    208   6e-61    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      208   6e-61    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                208   7e-61    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                207   7e-61    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                207   8e-61    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                207   9e-61    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    207   1e-60    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              208   1e-60    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                207   1e-60    
gb|EEE42985.1|  aminotransferase, class V superfamily                   206   2e-60    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                206   2e-60    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                206   2e-60    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                206   2e-60    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                206   2e-60    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                206   3e-60    
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     202   4e-60    
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                205   6e-60    
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                205   6e-60    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             207   8e-60    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                205   9e-60    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                205   9e-60    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                203   4e-59    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    203   4e-59    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                203   4e-59    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                203   4e-59    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     203   5e-59    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                203   6e-59    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                203   6e-59    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                202   6e-59    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                202   7e-59    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                202   8e-59    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    202   9e-59    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    202   9e-59    
ref|WP_039135088.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                201   3e-58    
gb|KIX16576.1|  serine--glyoxylate aminotransferase                     201   3e-58    
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                201   4e-58    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                200   5e-58    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                201   5e-58    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                200   6e-58    
ref|WP_010686651.1|  serine--glyoxylate transaminase                    200   8e-58    
ref|WP_007427777.1|  serine--glyoxylate aminotransferase                200   8e-58    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                200   8e-58    
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                199   9e-58    
ref|WP_011540013.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_039523955.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_020950386.1|  serine-glyoxylate transaminase                     199   1e-57    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   415 bits (1067),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/224 (93%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  358  QLLGCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/224 (93%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  179  SSICAVDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWADY  238

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTRLGTATRLAV+AWGLKNC
Sbjct  239  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKNC  298

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  299  TQKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  358

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 221/224 (99%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGIDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTRLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   412 bits (1058),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA SVRVFFDW DY
Sbjct  136  SSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTATSVRVFFDWNDY  195

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRL  ATRLAV AWGLKNC
Sbjct  196  LKFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLAKATRLAVDAWGLKNC  255

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  256  TQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  315

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  316  QLLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   413 bits (1061),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/224 (93%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   410 bits (1055),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DY
Sbjct  119  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDY  178

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNC
Sbjct  179  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNC  238

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  239  TQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  298

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  299  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   411 bits (1057),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   411 bits (1057),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNEL
Sbjct  298  TQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   411 bits (1057),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   408 bits (1048),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DY
Sbjct  83   SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDY  142

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNC
Sbjct  143  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNC  202

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  203  TQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNEL  262

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  263  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   411 bits (1057),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNEL
Sbjct  298  TQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   411 bits (1056),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/224 (93%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   410 bits (1055),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   410 bits (1054),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNEL
Sbjct  298  TQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   410 bits (1054),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  358  QLLGCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   410 bits (1053),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCAS KALEA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASQKALEATKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   409 bits (1051),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNEL
Sbjct  298  TQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   409 bits (1050),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   409 bits (1050),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  358  QLLGCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   409 bits (1050),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   408 bits (1049),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKAL ASKT+KSV+VFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALVASKTSKSVKVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   402 bits (1033),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDY
Sbjct  21   SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDY  80

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  81   LKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNC  140

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  141  TQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  200

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  201  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   408 bits (1048),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGL NC
Sbjct  238  LKFYKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   407 bits (1046),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   407 bits (1045),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   407 bits (1045),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  179  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDY  238

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNC
Sbjct  239  LKFYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNC  298

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  299  TQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  358

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QL+G L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  QLMGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   403 bits (1036),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDY
Sbjct  88   SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDY  147

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  148  LKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNC  207

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  208  TQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  267

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  268  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  311



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGIDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LRFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  358  QLLGCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK AKS+RVFFDW DY
Sbjct  179  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKMAKSLRVFFDWNDY  238

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  239  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  298

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQK+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  299  TQKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  358

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  359  QLLGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   406 bits (1044),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS KAL A+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASAKALRATKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   406 bits (1044),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   406 bits (1044),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS +VFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSYKVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY+MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL T TRLAV+AWGLKNC
Sbjct  238  LKFYQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   406 bits (1043),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALS+PTG+G +CASPKALEASKTA+S RVFFDW DY
Sbjct  178  SSICALDFRMDEWGIDVALTGSQKALSMPTGMGFICASPKALEASKTAQSARVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  358  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   406 bits (1043),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/224 (93%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            T+KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  358  QLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   406 bits (1043),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASK AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKMAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  358  QLLGCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   405 bits (1042),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA+SVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTARSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  358  QLLGCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   405 bits (1041),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  178  SSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNC
Sbjct  238  IKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   405 bits (1041),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  178  SSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNC
Sbjct  238  IKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   404 bits (1037),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 215/220 (98%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGXDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   405 bits (1040),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/224 (93%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            T KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  358  QLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   405 bits (1040),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   405 bits (1040),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R+G ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   399 bits (1025),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDY
Sbjct  39   SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDY  98

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC
Sbjct  99   LRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNC  158

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  159  CQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  218

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  219  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  262



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   404 bits (1038),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   402 bits (1033),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   403 bits (1036),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  178  SSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNC
Sbjct  238  IKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   402 bits (1032),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   403 bits (1036),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKA+EA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKAMEAAKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  358  QLLGCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   402 bits (1032),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   403 bits (1035),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  729  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  550
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  549  KFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCT  370
            KFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  369  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  190
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  189  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   401 bits (1031),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 201/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   401 bits (1030),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   400 bits (1028),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  123  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  182

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  183  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  242

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  243  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  302

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  303  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   402 bits (1033),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DY
Sbjct  178  SSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  358  QLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   400 bits (1028),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  134  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  193

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  194  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  253

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  254  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  313

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  314  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   402 bits (1033),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DY
Sbjct  178  SSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  358  QLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   400 bits (1029),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  132  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  191

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  192  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  251

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  252  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  311

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  312  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  131  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  190

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  191  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  250

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  251  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  310

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   402 bits (1032),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGVDVALTGSQK LSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVDVALTGSQKVLSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   402 bits (1032),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   400 bits (1028),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   395 bits (1015),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  726  ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK  547
            ICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLK
Sbjct  17   ICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLK  76

Query  546  FYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  367
            FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ
Sbjct  77   FYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQ  136

Query  366  KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  187
            +EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL
Sbjct  137  EEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  196

Query  186  LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            LG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  197  LGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  238



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/220 (91%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGRATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   401 bits (1030),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGV VALTGSQKALSLPTG+GIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVGVALTGSQKALSLPTGVGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   401 bits (1030),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   399 bits (1026),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   400 bits (1029),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   400 bits (1029),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALSLPTG+GI+CASPKALEA+K+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGIDVALTGSQKALSLPTGLGILCASPKALEATKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  358  QLLGCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   400 bits (1029),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFR DEWGVDVALTGSQKALSLPTG+GI+ ASPKALEA+KTAKSVRVFFDW DY
Sbjct  178  SSICALDFRQDEWGVDVALTGSQKALSLPTGMGIISASPKALEATKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLG LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  358  QLLGALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   399 bits (1026),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DY
Sbjct  151  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDY  210

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNC
Sbjct  211  LKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNC  270

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++
Sbjct  271  TQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDV  330

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  331  QLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  374



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   399 bits (1025),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   400 bits (1028),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK YK+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH RL  ATRLA++AWGLKNC
Sbjct  238  LKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   400 bits (1028),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   400 bits (1027),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 212/220 (96%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++
Sbjct  298  TQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDV  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  179  SSICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDY  238

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNC
Sbjct  239  LKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNC  298

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  299  TQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  358

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   397 bits (1020),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  132  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  191

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  192  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  251

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  252  TQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  311

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  312  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   396 bits (1018),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDY
Sbjct  105  SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDY  164

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC
Sbjct  165  LRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNC  224

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  225  CQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  284

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  285  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  328



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   397 bits (1021),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 212/218 (97%), Gaps = 0/218 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKA SLPTGIGIV ASPKA+EASK+AKS+RVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKAXSLPTGIGIVVASPKAIEASKSAKSLRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK A+SVR FFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKXAQSVRFFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++
Sbjct  298  TQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDV  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  358  QLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD+
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDH  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEA+K+AKSVRVFFDW DY
Sbjct  178  SSICAIDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKALEAAKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+L
Sbjct  298  TQKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNDL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  358  QLLGCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLGTATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  358  QLLGCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   399 bits (1024),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  358  QLLGCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   400 bits (1029),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASP+ALEASKTAKSVRVFFDWKDY
Sbjct  238  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPRALEASKTAKSVRVFFDWKDY  297

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTRLGTATR+AV+AWGLKNC
Sbjct  298  LKFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKNC  357

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  358  TQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  417

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  418  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   398 bits (1023),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  358  QLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   397 bits (1020),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  132  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  191

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+A GLKNC
Sbjct  192  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEARGLKNC  251

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  252  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  311

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  312  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   398 bits (1022),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   399 bits (1025),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  214  SSICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDY  273

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNC
Sbjct  274  LKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNC  333

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  334  TQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  393

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  394  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/220 (90%), Positives = 211/220 (96%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/220 (90%), Positives = 213/220 (97%), Gaps = 0/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D 
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDN  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNEL
Sbjct  298  TQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  358  QLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDY
Sbjct  180  SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDY  239

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC
Sbjct  240  LRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNC  299

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  300  CQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  359

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  360  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   395 bits (1015),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   389 bits (1000),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  705  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  526
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTF  60

Query  525  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  346
            WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SD
Sbjct  61   WPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSD  120

Query  345  TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  166
            TVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV
Sbjct  121  TVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180

Query  165  EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            EM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  181  EMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  215



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNC
Sbjct  238  LKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            T+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNEL
Sbjct  298  TEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  358  QLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   394 bits (1012),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   394 bits (1012),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/216 (92%), Positives = 209/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCAS KALEASK A+SVRVFFDWKDY
Sbjct  179  SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASSKALEASKAARSVRVFFDWKDY  238

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FY+MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATR AV+AWGLKNC
Sbjct  239  LRFYEMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKNC  298

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  299  CQKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  358

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  QLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   395 bits (1015),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   395 bits (1015),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   395 bits (1015),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   396 bits (1017),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  215  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  274

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  275  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  334

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  335  TQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  394

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  395  QLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   393 bits (1009),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   393 bits (1009),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGEATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKNC
Sbjct  238  LKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  298  TQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  358  QLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   392 bits (1006),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/216 (91%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   392 bits (1008),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   390 bits (1001),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/217 (90%), Positives = 208/217 (96%), Gaps = 0/217 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  82
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   391 bits (1004),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNEL
Sbjct  298  TQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   389 bits (999),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  91
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   388 bits (997),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  91
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   390 bits (1001),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   388 bits (997),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/216 (90%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/224 (85%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   389 bits (998),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDY
Sbjct  171  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDY  230

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKNC
Sbjct  231  LKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKNC  290

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL
Sbjct  291  TQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  350

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  88
            QLLGCLAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  351  QLLGCLAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  358  QLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/224 (84%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  358  QLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   375 bits (964),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVA  112
            QLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   376 bits (965),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAA  106
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NEL
Sbjct  298  TQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            QLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  358  QLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   374 bits (960),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  131  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  190

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  191  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  250

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  251  TQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  310

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAA  109
            QLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  311  QLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   373 bits (958),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  122  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  181

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  182  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNC  241

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NEL
Sbjct  242  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNEL  301

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAA  106
            QLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  302  QLLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   374 bits (959),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAA  109
            QLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   373 bits (957),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  131  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  190

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  191  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  250

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  251  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  310

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAA  109
            QLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  311  QLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   372 bits (954),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  123  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  182

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  183  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  242

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  243  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  302

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSG  118
            QLLGCL+GVEMVLKD+GYPVK GSG
Sbjct  303  QLLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   371 bits (953),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKA SLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  123  SSICALDFRMDEWGVDVALTGSQKAPSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  182

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  183  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  242

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  243  TQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  302

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAA  109
            QLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  303  QLLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   371 bits (952),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  122  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  181

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  182  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNC  241

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  242  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  301

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVA  112
            QLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  302  QLLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   371 bits (952),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  126  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  185

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  186  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  245

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  246  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  305

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVA  112
            QLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  306  QLLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   371 bits (953),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVA  112
            QLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   369 bits (948),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVKLG  124
            QLLGCL+GVEMVLKD+GYPVK G
Sbjct  323  QLLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   368 bits (945),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  132  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  191

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  192  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  251

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  252  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  311

Query  192  QLLGCLAGVEMVLKDIGYPVKLG  124
            QLLGCL+GVEMVLKD+GYPVK G
Sbjct  312  QLLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   366 bits (939),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPVK  130
            QLLGCL+GVEMVLKD+GYPVK
Sbjct  323  QLLGCLSGVEMVLKDVGYPVK  343



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   365 bits (936),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPV  133
            QLLGCL+GVEMVLKD+GYPV
Sbjct  323  QLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   365 bits (936),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVLKDIGYPV  133
            QLLGCL+GVEMVLKD+GYPV
Sbjct  323  QLLGCLSGVEMVLKDVGYPV  342



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A+DFRMDEWG+DVA+T SQKALSLPTG+GIVCASPKA+EASK A S+R +FDW  Y
Sbjct  178  SSIGALDFRMDEWGIDVAVTSSQKALSLPTGMGIVCASPKAIEASKHATSLRSYFDWNGY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH RL  ATRLAV+AWGLKNC
Sbjct  238  LKCYNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             Q +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NEL
Sbjct  298  CQNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  358  QLLGCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   353 bits (907),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  119  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  178

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  179  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  238

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  239  TQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  298

Query  192  QLLGCLAGVEMVLK  151
            QLLGCL+GVEMVLK
Sbjct  299  QLLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVL  154
            QLLGCL+GVEMVL
Sbjct  323  QLLGCLSGVEMVL  335



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 197/224 (88%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+EA+K+A SVR FFDW  Y
Sbjct  178  SSIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIEATKSATSVRSFFDWNGY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC
Sbjct  238  LKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNEL
Sbjct  298  CQKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  358  QLLGCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   350 bits (898),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  131  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  190

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  191  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  250

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  251  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  310

Query  192  QLLGCLAGVEMVL  154
            QLLGCL+GVEMVL
Sbjct  311  QLLGCLSGVEMVL  323



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVL  154
            QLLGCL+GVEMVL
Sbjct  323  QLLGCLSGVEMVL  335



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVL  154
            QLLGCL+GVEMVL
Sbjct  323  QLLGCLSGVEMVL  335



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVEMVL  154
            QLLGCL+GVEMVL
Sbjct  323  QLLGCLSGVEMVL  335



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   347 bits (889),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGV  166
            QLLGCL+GV
Sbjct  323  QLLGCLSGV  331



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   349 bits (896),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DY
Sbjct  178  SSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK C
Sbjct  238  LKFYKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            T++ EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NEL
Sbjct  298  TKRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  358  QLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   347 bits (889),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVE  163
            QLLGCL+GVE
Sbjct  323  QLLGCLSGVE  332



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DY
Sbjct  178  SSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK C
Sbjct  238  LKFYKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            T++ EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NEL
Sbjct  298  TKRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  358  QLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGVE  163
            QLLGCL+GVE
Sbjct  323  QLLGCLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  122  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  181

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  182  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  241

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  242  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  301

Query  192  QLLGCLAGVE  163
            QLLGCL+GVE
Sbjct  302  QLLGCLSGVE  311



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGV  166
            QLLGCL+GV
Sbjct  323  QLLGCLSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAG  169
            QLLGCL+G
Sbjct  323  QLLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   343 bits (879),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLGCLAGV  166
            QLLGCL+GV
Sbjct  323  QLLGCLSGV  331



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DY
Sbjct  120  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDY  179

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNC
Sbjct  180  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNC  239

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  240  TQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNEL  299

Query  192  QL  187
            QL
Sbjct  300  QL  301



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  Y
Sbjct  178  SSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C
Sbjct  238  LKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNEL
Sbjct  298  VKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QL+  LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  358  QLISALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   328 bits (841),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  298  TQKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  Y
Sbjct  178  SSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C
Sbjct  238  LKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNEL
Sbjct  298  IKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNEL  357

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QL+  LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  358  QLISALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   329 bits (843),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKAL A+K +KS RVFFDW DY
Sbjct  178  SSIGAIDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKN  376
            LKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RLG ATR AV+AWGL  
Sbjct  238  LKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLTL  297

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            CTQ  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NE
Sbjct  298  CTQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNE  357

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            LQ+LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  358  LQMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DY
Sbjct  143  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDY  202

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL V+AWGLKNC
Sbjct  203  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLXVEAWGLKNC  262

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            T KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLGN+NEL
Sbjct  263  TPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNEL  322

Query  192  QLLG  181
            QLLG
Sbjct  323  QLLG  326



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKALEA+K +KS RVFFDW DY
Sbjct  178  SSIGAIDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKN  376
            LKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RL  ATR AV+AWGL  
Sbjct  238  LKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLTL  297

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            CT+  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NE
Sbjct  298  CTKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNE  357

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            LQLLG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  358  LQLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   323 bits (828),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDY
Sbjct  178  SSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  298  TQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357

Query  192  QLL  184
              +
Sbjct  358  TFI  360



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DY
Sbjct  178  SSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNC
Sbjct  238  LKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            TQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  298  TQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDY
Sbjct  39   SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDY  98

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC
Sbjct  99   LRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNC  158

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  159  CQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  218



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DY
Sbjct  178  SSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNC
Sbjct  238  LKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  298  TQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357

Query  192  QLL  184
             L+
Sbjct  358  TLI  360



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY
Sbjct  178  SSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNC
Sbjct  238  IKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNC  297

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            TQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE+
Sbjct  298  TQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEV  357

Query  192  QL  187
              
Sbjct  358  MF  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   315 bits (806),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDY
Sbjct  180  SSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDY  239

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC
Sbjct  240  LRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNC  299

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  300  CQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  359



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 183/224 (82%), Gaps = 15/224 (7%)
 Frame = -2

Query  729  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  550
            SI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+E                YL
Sbjct  141  SIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIE--------------NGYL  186

Query  549  KFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCT  370
            K Y +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC 
Sbjct  187  KCYNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKNCC  246

Query  369  QKEE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
            Q+EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLNEL
Sbjct  247  QQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNEL  306

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  307  QLLGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  612  ALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIAR  433
               A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI R
Sbjct  107  GFSAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKR  166

Query  432  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  253
            HTRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLG
Sbjct  167  HTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLG  226

Query  252  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            LNKVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+I
Sbjct  227  LNKVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLI  286

Query  72   PSRI  61
            PSRI
Sbjct  287  PSRI  290



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   290 bits (741),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  561  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  382
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  381  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  202
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  201  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 178/224 (79%), Gaps = 19/224 (8%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A+DFRMDEWGVDV +T SQKALSL TG+GIVCA PKA+EASK+A S+R FFDW  Y
Sbjct  139  SSIGALDFRMDEWGVDVVVTSSQKALSLSTGMGIVCAGPKAIEASKSATSLRSFFDWNGY  198

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH       +L V        
Sbjct  199  LKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------KLVV--------  243

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
                EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNEL
Sbjct  244  ----EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNEL  299

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            QLLGCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  300  QLLGCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 185/225 (82%), Gaps = 1/225 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ A+DFRMD+WGVDVALTGSQKALSLPTG+GI+CAS KA+E SK AK  R +FDW +Y
Sbjct  178  SSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEY  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKN  376
            LK YK GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH RL  ATR AV+AWGL  
Sbjct  238  LKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTV  297

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +NE
Sbjct  298  CARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNE  357

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            LQLLG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  358  LQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (689),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  537  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  358
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  357  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  178
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  177  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (660),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  516  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  337
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  336  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  157
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  156  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -2

Query  705  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  526
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  525  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  346
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSD  120

Query  345  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  259
            TVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  705  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  526
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  525  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  346
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT LAV+AWGLKNCTQKEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKEEWHSD  120

Query  345  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  259
            TVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (620),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YIDS+EIVKRAWKRYN
Sbjct  121  VVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVI+RH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVISRHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YIDS+EIVK+AWKRYN
Sbjct  121  VVIPPYIDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YIDSS+IVK+AWKRYN
Sbjct  121  VVIPPYIDSSDIVKKAWKRYN  141



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (613),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YI+SSEIVK AWKRYN
Sbjct  121  VVIPPYINSSEIVKMAWKRYN  141



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DY+KFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYMKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  693  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  514
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  513  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  334
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  333  VVVPSYIDSSEIVKRAWKRYN  271
            VV+P YI+S+EIVK AWKRYN
Sbjct  121  VVIPPYINSAEIVKMAWKRYN  141



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 165/224 (74%), Gaps = 1/224 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +IDFR DEWGVD+A+TGSQK + LP G+GIVCASPKAL    TA   R +F+  D+
Sbjct  147  SSIGSIDFRFDEWGVDLAITGSQKGMMLPAGLGIVCASPKALARMDTATCTRAYFNLADH  206

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
             K    G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L + TR AV AWGL  C
Sbjct  207  FK-ANAGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSLC  265

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNEL
Sbjct  266  AKEPKWQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNEL  325

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  61
             LLG ++G EM ++D+G  V+ GSGVAAA  Y +N       R+
Sbjct  326  MLLGAISGAEMSMRDVGIQVEPGSGVAAAQEYFRNAHGAADQRL  369



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+ GSQK   LP G+ IV AS KALEA  TAK  RVFF+++D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVAGSQKGFMLPAGLAIVGASQKALEARHTAKCARVFFNFEDM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH  L +  R AV AWGLKNC
Sbjct  241  IKSNATG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKNC  299

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
              + +WFSDTVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNEL
Sbjct  300  ATEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNEL  359

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
             +LG LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  360  MVLGALAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+ALEASKTA   RVFFD+ D 
Sbjct  173  SSIGSLDFRTDEWRVDLAIAGSQKGLMLPAGLGIVCASPRALEASKTAGLKRVFFDFNDM  232

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP++ +LYGLR  L +LFEE L++V  RH  L    R AV+AWGLK C
Sbjct  233  IKANATG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKPC  291

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
              + +W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L
Sbjct  292  ATEPKWYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDL  351

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  91
             +LG + G EM + D+G  VKLGSGV AA A+ +
Sbjct  352  MVLGAIGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            S+I +IDFR +EW VD A+TGSQK L LP G+GIVCAS +ALEASKTA+  RVFFD+ D 
Sbjct  178  SAIGSIDFRAEEWRVDCAITGSQKGLMLPAGLGIVCASKRALEASKTAECRRVFFDFGDQ  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
             K    G Y+PYTP++ +LYGLR  L  + +EGL+NV ARH RL  +TR AV+AWGL  C
Sbjct  238  AKANATG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTLC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++E+W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNEL
Sbjct  297  AKEEKWYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
             LLG LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  357  MLLGALAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ ++DF+ DEWGVDVA++GSQK   LP G+ I+  S KAL+A +TAK  R +FD++D+
Sbjct  178  SSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQDH  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C
Sbjct  238  VKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL
Sbjct  297  AKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  100
             LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  357  MLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D+
Sbjct  178  SSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDH  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C
Sbjct  238  VKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL
Sbjct  297  AKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  100
             LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  357  MLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D+
Sbjct  178  SSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDH  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C
Sbjct  238  VKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL
Sbjct  297  AKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  100
             LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  357  MLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 162/223 (73%), Gaps = 1/223 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ A+ F+ D+W VDVA+TGSQKALSLPTG+GIV AS KAL+A  +AK  RV+F + D 
Sbjct  151  SSVGALPFKFDDWRVDVAVTGSQKALSLPTGLGIVAASDKALDARSSAKLKRVYFSFDDM  210

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            LK  K G   PYTP + LL+GL+A L LL  EGLDNV ARH RL   TR AV AWGLK  
Sbjct  211  LKTNKNGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHHRLAEGTRAAVAAWGLKLL  269

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++  W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL +V GKVFRIGHLGN++EL
Sbjct  270  CREPRWQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAEVQGKVFRIGHLGNMDEL  329

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  64
             L G L GVEM L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  330  MLAGALGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 159/223 (71%), Gaps = 1/223 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +IDFRMDEWG+D+ L GSQK   LP G+ ++C S KALEA  TAKS R F D +D+
Sbjct  173  SSIASIDFRMDEWGIDIGLAGSQKGFMLPAGLALLCFSQKALEARHTAKSRRCFLDIQDH  232

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +     G Y+PYTPSI LLYGLR  +DLL EEGL NV ARH RL    R AV+AWGL+ C
Sbjct  233  ITNNASG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLELC  291

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +  +W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL
Sbjct  292  ARDPKWYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNEL  351

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  64
             L   +AG EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  352  MLCSAIAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>gb|AEW08188.1| hypothetical protein 2_2585_01, partial [Pinus lambertiana]
Length=135

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = -2

Query  705  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  526
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL+FYKMGTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLRFYKMGTY  60

Query  525  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  349
            WPYTPSIQLLYGLRA LDL+  EEGLDNVIARH RLGTATRLAV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWYS  120

Query  348  DTVTAVVVPSYIDSS  304
            DTVTAV+VP YIDS+
Sbjct  121  DTVTAVIVPPYIDSA  135



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 164/216 (76%), Gaps = 1/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+AL A+KTA   RV+FD+ D 
Sbjct  173  SSIGSLDFRADEWRVDLAIAGSQKGLMLPAGLGIVCASPRALAATKTAGLKRVYFDFADM  232

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP++ +LYGLR  + +LFEE L++V  RH  L    R AV+AWGL  C
Sbjct  233  IKANATG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHPC  291

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L
Sbjct  292  AKEAKWDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDL  351

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
             +LG +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  352  MVLGAIAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +I F+MDEW VD+A+TGSQK L LP G+G+VCAS KALE SK     RVFF ++D 
Sbjct  175  SSIASIPFKMDEWKVDLAITGSQKGLMLPAGLGMVCASEKALERSKKNNLHRVFFSFEDM  234

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +    +G Y+PYTPSI LLYGL+  L +L EEGL++V  RH RL    R AV+AWGLK C
Sbjct  235  IVNNDVG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKTC  293

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +  + +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNEL
Sbjct  294  CKNPKEYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNEL  353

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
             +L  LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  354  MVLATLAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 161/219 (74%), Gaps = 1/219 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ ++DFR DEWGVD+A++GSQK L LP G+G++  S KAL ASKTA S R +FD+ D 
Sbjct  173  SSLGSLDFRQDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDDM  232

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ L    R AV+AWGL  C
Sbjct  233  IKANATG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPC  291

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL
Sbjct  292  AKEPKWYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNEL  351

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  76
             +LG LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  352  MVLGALAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D+
Sbjct  178  SSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDH  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C
Sbjct  238  VKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  297  AKESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  100
             LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  357  MLLGAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>gb|AFG57258.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57259.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57260.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57261.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57262.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57263.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57264.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57265.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57266.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57267.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57268.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57269.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57270.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57271.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57272.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57273.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57274.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57275.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
Length=135

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  705  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  526
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  525  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  349
            WPYTPSIQLLYGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVITRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  348  DTVTAVVVPSYIDSS  304
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 162/220 (74%), Gaps = 2/220 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMD+W VD+A+TGSQK L LP G+GI+C SPKAL+A +TAKS R +FD  D 
Sbjct  181  SSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAIETAKSKRCYFDLGDM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            +K    G Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH  L    R AV + WGL+ 
Sbjct  241  IKANATG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLEL  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKGPKWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  76
            L L   +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  360  LMLTSAIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>gb|AEW08187.1| hypothetical protein 2_2585_01, partial [Pinus radiata]
Length=135

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  705  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  526
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  525  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  349
            WPYTPSIQLLYGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIIRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  348  DTVTAVVVPSYIDSS  304
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 162/223 (73%), Gaps = 1/223 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A++FRMD+W VDVA+TGSQKALSLPTG+  V ASPKALEA K+AK  RV++D+ D 
Sbjct  223  SSIGALEFRMDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADM  282

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L+    G   PYTPS+ +LYG+R  + +L EEG++NV ARH RLG   R AV+ WGLK  
Sbjct  283  LRTNPSGNV-PYTPSLAMLYGMRESIKMLREEGMENVFARHHRLGEGARRAVEGWGLKLL  341

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +   W SD++T V VP  IDS++IVK A+ +Y+LSLG+GL ++ GKVFRIGHLGN+NEL
Sbjct  342  CKNPRWRSDSLTVVEVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNEL  401

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  64
             L+  LAG EM + D G P++ GSGV  A  Y Q T+ +I +R
Sbjct  402  MLVSALAGAEMAMIDAGVPIRPGSGVGKAIEYWQQTSSVIKTR  444



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWK  559
            S + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+
Sbjct  175  SGVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWE  234

Query  558  DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  379
            D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK
Sbjct  235  DMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLK  293

Query  378  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  199
             C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+
Sbjct  294  LCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALD  353

Query  198  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  67
            E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  354  EYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWK  559
            S + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+
Sbjct  172  SGVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWE  231

Query  558  DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  379
            D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK
Sbjct  232  DMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLK  290

Query  378  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  199
             C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+
Sbjct  291  LCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALD  350

Query  198  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  67
            E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  351  EYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 158/216 (73%), Gaps = 1/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D 
Sbjct  178  SSIGSIDFRASEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDM  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
             K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C
Sbjct  238  SKANATG-YFPYTPALPLLYGLRESMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W+SDTV+A++VP  I+ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L
Sbjct  297  AKEPKWYSDTVSAIMVPEGINGADVIDIAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
             LLG LAG EM + D G  ++ GSGVAAA  + + T
Sbjct  357  MLLGALAGAEMSMLDAGIKIEPGSGVAAAQQHFRET  392



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            ++    G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L    R AV + WGL+ 
Sbjct  241  VRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLEL  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +   W SDTV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPRWHSDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  360  LMLMSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFF  568
            SSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+F
Sbjct  155  SSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYF  214

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
            DW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AW
Sbjct  215  DWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAW  273

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G
Sbjct  274  GLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVG  333

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  334  DLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFF  568
            SSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+F
Sbjct  178  SSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYF  237

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
            DW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AW
Sbjct  238  DWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAW  296

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G
Sbjct  297  GLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVG  356

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  357  DLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFF  568
            SSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+F
Sbjct  178  SSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYF  237

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
            DW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AW
Sbjct  238  DWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAW  296

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G
Sbjct  297  GLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVG  356

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  357  DLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFF  568
            SSI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+F
Sbjct  178  SSIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYF  237

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
            DW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AW
Sbjct  238  DWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAW  296

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G
Sbjct  297  GLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVG  356

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  357  DLNELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  432  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  253
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  252  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  73
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  72   PSRI  61
            PSRI
Sbjct  121  PSRI  124



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 158/214 (74%), Gaps = 1/214 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA++A KT K  R +F+++D 
Sbjct  178  SSVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIDAGKTNKGRRAYFEFQDM  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L   TR AV AWGLK C
Sbjct  238  IAQNANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKTC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL
Sbjct  297  AKEPKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  91
             LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  357  MLLGAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFF  568
            SSI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+F
Sbjct  178  SSIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYF  237

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
            DW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AW
Sbjct  238  DWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAW  296

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G
Sbjct  297  GLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVG  356

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  357  DLNELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            ++    G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L +  R A+ + WGL+ 
Sbjct  241  VRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRAAITEGWGLEV  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  360  LMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 157/216 (73%), Gaps = 1/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D 
Sbjct  178  SSIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDM  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
             K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C
Sbjct  238  SKANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L
Sbjct  297  AKEPKWYSDTVSAIMVPEGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
             LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  357  MLLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 157/216 (73%), Gaps = 1/216 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D 
Sbjct  178  SSIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDM  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
             K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C
Sbjct  238  SKANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L
Sbjct  297  AKEPKWYSDTVSAIMVPDGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
             LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  357  MLLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFF  568
            SSI ++ F+ DEW VD A+ GSQK L LP G+G++C S +AL+A+     +  +  RV+F
Sbjct  178  SSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQRALKAAEGQSGRNDRLARVYF  237

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
            DW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AW
Sbjct  238  DWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAW  296

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G
Sbjct  297  GLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVG  356

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  357  DLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 157/213 (74%), Gaps = 2/213 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMD+W VD+A+TGSQK L LP G+GI+C S KAL+AS+TA S R +FD  D 
Sbjct  181  SSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSQKALKASETATSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            +K    G Y+PYTP++ LLYGLR  LDLLFEEGLDNV ARH  L    R A+ + W L  
Sbjct  241  IKANATG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHHYLAQGVRAAITEGWDLGV  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPKWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  97
            L L+G +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  360  LMLMGAIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 156/219 (71%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ +IDFRMDEWGVD A++GSQK   LP G+GI+  SPKAL+A +TA S R +FD  D 
Sbjct  176  SSLVSIDFRMDEWGVDCAVSGSQKGFMLPAGMGILGVSPKALKAMETATSRRCYFDLGDM  235

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQ-AWGLKN  376
            LK    G Y+PYTPSI +LYG+R  L+ +FEEGL+N+ ARH  L +  R AVQ  W L  
Sbjct  236  LKNNATG-YFPYTPSIPMLYGMRESLNTIFEEGLENIFARHNYLASGVRAAVQEGWKLNL  294

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  EW+SDTV+A++VP   D+++++  A+ +YNLSLG GL+KVAGKVFRIGHLG+LN 
Sbjct  295  CAKAPEWYSDTVSAILVPEGFDATKVISNAYAKYNLSLGAGLSKVAGKVFRIGHLGDLNA  354

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V  GSGVAAAS Y +   P
Sbjct  355  LSLMSAIAGAEMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ 
Sbjct  241  VRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEV  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  360  LMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            ++    G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L +  R AV + WGL  
Sbjct  241  VRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLASGVRAAVTEGWGLSL  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +   W SDTV+A+VVP  ++ ++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPRWHSDTVSAIVVPEGVNGAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V  GSGV AA  Y +  TP
Sbjct  360  LMLMSAIAGAEMAMLDAGIDVCPGSGVGAAGQYWRTHTP  398



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ 
Sbjct  241  VRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEV  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  360  LMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D 
Sbjct  181  SSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ 
Sbjct  241  VRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEV  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  79
            L L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  360  LMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028097617.1| serine--glyoxylate aminotransferase [Dongia sp. URHE0060]
Length=397

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 154/215 (72%), Gaps = 1/215 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI +IDFRMDEWGVD+A+ GSQK   LP G+ I+C SPKAL+ +K +K  R +FD+ D 
Sbjct  173  SSIASIDFRMDEWGVDIAVCGSQKGFMLPGGLAILCVSPKALDTAKNSKLHRCYFDFADM  232

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +K  K G ++PYTP +QL+ GLR  +D+L  EGL+NV ARH RLG   R AV AW +K  
Sbjct  233  IKTNKDG-FFPYTPPMQLIRGLRTSVDMLLSEGLENVFARHHRLGEGVRRAVAAWNMKLV  291

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +++ W SDTV+A+ +    DS+ +V+ A++RY LSLG+GL ++ GKVFRIGHLG+LNEL
Sbjct  292  AKEKRWQSDTVSAIQITDGFDSNSLVRHAYRRYGLSLGVGLARLNGKVFRIGHLGDLNEL  351

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  88
             +L  L GVE+ ++D+G P+K GSGV AA  Y   
Sbjct  352  MVLSALGGVELAMRDVGVPIKAGSGVGAAVDYFHQ  386



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI  IDFRMD+W VD+A+TGSQK L LP G+GI+CASPKAL+A + A+S R +FD  D 
Sbjct  181  SSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCASPKALKAMEHAQSRRCYFDLGDM  240

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            +K    G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L    R AV + WGL+ 
Sbjct  241  IKANATG-YFPYTPALSLLYGLRASLDLLFEEGLDNVFARHHYLAAGVRAAVTEGWGLEL  299

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W SDTVTA+VVP   +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  300  CAKAPKWHSDTVTAIVVPQGFNAAHVIDTAFRRYNLALGAGLSKVAGKVFRIGHLGDLNE  359

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  97
            L L   ++G EM + D+G  V+ GSG  AA+ Y
Sbjct  360  LMLTSAISGAEMAMLDVGIDVRPGSGTGAATQY  392



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 157/214 (73%), Gaps = 1/214 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA+E  KT K  R +F+++D 
Sbjct  178  SSVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIEKGKTNKGRRAYFEFQDM  237

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK C
Sbjct  238  IAQNANG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLAEGCRAAVAAWGLKTC  296

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL
Sbjct  297  AKEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNEL  356

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  91
             LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  357  MLLGAIAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 160/221 (72%), Gaps = 6/221 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK--TAKSVRV---FF  568
            SSI ++ F+MDEWGVD A+ GSQK   LP G+G++C SPKAL+ ++  T ++ R+   +F
Sbjct  178  SSIGSLPFKMDEWGVDCAIAGSQKGFMLPAGLGLICISPKALKIAEGGTGRNDRLGHAYF  237

Query  567  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  388
             WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AW
Sbjct  238  AWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAW  296

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG
Sbjct  297  GLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLG  356

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  85
            +LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  357  DLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>gb|KIZ03753.1| serine--glyoxylate transaminase [Monoraphidium neglectum]
Length=425

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 158/223 (71%), Gaps = 1/223 (0%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SSI A++F+ D+W VDVA+TGSQKALSLPTG+ ++C S KAL+A KTAK  R+++ W D 
Sbjct  202  SSIGALEFKFDDWRVDVAVTGSQKALSLPTGLALLCVSDKALDARKTAKLPRIYYSWDDQ  261

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNC  373
            L     G   PYTPS+ LL+GL+  L LL EEG DNV+ARH RL   TR AV+ WGLK  
Sbjct  262  LNTNPSGNV-PYTPSLMLLHGLKESLALLREEGFDNVVARHHRLAEGTRKAVEGWGLKLL  320

Query  372  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  193
             +   W SD++T + VP+ IDS+ IVK A+ +YNLS+G+GL+KV GKVFRIGHLGN++EL
Sbjct  321  CKHPRWQSDSLTVIEVPAGIDSNLIVKNAYSKYNLSIGIGLSKVNGKVFRIGHLGNMDEL  380

Query  192  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  64
             +   L+G EM + D G  +  GSGV  A  Y Q T+ +IP+R
Sbjct  381  MMCSALSGAEMAMLDAGMKITPGSGVGRAIEYWQKTSKVIPTR  423



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 163/224 (73%), Gaps = 3/224 (1%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDY  553
            SS+ +IDFRMDEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ + R FFD+ D 
Sbjct  173  SSLGSIDFRMDEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESSTAPRCFFDFGDM  232

Query  552  LKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKN  376
            +K    G Y+PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R AV   W L  
Sbjct  233  IKANATG-YFPYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVRAAVLDGWKLGL  291

Query  375  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  196
            C +  +W+SDTV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNE
Sbjct  292  CAKDPKWYSDTVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKVFRIGHLGDLNE  351

Query  195  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  64
            L +LG LAG EM + D+G  ++ GSGVAAA  Y + T   +P +
Sbjct  352  LMVLGALAGAEMSMLDVGIKIEPGSGVAAAQKYFR-THDNVPKK  394



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 6/217 (3%)
 Frame = -2

Query  732  SSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS----VRVFFD  565
            SSI +IDFRMD+W VD  +TGSQK L LP G+GI   S KALEA K A++     RV+FD
Sbjct  173  SSIGSIDFRMDDWKVDAIITGSQKGLMLPAGLGIAVVSQKALEAQKAARANNPLRRVYFD  232

Query  564  WKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAW  388
            ++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+AW
Sbjct  233  FEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAW  291

Query  387  GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  208
            GL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG
Sbjct  292  GLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLG  351

Query  207  NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  97
            +LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  352  DLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485