BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015K03

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004242955.1|  PREDICTED: probable chlorophyll(ide) b reduc...    355   8e-117   Solanum lycopersicum
ref|XP_006360473.1|  PREDICTED: probable chlorophyll(ide) b reduc...    355   1e-116   Solanum tuberosum [potatoes]
ref|XP_006451159.1|  hypothetical protein CICLE_v10008039mg             350   2e-116   
gb|KDO50906.1|  hypothetical protein CISIN_1g010380mg                   349   2e-116   Citrus sinensis [apfelsine]
ref|XP_010323446.1|  PREDICTED: probable chlorophyll(ide) b reduc...    355   2e-116   Solanum lycopersicum
ref|XP_006451161.1|  hypothetical protein CICLE_v10008039mg             351   2e-116   
ref|XP_009770954.1|  PREDICTED: probable chlorophyll(ide) b reduc...    353   1e-115   Nicotiana sylvestris
gb|KDP33676.1|  hypothetical protein JCGZ_07247                         353   1e-115   Jatropha curcas
gb|ACH54085.1|  putative chlorophyll b reductase                        352   4e-115   Nicotiana tabacum [American tobacco]
ref|XP_009626733.1|  PREDICTED: probable chlorophyll(ide) b reduc...    352   4e-115   Nicotiana tomentosiformis
ref|XP_008795045.1|  PREDICTED: probable chlorophyll(ide) b reduc...    347   4e-115   Phoenix dactylifera
ref|XP_002514298.1|  short-chain dehydrogenase, putative                352   5e-115   Ricinus communis
gb|KJB54195.1|  hypothetical protein B456_009G025000                    344   5e-115   Gossypium raimondii
emb|CDP03330.1|  unnamed protein product                                350   1e-114   Coffea canephora [robusta coffee]
ref|XP_006451163.1|  hypothetical protein CICLE_v10008039mg             350   1e-114   Citrus clementina [clementine]
ref|XP_004162801.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   2e-114   
ref|XP_008463393.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   2e-114   Cucumis melo [Oriental melon]
ref|XP_008242653.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   2e-114   Prunus mume [ume]
gb|KDO50903.1|  hypothetical protein CISIN_1g010380mg                   350   2e-114   Citrus sinensis [apfelsine]
ref|XP_006475625.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   2e-114   Citrus sinensis [apfelsine]
gb|EMT15486.1|  Carbonyl reductase family member 4                      346   3e-114   
ref|XP_007204378.1|  hypothetical protein PRUPE_ppa004339mg             350   3e-114   Prunus persica
ref|XP_011093590.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   3e-114   
ref|XP_010915806.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   3e-114   Elaeis guineensis
ref|XP_010047726.1|  PREDICTED: probable chlorophyll(ide) b reduc...    350   3e-114   Eucalyptus grandis [rose gum]
gb|EMS48016.1|  putative chlorophyll(ide) b reductase NYC1, chlor...    347   4e-114   Triticum urartu
ref|XP_003528914.1|  PREDICTED: probable chlorophyll(ide) b reduc...    348   1e-113   
gb|AHM26648.1|  reductase NYC                                           348   1e-113   Pyrus x bretschneideri [bai li]
ref|XP_003565871.1|  PREDICTED: probable chlorophyll(ide) b reduc...    347   1e-113   Brachypodium distachyon [annual false brome]
ref|XP_011043468.1|  PREDICTED: probable chlorophyll(ide) b reduc...    348   2e-113   Populus euphratica
ref|XP_009371459.1|  PREDICTED: probable chlorophyll(ide) b reduc...    348   2e-113   Pyrus x bretschneideri [bai li]
ref|XP_002324420.2|  hypothetical protein POPTR_0018s08790g             348   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_009374020.1|  PREDICTED: probable chlorophyll(ide) b reduc...    348   2e-113   Pyrus x bretschneideri [bai li]
ref|XP_004150053.1|  PREDICTED: probable chlorophyll(ide) b reduc...    347   3e-113   Cucumis sativus [cucumbers]
ref|XP_009381052.1|  PREDICTED: probable chlorophyll(ide) b reduc...    348   4e-113   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ87391.1|  predicted protein                                      346   4e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT45005.1|  unknown                                                 338   5e-113   Xerophyta humilis
ref|XP_003534200.1|  PREDICTED: probable chlorophyll(ide) b reduc...    346   6e-113   
ref|XP_008795044.1|  PREDICTED: probable chlorophyll(ide) b reduc...    347   6e-113   Phoenix dactylifera
ref|XP_004967428.1|  PREDICTED: probable chlorophyll(ide) b reduc...    345   1e-112   Setaria italica
ref|XP_010249726.1|  PREDICTED: probable chlorophyll(ide) b reduc...    346   2e-112   Nelumbo nucifera [Indian lotus]
ref|XP_004512981.1|  PREDICTED: probable chlorophyll(ide) b reduc...    345   2e-112   Cicer arietinum [garbanzo]
ref|XP_010532859.1|  PREDICTED: probable chlorophyll(ide) b reduc...    345   2e-112   Tarenaya hassleriana [spider flower]
ref|XP_002280953.1|  PREDICTED: probable chlorophyll(ide) b reduc...    345   2e-112   Vitis vinifera
ref|XP_010656325.1|  PREDICTED: probable chlorophyll(ide) b reduc...    345   2e-112   
ref|XP_006833298.1|  hypothetical protein AMTR_s00109p00036750          345   3e-112   Amborella trichopoda
ref|XP_002457093.1|  hypothetical protein SORBIDRAFT_03g001100          345   3e-112   Sorghum bicolor [broomcorn]
ref|XP_004287406.1|  PREDICTED: probable chlorophyll(ide) b reduc...    344   3e-112   Fragaria vesca subsp. vesca
ref|XP_010688205.1|  PREDICTED: probable chlorophyll(ide) b reduc...    344   3e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001042468.1|  Os01g0227100                                       343   5e-112   
gb|EEC70221.1|  hypothetical protein OsI_00981                          343   6e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_010099589.1|  putative chlorophyll(ide) b reductase NYC1         344   6e-112   Morus notabilis
ref|XP_006645666.1|  PREDICTED: probable chlorophyll(ide) b reduc...    342   8e-112   Oryza brachyantha
gb|KHG20319.1|  hypothetical protein F383_09127                         343   9e-112   Gossypium arboreum [tree cotton]
ref|XP_008337383.1|  PREDICTED: probable chlorophyll(ide) b reduc...    343   1e-111   
gb|KJB54193.1|  hypothetical protein B456_009G025000                    343   2e-111   Gossypium raimondii
ref|XP_009409056.1|  PREDICTED: probable chlorophyll(ide) b reduc...    343   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007013167.1|  NAD(P)-binding Rossmann-fold superfamily pro...    342   4e-111   
ref|XP_007013166.1|  NAD(P)-binding Rossmann-fold superfamily pro...    342   4e-111   
ref|NP_001147506.1|  LOC100281115                                       340   1e-110   
gb|ACN31897.1|  unknown                                                 340   1e-110   Zea mays [maize]
emb|CDY67729.1|  BnaAnng25090D                                          333   2e-110   Brassica napus [oilseed rape]
gb|EPS61243.1|  hypothetical protein M569_13555                         337   3e-110   Genlisea aurea
ref|XP_003620673.1|  Oxidoreductase                                     339   3e-110   Medicago truncatula
ref|XP_007152835.1|  hypothetical protein PHAVU_004G163900g             339   4e-110   Phaseolus vulgaris [French bean]
emb|CAB41935.1|  putative protein                                       336   7e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39772.1|  hypothetical protein AALP_AA3G285600                    337   2e-109   Arabis alpina [alpine rockcress]
ref|XP_010450312.1|  PREDICTED: probable chlorophyll(ide) b reduc...    335   6e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010440670.1|  PREDICTED: probable chlorophyll(ide) b reduc...    335   6e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010435297.1|  PREDICTED: probable chlorophyll(ide) b reduc...    335   6e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010254115.1|  PREDICTED: probable chlorophyll(ide) b reduc...    336   7e-109   Nelumbo nucifera [Indian lotus]
ref|XP_002863155.1|  short-chain dehydrogenase/reductase family p...    335   9e-109   Arabidopsis lyrata subsp. lyrata
ref|NP_001190716.1|  probable chlorophyll(ide) b reductase NYC1         335   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567400.1|  probable chlorophyll(ide) b reductase NYC1            335   1e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47326.1|  BnaCnng14630D                                          335   1e-108   Brassica napus [oilseed rape]
ref|XP_006283586.1|  hypothetical protein CARUB_v10004643mg             334   2e-108   Capsella rubella
ref|XP_009139641.1|  PREDICTED: probable chlorophyll(ide) b reduc...    333   4e-108   Brassica rapa
ref|XP_009107686.1|  PREDICTED: probable chlorophyll(ide) b reduc...    333   4e-108   Brassica rapa
ref|XP_006414943.1|  hypothetical protein EUTSA_v10024970mg             333   4e-108   Eutrema salsugineum [saltwater cress]
emb|CDY01120.1|  BnaA04g06990D                                          333   1e-107   
gb|EYU18156.1|  hypothetical protein MIMGU_mgv1a0102812mg               300   2e-99    Erythranthe guttata [common monkey flower]
dbj|BAO56868.1|  chlorophyll b reductase                                296   2e-98    Egeria densa
dbj|BAH84862.1|  putative short-chain dehydrogenase/reductase           302   4e-98    Cucumis sativus [cucumbers]
gb|KCW79680.1|  hypothetical protein EUGRSUZ_C01035                     308   8e-98    Eucalyptus grandis [rose gum]
ref|XP_002988833.1|  hypothetical protein SELMODRAFT_128787             285   1e-90    
ref|XP_002964564.1|  hypothetical protein SELMODRAFT_405906             284   2e-88    
gb|ADE77501.1|  unknown                                                 268   1e-86    Picea sitchensis
ref|XP_001775957.1|  predicted protein                                  276   3e-86    
ref|XP_006451162.1|  hypothetical protein CICLE_v10008039mg             252   7e-77    
ref|XP_007013168.1|  NAD(P)-binding Rossmann-fold superfamily pro...    248   2e-75    
gb|KJB54194.1|  hypothetical protein B456_009G025000                    246   2e-74    Gossypium raimondii
ref|XP_007013169.1|  NAD(P)-binding Rossmann-fold superfamily pro...    236   7e-71    
gb|ACN27294.1|  unknown                                                 209   6e-65    Zea mays [maize]
ref|XP_006475689.1|  PREDICTED: probable chlorophyll(ide) b reduc...    186   7e-56    
gb|ADI80447.1|  putative oxidoreductase                                 151   3e-41    Aegilops uniaristata
gb|ADI80451.1|  putative oxidoreductase                                 146   2e-39    Hordeum bogdanii
gb|ADI80440.1|  putative oxidoreductase                                 146   3e-39    Aegilops comosa
gb|ADI80458.1|  putative oxidoreductase                                 146   3e-39    Aegilops speltoides subsp. speltoides [goat grass]
ref|XP_005652224.1|  NAD(P)-binding protein                             150   3e-39    Coccomyxa subellipsoidea C-169
gb|ADI80446.1|  putative oxidoreductase                                 146   3e-39    Aegilops sharonensis
gb|ADI80449.1|  putative oxidoreductase                                 144   1e-38    Triticum monococcum subsp. aegilopoides [wild einkorn]
gb|ADI80455.1|  putative oxidoreductase                                 144   1e-38    Aegilops speltoides
gb|ADI80448.1|  putative oxidoreductase                                 144   1e-38    Aegilops uniaristata
gb|ADI80441.1|  putative oxidoreductase                                 144   1e-38    Aegilops comosa
gb|ADI80438.1|  putative oxidoreductase                                 144   2e-38    Aegilops longissima
ref|XP_005847895.1|  hypothetical protein CHLNCDRAFT_57711              150   4e-38    Chlorella variabilis
gb|ADI80437.1|  putative oxidoreductase                                 142   1e-37    Aegilops comosa
gb|ADI80439.1|  putative oxidoreductase                                 142   1e-37    Aegilops comosa
ref|XP_001697080.1|  chlorophyll b reductase                            148   1e-37    Chlamydomonas reinhardtii
gb|ADI80450.1|  putative oxidoreductase                                 139   1e-36    Triticum urartu
gb|ADI80456.1|  putative oxidoreductase                                 139   1e-36    Aegilops speltoides
gb|ADI80445.1|  putative oxidoreductase                                 139   1e-36    Aegilops sharonensis
ref|XP_002948073.1|  hypothetical protein VOLCADRAFT_103703             144   2e-36    Volvox carteri f. nagariensis
gb|ADI80460.1|  putative oxidoreductase                                 137   1e-35    Aegilops speltoides subsp. speltoides [goat grass]
gb|ADI80452.1|  putative oxidoreductase                                 129   2e-33    Hordeum marinum
ref|XP_004334914.1|  oxidoreductase, short chain dehydrogenase/re...    128   1e-31    Acanthamoeba castellanii str. Neff
gb|KCW79681.1|  hypothetical protein EUGRSUZ_C01035                     129   5e-31    Eucalyptus grandis [rose gum]
gb|KDO50904.1|  hypothetical protein CISIN_1g010380mg                   125   1e-29    Citrus sinensis [apfelsine]
gb|KIZ05848.1|  chlorophyll(ide) b reductase                            124   3e-29    Monoraphidium neglectum
ref|XP_006583379.1|  PREDICTED: probable chlorophyll(ide) b reduc...    124   4e-29    Glycine max [soybeans]
tpg|DAA52781.1|  TPA: hypothetical protein ZEAMMB73_885268              117   9e-27    
ref|XP_003620674.1|  Oxidoreductase                                     117   9e-27    
ref|XP_001783689.1|  predicted protein                                  104   8e-23    
ref|XP_005537824.1|  hypothetical protein, conserved                    104   2e-22    Cyanidioschyzon merolae strain 10D
ref|XP_005716045.1|  unnamed protein product                            103   2e-22    Chondrus crispus [carageen]
ref|XP_005646276.1|  NAD(P)-binding protein                             100   2e-21    Coccomyxa subellipsoidea C-169
ref|XP_002671992.1|  predicted protein                                  103   3e-21    Naegleria gruberi strain NEG-M
ref|XP_005649562.1|  NAD(P)-binding protein                           99.4    5e-21    Coccomyxa subellipsoidea C-169
ref|XP_011396096.1|  putative chlorophyll(ide) b reductase NYC1, ...  99.4    8e-21    Auxenochlorella protothecoides
ref|XP_005851270.1|  hypothetical protein CHLNCDRAFT_33893            99.4    9e-21    Chlorella variabilis
ref|XP_005768220.1|  hypothetical protein EMIHUDRAFT_445538           97.8    3e-20    Emiliania huxleyi CCMP1516
ref|XP_005764911.1|  hypothetical protein EMIHUDRAFT_445986           97.8    3e-20    Emiliania huxleyi CCMP1516
gb|ABK24799.1|  unknown                                               97.1    6e-20    Picea sitchensis
gb|AEO19897.1|  chlorophyll(ide) b reductase                          93.6    1e-19    Pyrus x bretschneideri [bai li]
ref|XP_009035569.1|  hypothetical protein AURANDRAFT_24309            94.7    2e-19    Aureococcus anophagefferens
ref|XP_005647798.1|  NAD(P)-binding protein                           93.2    7e-19    Coccomyxa subellipsoidea C-169
ref|NP_001289228.1|  chlorophyll(ide) b reductase NOL, chloroplastic  93.2    1e-18    Pyrus x bretschneideri [bai li]
gb|KIY92204.1|  chlorophyll(ide) b reductase                          89.7    1e-18    Monoraphidium neglectum
ref|XP_008456630.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  91.7    2e-18    Cucumis melo [Oriental melon]
ref|XP_004140918.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  92.4    2e-18    Cucumis sativus [cucumbers]
ref|XP_007218803.1|  hypothetical protein PRUPE_ppa009825mg           91.3    3e-18    
ref|XP_007218802.1|  hypothetical protein PRUPE_ppa009825mg           91.3    3e-18    
ref|XP_008231784.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  91.3    5e-18    Prunus mume [ume]
emb|CDP16548.1|  unnamed protein product                              91.3    6e-18    Coffea canephora [robusta coffee]
ref|XP_002508859.1|  predicted protein                                90.9    7e-18    Micromonas commoda
ref|XP_008456629.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  91.3    7e-18    
ref|XP_010667592.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.9    8e-18    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010452392.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.9    8e-18    Camelina sativa [gold-of-pleasure]
ref|XP_010667593.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.5    8e-18    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK24930.1|  hypothetical protein AALP_AA8G043400                  90.5    9e-18    Arabis alpina [alpine rockcress]
ref|XP_011091971.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.5    9e-18    Sesamum indicum [beniseed]
dbj|BAB11512.1|  unnamed protein product                              90.5    9e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445683.1|  hypothetical protein CICLE_v10016279mg           89.7    1e-17    
gb|EJK52057.1|  hypothetical protein THAOC_28713                      90.1    1e-17    Thalassiosira oceanica
ref|XP_002871122.1|  short-chain dehydrogenase/reductase family p...  90.5    1e-17    
gb|ACR37801.1|  unknown                                               90.5    1e-17    Zea mays [maize]
ref|NP_568145.1|  chlorophyll(ide) b reductase NOL                    90.5    1e-17    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002292477.1|  predicted protein                                90.1    1e-17    Thalassiosira pseudonana CCMP1335
ref|XP_010491019.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.1    1e-17    Camelina sativa [gold-of-pleasure]
ref|XP_006289440.1|  hypothetical protein CARUB_v10002945mg           90.1    1e-17    Capsella rubella
emb|CDX80928.1|  BnaC03g01820D                                        90.1    1e-17    
ref|NP_001146883.1|  short-chain dehydrogenase/reductase SDR          89.7    2e-17    Zea mays [maize]
emb|CDY11316.1|  BnaA03g01520D                                        89.7    2e-17    Brassica napus [oilseed rape]
ref|XP_009130847.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.7    2e-17    Brassica rapa
ref|XP_003074351.1|  putative short chain dehydrogenase (ISS)         89.7    2e-17    Ostreococcus tauri
ref|XP_006398945.1|  hypothetical protein EUTSA_v10013856mg           90.1    2e-17    
ref|XP_001415854.1|  predicted protein                                89.4    2e-17    Ostreococcus lucimarinus CCE9901
dbj|BAK00206.1|  predicted protein                                    89.7    2e-17    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006485528.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.7    2e-17    Citrus sinensis [apfelsine]
ref|XP_009383124.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.7    2e-17    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006485529.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.7    2e-17    Citrus sinensis [apfelsine]
gb|KHG22371.1|  Chlorophyll (ide) b reductase NOL, chloroplastic ...  89.4    2e-17    Gossypium arboreum [tree cotton]
ref|XP_002464146.1|  hypothetical protein SORBIDRAFT_01g013080        91.3    2e-17    
gb|KJB73294.1|  hypothetical protein B456_011G226100                  89.4    3e-17    Gossypium raimondii
ref|XP_006651647.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.9    3e-17    
ref|XP_011032940.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.4    3e-17    Populus euphratica
ref|XP_011032939.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.4    3e-17    Populus euphratica
ref|XP_004986341.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  90.9    3e-17    
gb|KDP39501.1|  hypothetical protein JCGZ_04165                       89.0    4e-17    Jatropha curcas
ref|XP_007010600.1|  NYC1-like                                        89.0    4e-17    
ref|XP_010423519.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.4    4e-17    Camelina sativa [gold-of-pleasure]
ref|XP_010423518.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  89.4    4e-17    
ref|XP_002514449.1|  short-chain dehydrogenase, putative              88.6    4e-17    
ref|XP_010654105.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  88.2    4e-17    Vitis vinifera
ref|XP_010909530.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  88.6    5e-17    Elaeis guineensis
ref|XP_007133514.1|  hypothetical protein PHAVU_011G185400g           88.6    5e-17    Phaseolus vulgaris [French bean]
ref|XP_002266979.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  88.2    6e-17    Vitis vinifera
gb|EYU24451.1|  hypothetical protein MIMGU_mgv1a020679mg              88.2    6e-17    Erythranthe guttata [common monkey flower]
ref|XP_009796256.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.0    6e-17    Nicotiana sylvestris
ref|XP_004306432.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  88.2    7e-17    Fragaria vesca subsp. vesca
ref|XP_003546651.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.8    8e-17    
ref|XP_010321272.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.4    1e-16    Solanum lycopersicum
ref|XP_004239607.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.8    1e-16    Solanum lycopersicum
ref|XP_010321271.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.4    1e-16    Solanum lycopersicum
ref|XP_010321270.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.4    1e-16    Solanum lycopersicum
ref|XP_006346694.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.0    1e-16    
ref|XP_002310986.2|  hypothetical protein POPTR_0008s01480g           87.4    1e-16    
ref|XP_006346693.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.0    1e-16    Solanum tuberosum [potatoes]
ref|XP_006346691.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.0    2e-16    
ref|XP_002310976.2|  hypothetical protein POPTR_0008s01480g           87.4    2e-16    
ref|XP_002179032.1|  predicted protein                                89.7    2e-16    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010266684.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.0    2e-16    Nelumbo nucifera [Indian lotus]
ref|XP_010543634.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  87.0    2e-16    Tarenaya hassleriana [spider flower]
sp|Q84ST4.1|NOL_ORYSJ  RecName: Full=Chlorophyll(ide) b reductase...  86.7    2e-16    Oryza sativa Japonica Group [Japonica rice]
gb|KEH19223.1|  chlorophyll(ide) B reductase, putative                86.3    3e-16    Medicago truncatula
ref|XP_009611197.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  86.3    3e-16    Nicotiana tomentosiformis
ref|XP_004511171.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  85.9    3e-16    
ref|XP_009796254.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  86.3    3e-16    Nicotiana sylvestris
ref|XP_010067082.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  85.5    5e-16    Eucalyptus grandis [rose gum]
ref|XP_010103987.1|  Chlorophyll(ide) b reductase NOL                 85.5    5e-16    
gb|ABF97956.1|  myb-like DNA-binding domain, SHAQKYF class family...  86.7    8e-16    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002956541.1|  hypothetical protein VOLCADRAFT_67034            84.3    1e-15    Volvox carteri f. nagariensis
ref|XP_002505343.1|  predicted protein                                84.3    1e-15    Micromonas commoda
ref|XP_008777050.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  83.2    2e-15    
gb|KJB73296.1|  hypothetical protein B456_011G226100                  83.6    3e-15    Gossypium raimondii
ref|XP_011400485.1|  Chlorophyll(ide) b reductase NOL, chloroplastic  82.0    4e-15    Auxenochlorella protothecoides
ref|XP_005828297.1|  hypothetical protein GUITHDRAFT_74825            82.4    9e-15    Guillardia theta CCMP2712
gb|KIZ02557.1|  hypothetical protein MNEG_5398                        82.8    1e-14    Monoraphidium neglectum
ref|XP_003061611.1|  predicted protein                                80.5    2e-14    Micromonas pusilla CCMP1545
ref|XP_006856083.1|  hypothetical protein AMTR_s00059p00121300        81.3    2e-14    
ref|XP_010231930.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  81.3    2e-14    Brachypodium distachyon [annual false brome]
ref|WP_010932815.1|  short-chain dehydrogenase                        79.7    3e-14    Chlorobaculum tepidum
ref|XP_001768174.1|  predicted protein                                79.0    4e-14    
ref|XP_008344535.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  79.7    5e-14    
ref|XP_007511401.1|  predicted protein                                79.7    1e-13    Bathycoccus prasinos
ref|WP_041465674.1|  short-chain dehydrogenase                        77.8    1e-13    
gb|ACD90027.1|  short-chain dehydrogenase/reductase SDR               77.8    1e-13    Chlorobium limicola DSM 245
ref|WP_014254598.1|  alcohol dehydrogenase [                          77.4    1e-13    Hungateiclostridium clariflavum
ref|XP_003060272.1|  predicted protein                                76.6    2e-13    Micromonas pusilla CCMP1545
ref|XP_011091972.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  78.2    2e-13    
ref|XP_011397241.1|  putative chlorophyll(ide) b reductase NYC1, ...  77.4    2e-13    Auxenochlorella protothecoides
gb|KJB73295.1|  hypothetical protein B456_011G226100                  77.4    3e-13    Gossypium raimondii
ref|WP_027622787.1|  alcohol dehydrogenase [                          76.6    3e-13    Hungateiclostridium clariflavum
dbj|BAO56869.1|  chlorophyll b reductase                              74.3    3e-13    Egeria densa
gb|EMT28465.1|  Granaticin polyketide synthase putative ketoacyl ...  77.8    4e-13    
ref|XP_006598008.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  76.6    6e-13    Glycine max [soybeans]
ref|WP_012502328.1|  short-chain dehydrogenase                        75.9    8e-13    Chlorobaculum parvum
gb|EMS50882.1|  Chlorophyll(ide) b reductase NOL, chloroplastic       77.4    8e-13    Triticum urartu
ref|WP_040936382.1|  hypothetical protein                             74.7    1e-12    
ref|WP_040932739.1|  hypothetical protein                             74.7    1e-12    
ref|WP_040714435.1|  chitin-binding protein                           73.6    3e-12    Nocardia takedensis
ref|WP_009151323.1|  short-chain dehydrogenase of unknown substra...  73.9    3e-12    Thiorhodovibrio sp. 970
gb|KCW65150.1|  hypothetical protein EUGRSUZ_G02650                   73.9    5e-12    Eucalyptus grandis [rose gum]
ref|XP_009611198.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  73.9    5e-12    Nicotiana tomentosiformis
ref|WP_042455527.1|  hypothetical protein                             72.8    6e-12    Bacillus dielmoensis
ref|XP_009796255.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  73.6    6e-12    Nicotiana sylvestris
ref|XP_006598009.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  73.6    7e-12    Glycine max [soybeans]
ref|WP_018679854.1|  hypothetical protein                             72.8    8e-12    Acinetobacter tjernbergiae
ref|WP_040796361.1|  chitin-binding protein                           71.6    2e-11    Nocardia higoensis
ref|WP_019925584.1|  hypothetical protein                             71.6    2e-11    Nocardia sp. BMG111209
ref|WP_006366648.1|  short-chain dehydrogenase                        71.6    2e-11    Chlorobium ferrooxidans
ref|WP_038271853.1|  chitin-binding protein                           70.9    4e-11    
ref|WP_004691698.1|  hypothetical protein                             70.9    4e-11    Acinetobacter johnsonii
ref|WP_042897092.1|  oxidoreductase                                   70.1    7e-11    Acinetobacter
ref|XP_010067084.1|  PREDICTED: chlorophyll(ide) b reductase NOL,...  70.9    7e-11    Eucalyptus grandis [rose gum]
ref|WP_039348673.1|  chitin-binding protein                           70.1    7e-11    Mumia flava
ref|WP_017480794.1|  oxidoreductase                                   69.3    1e-10    Acinetobacter pittii
ref|WP_012473734.1|  short-chain dehydrogenase                        69.3    1e-10    Chlorobium phaeobacteroides
ref|WP_041595334.1|  short-chain dehydrogenase                        69.3    1e-10    
gb|ABM61336.1|  short-chain dehydrogenase/reductase SDR               69.3    1e-10    Halorhodospira halophila SL1
ref|WP_040816409.1|  chitin-binding protein                           68.9    2e-10    Nocardia concava
ref|WP_017386492.1|  MULTISPECIES: oxidoreductase                     68.9    2e-10    Acinetobacter
ref|WP_039814739.1|  chitin-binding protein                           68.6    2e-10    Nocardia otitidiscaviarum
ref|WP_029924783.1|  chitin-binding protein                           68.6    2e-10    Nocardia otitidiscaviarum
ref|WP_005803615.1|  oxidoreductase                                   68.9    2e-10    Acinetobacter pittii
ref|WP_002115318.1|  MULTISPECIES: KR domain protein                  68.9    2e-10    Acinetobacter calcoaceticus/baumannii complex
ref|WP_039253654.1|  oxidoreductase                                   68.6    2e-10    Acinetobacter baumannii
ref|WP_019458412.1|  oxidoreductase                                   68.6    2e-10    Acinetobacter sp. GG2
ref|WP_041466414.1|  short-chain dehydrogenase                        68.6    3e-10    
ref|WP_033229799.1|  chitin-binding protein                           68.6    3e-10    Microbulbifer agarilyticus
ref|WP_004700658.1|  hypothetical protein                             68.6    3e-10    Acinetobacter seifertii
gb|EMT16134.1|  hypothetical protein F775_28399                       65.9    3e-10    
gb|KEC83509.1|  oxidoreductase                                        68.6    3e-10    Acinetobacter sp. ETR1
ref|WP_034616168.1|  oxidoreductase                                   68.2    4e-10    Acinetobacter sp. ETR1
gb|ABB27656.1|  oxidoreductase, short-chain dehydrogenase/reducta...  68.6    4e-10    Chlorobium chlorochromatii CaD3
ref|WP_013197279.1|  oxidoreductase                                   67.8    4e-10    Acinetobacter oleivorans
gb|EPH37960.1|  short-chain dehydrogenase/reductase SDR               68.2    4e-10    Acinetobacter guillouiae MSP4-18
gb|ACI23493.1|  putative oxidoreductase                               65.5    5e-10    Secale cereale
ref|WP_004722600.1|  hypothetical protein                             67.8    5e-10    Acinetobacter guillouiae
dbj|BAP35921.1|  hypothetical protein AS4_09810                       67.8    6e-10    
ref|WP_005306924.1|  hypothetical protein                             67.8    6e-10    
ref|WP_007228963.1|  short-chain dehydrogenase                        67.0    8e-10    
ref|WP_009387709.1|  KR domain protein                                67.0    9e-10    
ref|WP_031983534.1|  MULTISPECIES: oxidoreductase                     67.0    1e-09    
ref|WP_017393774.1|  MULTISPECIES: oxidoreductase                     67.0    1e-09    
ref|WP_003650800.1|  oxidoreductase                                   67.0    1e-09    
ref|WP_004819523.1|  hypothetical protein                             67.0    1e-09    
ref|WP_004707963.1|  hypothetical protein                             66.6    1e-09    
ref|WP_017392019.1|  oxidoreductase                                   66.6    1e-09    
ref|WP_004886341.1|  MULTISPECIES: oxidoreductase                     66.6    1e-09    
ref|WP_016137633.1|  hypothetical protein                             66.6    1e-09    
ref|WP_015282035.1|  short-chain dehydrogenase                        66.2    1e-09    
ref|WP_021654791.1|  oxidoreductase, short chain dehydrogenase/re...  66.2    1e-09    
ref|WP_017388026.1|  oxidoreductase                                   66.6    2e-09    
ref|WP_005046196.1|  hypothetical protein                             66.2    2e-09    
ref|WP_005039480.1|  hypothetical protein                             66.2    2e-09    
ref|WP_033366802.1|  chitin-binding protein                           65.9    2e-09    
dbj|GAM29956.1|  short-chain dehydrogenase/reductase SDR              66.2    2e-09    
ref|WP_004643401.1|  hypothetical protein                             66.2    2e-09    
ref|WP_016805466.1|  oxidoreductase                                   66.2    2e-09    
ref|WP_005401529.1|  oxidoreductase                                   66.2    2e-09    
ref|WP_012508106.1|  short-chain dehydrogenase                        66.2    2e-09    
ref|WP_004978234.1|  hypothetical protein                             65.9    2e-09    
ref|WP_030907906.1|  hypothetical protein                             65.9    2e-09    
ref|WP_021281806.1|  hypothetical protein                             65.5    3e-09    
ref|WP_017416582.1|  alcohol dehydrogenase                            65.5    3e-09    
ref|WP_012505717.1|  short-chain dehydrogenase                        65.5    4e-09    
ref|WP_012893059.1|  chitin-binding protein                           64.7    4e-09    
ref|WP_002049109.1|  MULTISPECIES: oxidoreductase, short chain de...  65.1    5e-09    
ref|WP_035301087.1|  oxidoreductase                                   64.7    7e-09    
ref|WP_005030783.1|  hypothetical protein                             64.7    8e-09    
gb|ELW83449.1|  KR domain protein                                     64.7    8e-09    
ref|WP_027343169.1|  chitin-binding protein                           64.3    8e-09    
ref|WP_025862602.1|  hypothetical protein                             64.3    8e-09    
ref|WP_004791330.1|  hypothetical protein                             63.9    1e-08    
ref|WP_031159399.1|  chitin-binding protein                           63.5    1e-08    
ref|WP_004828182.1|  hypothetical protein                             63.9    1e-08    
ref|WP_036510430.1|  chitin-binding protein                           63.2    2e-08    
ref|WP_031577823.1|  alcohol dehydrogenase                            63.2    2e-08    
ref|WP_035445485.1|  hypothetical protein                             62.4    2e-08    
ref|WP_041471576.1|  short-chain dehydrogenase                        62.8    3e-08    
gb|ACE04302.1|  short-chain dehydrogenase/reductase SDR               62.8    4e-08    
ref|WP_012466215.1|  short-chain dehydrogenase                        62.4    4e-08    
ref|WP_020815017.1|  hypothetical protein [                           62.0    5e-08    
ref|WP_016655212.1|  hypothetical protein                             62.0    5e-08    
gb|ETO32297.1|  short-chain dehydrogenase                             61.2    2e-07    
ref|WP_030909326.1|  chitin-binding protein                           59.7    3e-07    
ref|WP_006366238.1|  short-chain dehydrogenase                        59.7    4e-07    
ref|WP_026659248.1|  hypothetical protein                             59.7    4e-07    
ref|WP_027628822.1|  alcohol dehydrogenase [                          59.3    4e-07    
ref|WP_020547807.1|  hypothetical protein                             57.4    2e-06    
ref|WP_035369456.1|  short-chain dehydrogenase                        57.0    3e-06    
ref|WP_029762715.1|  short-chain dehydrogenase                        57.0    3e-06    
gb|AHK80418.1|  short-chain dehydrogenase                             57.0    4e-06    
ref|WP_014445838.1|  chitin-binding protein                           56.2    5e-06    
ref|WP_013657222.1|  short-chain dehydrogenase/reductase SDR          56.2    6e-06    
ref|WP_041702415.1|  short-chain dehydrogenase                        55.1    8e-06    
ref|WP_015261418.1|  alcohol dehydrogenase                            55.5    1e-05    
ref|XP_003082027.1|  Short-chain dehydrogenase/reductase SDR (ISS)    55.8    1e-05    
gb|KDO52239.1|  hypothetical protein CISIN_1g033434mg                 52.4    1e-05    
ref|WP_007228991.1|  oxidoreductase, short chain dehydrogenase/re...  55.1    1e-05    
gb|ACF45658.1|  short-chain dehydrogenase/reductase SDR               54.7    2e-05    
ref|WP_013832383.1|  short-chain dehydrogenase/reductase SDR          53.1    7e-05    
gb|AJG37902.1|  short-chain dehydrogenase                             52.8    7e-05    
ref|WP_011889623.1|  short-chain dehydrogenase                        52.8    9e-05    
ref|WP_037338291.1|  hypothetical protein                             52.4    1e-04    
gb|KDD72876.1|  hypothetical protein H632_c2785p0                     49.7    1e-04    
gb|ACI23495.1|  putative oxidoreductase                               49.7    2e-04    
ref|WP_031980541.1|  oxidoreductase                                   50.8    3e-04    
gb|EKU62287.1|  oxidoreductase, short chain dehydrogenase/reducta...  50.8    3e-04    
ref|WP_031162163.1|  hypothetical protein                             51.2    3e-04    
gb|EPS61191.1|  hypothetical protein M569_13608                       48.9    8e-04    
ref|WP_012891761.1|  chlorophyll b reductase                          50.1    8e-04    



>ref|XP_004242955.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=484

 Score =   355 bits (912),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  301  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  360

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QN+QMFNIICE PETVARTLVPRMR+VKGSG+AINYLTPPRILIALV+AWLRR
Sbjct  361  LLSGSTIQNRQMFNIICEHPETVARTLVPRMRVVKGSGRAINYLTPPRILIALVTAWLRR  420

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  421  GRWFDDQGRALYAAEADRLRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  478



>ref|XP_006360473.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Solanum tuberosum]
Length=486

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  303  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  362

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QN+QMFNIICE PETVARTLVPRMR+VKGSG+AINYLTPPRILIALV+AWLRR
Sbjct  363  LLSGSTIQNRQMFNIICEHPETVARTLVPRMRVVKGSGRAINYLTPPRILIALVTAWLRR  422

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  423  GRWFDDQGRALYAAEADRLRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  480



>ref|XP_006451159.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 ref|XP_006451160.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64399.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64400.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|KDO50908.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
 gb|KDO50909.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=368

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  180  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  239

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  240  LLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  299

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  300  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  357



>gb|KDO50906.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=347

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  159  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  218

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  219  LLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  278

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  279  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  336



>ref|XP_010323446.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=505

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  322  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  381

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QN+QMFNIICE PETVARTLVPRMR+VKGSG+AINYLTPPRILIALV+AWLRR
Sbjct  382  LLSGSTIQNRQMFNIICEHPETVARTLVPRMRVVKGSGRAINYLTPPRILIALVTAWLRR  441

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  442  GRWFDDQGRALYAAEADRLRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  499



>ref|XP_006451161.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64401.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|KDO50907.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=388

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  200  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  259

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  260  LLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  319

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  320  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  377



>ref|XP_009770954.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nicotiana sylvestris]
Length=506

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  323  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  382

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QN+QMFNIICE PETVARTLVPRMR+VKGSG+AINYLTPPRILIALV+AWLRR
Sbjct  383  LLSGSTIQNRQMFNIICEHPETVARTLVPRMRVVKGSGRAINYLTPPRILIALVTAWLRR  442

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  443  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAMEMYTENTWISVFSLSVVCAFIIL  500



>gb|KDP33676.1| hypothetical protein JCGZ_07247 [Jatropha curcas]
Length=523

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECK+SKVGVHTASPGMVLTDL
Sbjct  336  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKKSKVGVHTASPGMVLTDL  395

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  396  LLSGSTLQNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  455

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  456  GRWFDDQGRALYAAEADRLRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  513



>gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum]
Length=506

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  323  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLQKECKRSKVGVHTASPGMVLTDL  382

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QN+QMFNIICE PETVARTLVPRMR+VKGSG+AINYLTPPRILIALV+AWLRR
Sbjct  383  LLSGSTIQNRQMFNIICEHPETVARTLVPRMRVVKGSGRAINYLTPPRILIALVTAWLRR  442

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  443  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAMEMYTENTWISVFSLSVVCAFIIL  500



>ref|XP_009626733.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nicotiana tomentosiformis]
Length=506

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  323  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLQKECKRSKVGVHTASPGMVLTDL  382

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QN+QMFNIICE PETVARTLVPRMR+VKGSG+AINYLTPPRILIALV+AWLRR
Sbjct  383  LLSGSTIQNRQMFNIICEHPETVARTLVPRMRVVKGSGRAINYLTPPRILIALVTAWLRR  442

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  443  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAMEMYTENTWISVFSLSVVCAFIIL  500



>ref|XP_008795045.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=367

 Score =   347 bits (889),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FN+DGAGSGGSSTPLTAVYGSTKCGLRQLQSSL  ECKRSKVGVHTASPGMVLTDL
Sbjct  180  GGHIFNLDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLNECKRSKVGVHTASPGMVLTDL  239

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  240  LLSGSTLRNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  299

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWA+SRTR SFTDAME Y ENTW+SVFSLSVVCAFIIL
Sbjct  300  GRWFDDQGRALYAAEADRLRNWAQSRTRFSFTDAMEMYAENTWLSVFSLSVVCAFIIL  357



>ref|XP_002514298.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF48252.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=517

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKECKRSKVGVHTASPGMVLTDL
Sbjct  330  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKECKRSKVGVHTASPGMVLTDL  389

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLR+
Sbjct  390  LLSGSTLKNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRQ  449

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  450  GRWFDDQGRALYAAEADRLRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  507



>gb|KJB54195.1| hypothetical protein B456_009G025000 [Gossypium raimondii]
Length=295

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  108  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  167

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFN+ICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+AL++AWLR+
Sbjct  168  LLSGSTLKNKQMFNLICELPETVARSLVPRMRVVKGAGKAINYLTPPRILLALITAWLRQ  227

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  228  GRWFDEQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  285



>emb|CDP03330.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KEC+RS VGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECRRSNVGVHTASPGMVLTDL  383

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLR 
Sbjct  384  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRW  443

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  444  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  501



>ref|XP_006451163.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64403.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
Length=512

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  383

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  384  LLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  443

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  444  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  501



>ref|XP_004162801.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Cucumis sativus]
Length=521

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KEC+RS VGVHTASPGMVLTDL
Sbjct  334  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECRRSNVGVHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+V+NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  394  LLSGSTVRNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  453

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  454  GRWFDDQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  511



>ref|XP_008463393.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Cucumis melo]
Length=521

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KEC+RS VGVHTASPGMVLTDL
Sbjct  334  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECRRSNVGVHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+V+NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  394  LLSGSTVRNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  453

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  454  GRWFDDQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  511



>ref|XP_008242653.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Prunus mume]
Length=518

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  331  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  390

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  391  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  450

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQG+A+YAAEADRLRNWAE+RTR  FTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  451  GRWFDDQGKALYAAEADRLRNWAENRTRFYFTDAMEMYTENTWVSVFSLSVVCAFIIL  508



>gb|KDO50903.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=512

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  383

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  384  LLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  443

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  444  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  501



>ref|XP_006475625.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Citrus sinensis]
Length=512

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  383

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  384  LLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  443

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  444  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  501



>gb|EMT15486.1| Carbonyl reductase family member 4 [Aegilops tauschii]
Length=405

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  218  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  277

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS+QNKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+ALV+AW+RR
Sbjct  278  LLSGSSLQNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLALVTAWVRR  337

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFI+L
Sbjct  338  GRWFDEEGRAVYAAEADRIRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIML  395



>ref|XP_007204378.1| hypothetical protein PRUPE_ppa004339mg [Prunus persica]
 gb|EMJ05577.1| hypothetical protein PRUPE_ppa004339mg [Prunus persica]
Length=515

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  328  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  387

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  388  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  447

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQG+A+YAAEADRLRNWAE+RTR  FTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  448  GRWFDDQGKALYAAEADRLRNWAENRTRFYFTDAMEMYTENTWVSVFSLSVVCAFIIL  505



>ref|XP_011093590.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Sesamum indicum]
 ref|XP_011093591.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Sesamum indicum]
Length=523

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYG+TKCGLRQLQSSL KEC++SKVG+HTASPGMVLTDL
Sbjct  336  GGHIFNMDGAGSGGSSTPLTAVYGATKCGLRQLQSSLLKECRKSKVGIHTASPGMVLTDL  395

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSSV+NKQMFNIICELPETVARTLVPRMR+VKGSG+AINYLTPPRIL+ALV+AWLRR
Sbjct  396  LLSGSSVKNKQMFNIICELPETVARTLVPRMRVVKGSGRAINYLTPPRILLALVTAWLRR  455

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  456  GRWFDDQGRALYAAEADRLRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  513



>ref|XP_010915806.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Elaeis guineensis]
Length=533

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KECKRSKVGVHTASPGMVLTDL
Sbjct  346  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKECKRSKVGVHTASPGMVLTDL  405

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  406  LLSGSTLRNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  465

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAESR R SFTDAME Y ENTWVSVFSLSVVCAFIIL
Sbjct  466  GRWFDDQGRALYAAEADRLRNWAESRARFSFTDAMEMYAENTWVSVFSLSVVCAFIIL  523



>ref|XP_010047726.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW79682.1| hypothetical protein EUGRSUZ_C01035 [Eucalyptus grandis]
Length=521

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  332  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  391

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+ +NKQMFNIICELPETVAR+LVPRMR+VKG+GKAI+YLTPPRIL+AL++AWLRR
Sbjct  392  LLSGSTTKNKQMFNIICELPETVARSLVPRMRVVKGTGKAISYLTPPRILLALITAWLRR  451

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  452  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  509



>gb|EMS48016.1| putative chlorophyll(ide) b reductase NYC1, chloroplastic [Triticum 
urartu]
Length=430

 Score =   347 bits (889),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  243  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  302

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS+QNKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+ALV+AW+RR
Sbjct  303  LLSGSSLQNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLALVTAWVRR  362

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFI+L
Sbjct  363  GRWFDEEGRAVYAAEADRIRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIML  420



>ref|XP_003528914.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN20677.1| Putative chlorophyll(ide) b reductase NYC1, chloroplastic [Glycine 
soja]
Length=514

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ SL KECKRSKVGVHTASPGMVLTDLL
Sbjct  328  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQGSLLKECKRSKVGVHTASPGMVLTDLL  387

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSGS+VQN+QMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRRG
Sbjct  388  LSGSTVQNRQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRRG  447

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFDDQGRA+YAAEADRLRNWAE R R SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  448  RWFDDQGRALYAAEADRLRNWAEDRARFSFTDAMEMYTENTWLSVFSLSVVCAFIIL  504



>gb|AHM26648.1| reductase NYC [Pyrus x bretschneideri]
Length=515

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  328  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  387

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  388  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  447

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQG+A+YAAEADRLRNWAE+RTR  FTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  448  GRWFDDQGKALYAAEADRLRNWAENRTRFYFTDAMEMYTENTWVSVFSLSVVCAFIIL  505



>ref|XP_003565871.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Brachypodium distachyon]
Length=496

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL  E KRSKVGVHTASPGMVLTDL
Sbjct  309  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMTESKRSKVGVHTASPGMVLTDL  368

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS+QNKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  369  LLSGSSLQNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  428

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  429  GRWFDEEGRAVYAAEADRIRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  486



>ref|XP_011043468.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Populus euphratica]
Length=518

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KEC+RSKVGVHTASPGMVLTDL
Sbjct  331  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKECRRSKVGVHTASPGMVLTDL  390

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLR+
Sbjct  391  LLSGSTLKNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRQ  450

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+R + SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  451  GRWFDDQGRALYAAEADRLRNWAENRAQFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  508



>ref|XP_009371459.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Pyrus x bretschneideri]
Length=515

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  328  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  387

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  388  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  447

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQG+A+YAAEADRLRNWAE+RTR  FTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  448  GRWFDDQGKALYAAEADRLRNWAENRTRFYFTDAMEMYTENTWVSVFSLSVVCAFIIL  505



>ref|XP_002324420.2| hypothetical protein POPTR_0018s08790g [Populus trichocarpa]
 gb|EEF02985.2| hypothetical protein POPTR_0018s08790g [Populus trichocarpa]
Length=518

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KECKRSKVG+HTASPGMVLTDL
Sbjct  331  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKECKRSKVGIHTASPGMVLTDL  390

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKG+GKAI+YLTPPRIL+ALV+AWLRR
Sbjct  391  LLSGSTLKNKQMFNIICELPETVARTLVPRMRVVKGTGKAISYLTPPRILLALVTAWLRR  450

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+R + SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  451  GRWFDDQGRALYAAEADRLRNWAENRAQFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  508



>ref|XP_009374020.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Pyrus x bretschneideri]
Length=520

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  333  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  392

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  393  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  452

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QG+A+YAAEADRLRNWAE+RTR  FTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  453  GRWFDEQGKALYAAEADRLRNWAENRTRFYFTDAMEMYTENTWVSVFSLSVVCAFIIL  510



>ref|XP_004150053.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65150.1| hypothetical protein Csa_1G250130 [Cucumis sativus]
Length=521

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GG +FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KEC+RS VGVHTASPGMVLTDL
Sbjct  334  GGQIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECRRSNVGVHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+V+NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  394  LLSGSTVRNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  453

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  454  GRWFDDQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  511



>ref|XP_009381052.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=538

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKECKRSKVGVHTASPGMVLTDL
Sbjct  351  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKECKRSKVGVHTASPGMVLTDL  410

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  411  LLSGSTLRNKQMFNIICELPETVARTLVPRMRVVKGNGKAINYLTPPRILLALVTAWLRR  470

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAESR R SFTDAME Y ENTWVSVFSLSVVCAFI+L
Sbjct  471  GRWFDEQGRALYAAEADRIRNWAESRARFSFTDAMEMYAENTWVSVFSLSVVCAFIML  528



>dbj|BAJ87391.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  313  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  372

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS+QNKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+ALV+AW+RR
Sbjct  373  LLSGSSLQNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLALVTAWVRR  432

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESRTR SFTDAME YTENTWVSVFSLSVVCAFI+L
Sbjct  433  GRWFDEEGRAVYAAEADRIRNWAESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIML  490



>gb|AAT45005.1| unknown [Xerophyta humilis]
Length=258

 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGL+QLQ SL  ECK SKVG+HTASPGMVLTDL
Sbjct  71   GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLKQLQGSLVTECKGSKVGIHTASPGMVLTDL  130

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSG+AI+YLTPPRIL+ALV+AWLRR
Sbjct  131  LLSGSSLRNKQMFNIICELPETVARTLVPRMRVVKGSGRAIDYLTPPRILLALVTAWLRR  190

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAESR R SFTDAME YT++TWVSVFSLSVVCAFIIL
Sbjct  191  GRWFDDQGRALYAAEADRLRNWAESRARFSFTDAMEMYTDSTWVSVFSLSVVCAFIIL  248



>ref|XP_003534200.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Glycine max]
 gb|KHN45640.1| Putative chlorophyll(ide) b reductase NYC1, chloroplastic [Glycine 
soja]
Length=515

 Score =   346 bits (888),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ SL KECKRSKVGVHTASPGMVLTDLL
Sbjct  329  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQGSLLKECKRSKVGVHTASPGMVLTDLL  388

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSGS+VQN+QMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+AL++AWLR+G
Sbjct  389  LSGSTVQNRQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALITAWLRQG  448

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFDDQGRA+YAAEADRLRNWAE R R SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  449  RWFDDQGRALYAAEADRLRNWAEDRARFSFTDAMEMYTENTWLSVFSLSVVCAFIIL  505



>ref|XP_008795044.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=533

 Score =   347 bits (890),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FN+DGAGSGGSSTPLTAVYGSTKCGLRQLQSSL  ECKRSKVGVHTASPGMVLTDL
Sbjct  346  GGHIFNLDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLNECKRSKVGVHTASPGMVLTDL  405

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  406  LLSGSTLRNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  465

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWA+SRTR SFTDAME Y ENTW+SVFSLSVVCAFIIL
Sbjct  466  GRWFDDQGRALYAAEADRLRNWAQSRTRFSFTDAMEMYAENTWLSVFSLSVVCAFIIL  523



>ref|XP_004967428.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Setaria italica]
Length=504

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  317  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDL  376

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  377  LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  436

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDD+GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  437  GRWFDDEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  494



>ref|XP_010249726.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nelumbo nucifera]
Length=528

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYG+TKCGLRQ Q+SL KECKRSKVGVHTASPGMVLTDL
Sbjct  341  GGHIFNMDGAGSGGSSTPLTAVYGATKCGLRQFQASLLKECKRSKVGVHTASPGMVLTDL  400

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRILIALV+AWLRR
Sbjct  401  LLSGSTLKNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILIALVTAWLRR  460

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAESR R SFTDAME YT+NTW SVFSLSVVCAFIIL
Sbjct  461  GRWFDDQGRALYAAEADRIRNWAESRARFSFTDAMEMYTDNTWFSVFSLSVVCAFIIL  518



>ref|XP_004512981.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Cicer arietinum]
Length=511

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q SL KECKRSKVGVHTASPGMVLT+LL
Sbjct  324  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQGSLLKECKRSKVGVHTASPGMVLTELL  383

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSGS+VQN+QMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRRG
Sbjct  384  LSGSTVQNRQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRRG  443

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFDD+GRA+YAAEADRLRNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  444  RWFDDEGRALYAAEADRLRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  500



>ref|XP_010532859.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Tarenaya hassleriana]
Length=507

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   SL KEC+R+KVG+HTASPGMVLTDL
Sbjct  319  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSLLKECERTKVGLHTASPGMVLTDL  378

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSG+A+NYLTPPRIL+A+V+AWLRR
Sbjct  379  LLSGSSIRNKQMFNLICELPETVARTLVPRMRVVKGSGRAVNYLTPPRILLAIVTAWLRR  438

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  439  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  496



>ref|XP_002280953.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X2 [Vitis vinifera]
 emb|CBI28069.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ SL KECKRS VGVHTASPGMVLTDL
Sbjct  330  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQGSLLKECKRSNVGVHTASPGMVLTDL  389

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+AL++ WLR+
Sbjct  390  LLSGSTIQNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALITVWLRQ  449

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  450  GRWFDEQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  507



>ref|XP_010656325.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X1 [Vitis vinifera]
Length=521

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ SL KECKRS VGVHTASPGMVLTDL
Sbjct  334  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQGSLLKECKRSNVGVHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+AL++ WLR+
Sbjct  394  LLSGSTIQNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALITVWLRQ  453

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  454  GRWFDEQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  511



>ref|XP_006833298.1| hypothetical protein AMTR_s00109p00036750 [Amborella trichopoda]
 gb|ERM98576.1| hypothetical protein AMTR_s00109p00036750 [Amborella trichopoda]
Length=522

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KE KRSKVGVHTASPGMVLTDL
Sbjct  335  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKESKRSKVGVHTASPGMVLTDL  394

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNKQMFNIICELPETVARTLVPRMRIVKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  395  LLSGSTLQNKQMFNIICELPETVARTLVPRMRIVKGTGKAINYLTPPRILLALVTAWLRR  454

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDD+GRA+YAAEADR+RNWAESR   SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  455  GRWFDDEGRALYAAEADRIRNWAESRAPFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  512



>ref|XP_002457093.1| hypothetical protein SORBIDRAFT_03g001100 [Sorghum bicolor]
 gb|EES02213.1| hypothetical protein SORBIDRAFT_03g001100 [Sorghum bicolor]
Length=512

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q SL KE +RSKVGVHTASPGMVLTDL
Sbjct  325  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQGSLLKESRRSKVGVHTASPGMVLTDL  384

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  385  LLSGSSIRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  444

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDD+GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  445  GRWFDDEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  502



>ref|XP_004287406.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=501

 Score =   344 bits (883),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL +ECKRSKVGVHTASPGMVLTDL
Sbjct  314  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLEECKRSKVGVHTASPGMVLTDL  373

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKG+GK+INYLTPPRIL+ALV+AWLRR
Sbjct  374  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGTGKSINYLTPPRILLALVTAWLRR  433

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QG+A+YAAEADR+RNWAE+RTR  FTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  434  GRWFDEQGKALYAAEADRIRNWAENRTRFYFTDAMEMYTENTWVSVFSLSVVCAFIIL  491



>ref|XP_010688205.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=506

 Score =   344 bits (883),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KEC+R+K+GVHTASPGMVLT+LL
Sbjct  320  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECRRTKIGVHTASPGMVLTELL  379

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSGSS++NKQMFNIICELPETVAR+LVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLR+G
Sbjct  380  LSGSSLKNKQMFNIICELPETVARSLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRQG  439

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFDDQGRA+YAAEADR+RNWAE RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  440  RWFDDQGRALYAAEADRIRNWAEDRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  496



>ref|NP_001042468.1| Os01g0227100 [Oryza sativa Japonica Group]
 sp|Q5N800.1|NYC1_ORYSJ RecName: Full=Probable chlorophyll(ide) b reductase NYC1, chloroplastic; 
AltName: Full=Protein NON-YELLOW COLORING 1; Short=OsNYC1; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD81513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD82407.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04382.1| Os01g0227100 [Oryza sativa Japonica Group]
 dbj|BAF49740.1| short-chain dehydrogenase/reductase NYC1 [Oryza sativa Japonica 
Group]
 dbj|BAG90942.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54154.1| hypothetical protein OsJ_00960 [Oryza sativa Japonica Group]
Length=504

 Score =   343 bits (881),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  317  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDL  376

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  377  LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  436

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  437  GRWFDEEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  494



>gb|EEC70221.1| hypothetical protein OsI_00981 [Oryza sativa Indica Group]
Length=504

 Score =   343 bits (881),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  317  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDL  376

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  377  LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  436

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  437  GRWFDEEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  494



>ref|XP_010099589.1| putative chlorophyll(ide) b reductase NYC1 [Morus notabilis]
 gb|EXB79941.1| putative chlorophyll(ide) b reductase NYC1 [Morus notabilis]
Length=515

 Score =   344 bits (882),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KE KRSKVGVHTASPGMVLTDL
Sbjct  328  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKESKRSKVGVHTASPGMVLTDL  387

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS++QNK+MFNIICELPETVAR+LVPRMR+V+GSGKAINYLTPPRILIALV+AWLRR
Sbjct  388  LLSGSTIQNKRMFNIICELPETVARSLVPRMRVVRGSGKAINYLTPPRILIALVTAWLRR  447

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  448  GRWFDEQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWLSVFSLSVVCAFIIL  505



>ref|XP_006645666.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like, 
partial [Oryza brachyantha]
Length=478

 Score =   342 bits (878),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  291  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDL  350

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+ALV+AW+RR
Sbjct  351  LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLALVTAWVRR  410

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD++GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  411  GRWFDEEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  468



>gb|KHG20319.1| hypothetical protein F383_09127 [Gossypium arboreum]
Length=517

 Score =   343 bits (881),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVGVHTASPGMVLTDL
Sbjct  330  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGVHTASPGMVLTDL  389

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFN+ICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+AL++AWLR+
Sbjct  390  LLSGSTLKNKQMFNLICELPETVARSLVPRMRVVKGAGKAINYLTPPRILLALITAWLRQ  449

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  450  GRWFDEQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  507



>ref|XP_008337383.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Malus domestica]
Length=520

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECK SKVGVHTASPGMVLTDL
Sbjct  333  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKXSKVGVHTASPGMVLTDL  392

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN ICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  393  LLSGSSLKNKQMFNFICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  452

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QG+A+YAAEADRLRNWAE+RTR  FTDAM+ YTENTWVSVFSLSVVCAFIIL
Sbjct  453  GRWFDEQGKALYAAEADRLRNWAENRTRFYFTDAMDMYTENTWVSVFSLSVVCAFIIL  510



>gb|KJB54193.1| hypothetical protein B456_009G025000 [Gossypium raimondii]
Length=517

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  330  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  389

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFN+ICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+AL++AWLR+
Sbjct  390  LLSGSTLKNKQMFNLICELPETVARSLVPRMRVVKGAGKAINYLTPPRILLALITAWLRQ  449

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  450  GRWFDEQGRALYAAEADRIRNWAENRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  507



>ref|XP_009409056.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=546

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KECKRSKVGVHTASPGMVLT+L
Sbjct  359  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKECKRSKVGVHTASPGMVLTEL  418

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  419  LLSGSSLRNKQMFNIICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWLRR  478

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAESR R S TDAME Y ENTWVSVFSLSVVCAFIIL
Sbjct  479  GRWFDEQGRALYAAEADRIRNWAESRARFSVTDAMEMYAENTWVSVFSLSVVCAFIIL  536



>ref|XP_007013167.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY30786.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=522

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  335  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  394

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLR+
Sbjct  395  LLSGSTIKNKQMFNIICELPETVARSLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRQ  454

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RT+ SFTDAM+ YTENTWVSVFSLSVVCAFIIL
Sbjct  455  GRWFDEQGRALYAAEADRIRNWAENRTQFSFTDAMDMYTENTWVSVFSLSVVCAFIIL  512



>ref|XP_007013166.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30785.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=521

 Score =   342 bits (876),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  334  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLR+
Sbjct  394  LLSGSTIKNKQMFNIICELPETVARSLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRQ  453

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADR+RNWAE+RT+ SFTDAM+ YTENTWVSVFSLSVVCAFIIL
Sbjct  454  GRWFDEQGRALYAAEADRIRNWAENRTQFSFTDAMDMYTENTWVSVFSLSVVCAFIIL  511



>ref|NP_001147506.1| LOC100281115 [Zea mays]
 gb|ACG27755.1| oxidoreductase [Zea mays]
Length=509

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGL+Q Q SL  E +RSKVGVHTASPGMVLTDL
Sbjct  322  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLKQFQGSLLNESRRSKVGVHTASPGMVLTDL  381

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  382  LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  441

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDD+GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  442  GRWFDDEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  499



>gb|ACN31897.1| unknown [Zea mays]
 tpg|DAA52782.1| TPA: oxidoreductase [Zea mays]
Length=511

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGL+Q Q SL  E +RSKVGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLKQFQGSLLNESRRSKVGVHTASPGMVLTDL  383

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct  384  LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR  443

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDD+GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  444  GRWFDDEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  501



>emb|CDY67729.1| BnaAnng25090D, partial [Brassica napus]
Length=312

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++KVG+HTASPGMVLT+L
Sbjct  124  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSVAKESQKTKVGLHTASPGMVLTEL  183

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGK++NYLTPPRIL+A+V++WLRR
Sbjct  184  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKSVNYLTPPRILLAIVTSWLRR  243

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFII+
Sbjct  244  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIV  301



>gb|EPS61243.1| hypothetical protein M569_13555, partial [Genlisea aurea]
Length=434

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GG++FNMDGAGSGGSSTPLTAVYGSTKCGLRQL SSL KE ++SKVG+HTASPGMVLTDL
Sbjct  252  GGNIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHSSLVKEFRKSKVGIHTASPGMVLTDL  311

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSSV+NKQMFN+ICE PETVARTLVPR+R+VKGSGKA+NYLTPPRIL+ALV+AW+RR
Sbjct  312  LLSGSSVKNKQMFNLICEQPETVARTLVPRLRVVKGSGKAVNYLTPPRILLALVTAWVRR  371

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD+QGRA+YAAEADRLRNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  372  GRWFDEQGRALYAAEADRLRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  429



>ref|XP_003620673.1| Oxidoreductase [Medicago truncatula]
 gb|AES76891.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=514

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   SL  ECKRSKVGVHTASPGMVLT+LL
Sbjct  328  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSLLTECKRSKVGVHTASPGMVLTELL  387

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSGS++QNKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRRG
Sbjct  388  LSGSTIQNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRRG  447

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFDD+GRA+Y+AEADRLRNWAE+R R SFTDAME YTENTW+SVFSLSVVCAFIIL
Sbjct  448  RWFDDEGRALYSAEADRLRNWAENRARFSFTDAMEMYTENTWLSVFSLSVVCAFIIL  504



>ref|XP_007152835.1| hypothetical protein PHAVU_004G163900g [Phaseolus vulgaris]
 gb|ESW24829.1| hypothetical protein PHAVU_004G163900g [Phaseolus vulgaris]
Length=512

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ SL KECKRSKVGVHTASPGMVLTDLL
Sbjct  328  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQGSLLKECKRSKVGVHTASPGMVLTDLL  387

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSGS+VQN+QMFNIICELPETVARTLVPRMR+VKG+GKAI+YLTPPRIL+ALV+AWLRRG
Sbjct  388  LSGSTVQNRQMFNIICELPETVARTLVPRMRVVKGTGKAISYLTPPRILLALVTAWLRRG  447

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFD+QGRA+YAAEADRLRNWAE R R SFTDAME YTENT + VFSLSVVCAFIIL
Sbjct  448  RWFDEQGRALYAAEADRLRNWAEDRARFSFTDAMEMYTENTLLPVFSLSVVCAFIIL  504



>emb|CAB41935.1| putative protein [Arabidopsis thaliana]
 emb|CAB78367.1| putative protein [Arabidopsis thaliana]
Length=447

 Score =   336 bits (862),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct  259  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTEL  318

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  319  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  378

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  379  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  436



>gb|KFK39772.1| hypothetical protein AALP_AA3G285600 [Arabis alpina]
Length=497

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KEC+++KVG+HTASPGMVLT+L
Sbjct  309  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSVEKECQKTKVGLHTASPGMVLTEL  368

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGK++N+LTPPRIL+A+V++WLRR
Sbjct  369  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKSVNFLTPPRILLAIVTSWLRR  428

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  429  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  486



>ref|XP_010450312.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Camelina sativa]
Length=499

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE ++ KVG+HTASPGMVLT+L
Sbjct  311  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKVKVGLHTASPGMVLTEL  370

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  371  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  430

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  431  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  488



>ref|XP_010440670.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Camelina sativa]
Length=499

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE ++ KVG+HTASPGMVLT+L
Sbjct  311  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKLKVGLHTASPGMVLTEL  370

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  371  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  430

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  431  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  488



>ref|XP_010435297.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Camelina sativa]
Length=499

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE ++ KVG+HTASPGMVLT+L
Sbjct  311  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKLKVGLHTASPGMVLTEL  370

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  371  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  430

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  431  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  488



>ref|XP_010254115.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nelumbo nucifera]
Length=528

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYG+TKCGLRQ Q+SL KE K SK+GVHTASPGMVLTDL
Sbjct  341  GGHIFNMDGAGSGGSSTPLTAVYGATKCGLRQFQASLLKEFKWSKIGVHTASPGMVLTDL  400

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLR+
Sbjct  401  LLSGSTLKNKQMFNIICELPETVARSLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRQ  460

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAESR +LSFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  461  GRWFDDQGRALYAAEADRIRNWAESRAQLSFTDAMEMYTENTWVSVFSLSVVCAFIIL  518



>ref|XP_002863155.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39414.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=496

 Score =   335 bits (859),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct  308  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTEL  367

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  368  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  427

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  428  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  485



>ref|NP_001190716.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
 gb|AEE83252.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
Length=494

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct  306  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTEL  365

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  366  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  425

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  426  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  483



>ref|NP_567400.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
 sp|Q93ZA0.1|NYC1_ARATH RecName: Full=Probable chlorophyll(ide) b reductase NYC1, chloroplastic; 
AltName: Full=Protein NON-YELLOW COLORING 1; Short=AtNYC1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL15327.1| AT4g13250/F17N18_140 [Arabidopsis thaliana]
 dbj|BAF49743.1| short-chain dehydrogenase/reductase AtNYC1 [Arabidopsis thaliana]
 gb|AEE83251.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
Length=496

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct  308  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTEL  367

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  368  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  427

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  428  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  485



>emb|CDY47326.1| BnaCnng14630D [Brassica napus]
Length=492

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ  SS+ KE +++KVG+HTASPGMVLT+L
Sbjct  304  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHSSIVKESQKTKVGLHTASPGMVLTEL  363

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMRIVKGSGK++NYLTPPRIL+A+V++WLRR
Sbjct  364  LLSGSSIKNKQMFNIICELPETVARTLVPRMRIVKGSGKSVNYLTPPRILLAIVTSWLRR  423

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
             RWFDDQGRA+YAAEADRLRNWAE+RTR S TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  424  SRWFDDQGRALYAAEADRLRNWAENRTRFSLTDAMEMYTENTWVSVFSLSVVCAFIIL  481



>ref|XP_006283586.1| hypothetical protein CARUB_v10004643mg [Capsella rubella]
 gb|EOA16484.1| hypothetical protein CARUB_v10004643mg [Capsella rubella]
Length=499

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE ++  VG+HTASPGMVLT+L
Sbjct  311  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKMNVGLHTASPGMVLTEL  370

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct  371  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR  430

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  431  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  488



>ref|XP_009139641.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Brassica rapa]
Length=499

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ  SS+ KE +++KVG+HTASPGMVLT+L
Sbjct  311  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHSSIVKESQKTKVGLHTASPGMVLTEL  370

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGK++NYLTPPRIL+A+V++WLRR
Sbjct  371  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKSVNYLTPPRILLAIVTSWLRR  430

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
             RWFDDQGRA+YAAEADRLRNWAE+RTR S TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  431  SRWFDDQGRALYAAEADRLRNWAENRTRFSLTDAMEMYTENTWVSVFSLSVVCAFIIL  488



>ref|XP_009107686.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Brassica rapa]
Length=497

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++KVG+HTASPGMVLT+L
Sbjct  309  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSVAKESQKTKVGLHTASPGMVLTEL  368

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGK++NYLTPPRIL+A+V++WLRR
Sbjct  369  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKSVNYLTPPRILLAIVTSWLRR  428

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFII+
Sbjct  429  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIV  486



>ref|XP_006414943.1| hypothetical protein EUTSA_v10024970mg [Eutrema salsugineum]
 dbj|BAJ33699.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ56396.1| hypothetical protein EUTSA_v10024970mg [Eutrema salsugineum]
Length=504

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct  316  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSVVKESQKTNVGLHTASPGMVLTEL  375

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGK++NYLTPPRIL+A+V++WLRR
Sbjct  376  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKSVNYLTPPRILLAIVTSWLRR  435

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  436  GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL  493



>emb|CDY01120.1| BnaA04g06990D [Brassica napus]
Length=513

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ  SS+ KE +++KVG+HTASPGMVLT+L
Sbjct  325  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHSSIVKESQKTKVGLHTASPGMVLTEL  384

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGK++NYLTPPRIL+A+V++WLRR
Sbjct  385  LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKSVNYLTPPRILLAIVTSWLRR  444

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
             RWFDDQGRA+YAAEADRLRNWAE+RTR S TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  445  SRWFDDQGRALYAAEADRLRNWAENRTRFSLTDAMEMYTENTWVSVFSLSVVCAFIIL  502



>gb|EYU18156.1| hypothetical protein MIMGU_mgv1a0102812mg, partial [Erythranthe 
guttata]
Length=170

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  708  YGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNIICELPET  529
            YGSTKCGLRQL SSL KE KRSKVGVHTASPGMVLT+LLLSG+SV+NKQMFNIICELPET
Sbjct  1    YGSTKCGLRQLHSSLLKESKRSKVGVHTASPGMVLTELLLSGASVKNKQMFNIICELPET  60

Query  528  VARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRGRWFDDQGRAVYAAEADRLRNW  349
            VARTLVPRMR+VKGSGK+INYLTPPRIL+ALV+AW+RR RWFDDQGRA+YAAEADRLRNW
Sbjct  61   VARTLVPRMRVVKGSGKSINYLTPPRILLALVTAWVRRARWFDDQGRALYAAEADRLRNW  120

Query  348  AESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            AESRTR SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  121  AESRTRFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  156



>dbj|BAO56868.1| chlorophyll b reductase, partial [Egeria densa]
Length=155

 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  762  FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSG  583
            F+MDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SL KECKRSKVGVHTASPGMVLT+LLLSG
Sbjct  1    FHMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLLKECKRSKVGVHTASPGMVLTELLLSG  60

Query  582  SSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRGRWF  403
            SS++NKQMFNIICELPETVARTLVPRMRIVKGSGKA+NYLTPPRIL+ALV+AWLRRGRWF
Sbjct  61   SSLKNKQMFNIICELPETVARTLVPRMRIVKGSGKAVNYLTPPRILLALVTAWLRRGRWF  120

Query  402  DDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYT  298
            DDQGRA+YAAEADR+RNWAESR   SF DAME YT
Sbjct  121  DDQGRALYAAEADRIRNWAESRAGFSFADAMEMYT  155



>dbj|BAH84862.1| putative short-chain dehydrogenase/reductase [Cucumis sativus]
Length=321

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GG +FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KEC+RS VGVHTASPGMVLTDL
Sbjct  168  GGQIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECRRSNVGVHTASPGMVLTDL  227

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+V+NKQMFNIICELPETVARTLVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLRR
Sbjct  228  LLSGSTVRNKQMFNIICELPETVARTLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRR  287

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDA  313
            GRWFDDQGRA+YAAEADR+RNWAE+RTR SFTDA
Sbjct  288  GRWFDDQGRALYAAEADRIRNWAENRTRFSFTDA  321



>gb|KCW79680.1| hypothetical protein EUGRSUZ_C01035 [Eucalyptus grandis]
Length=539

 Score =   308 bits (789),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  332  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  391

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+ +NKQMFNIICELPETVAR+LVPRMR+VKG+GKAI+YLTPPRIL+AL++AWLRR
Sbjct  392  LLSGSTTKNKQMFNIICELPETVARSLVPRMRVVKGTGKAISYLTPPRILLALITAWLRR  451

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAME  307
            GRWFDDQGRA+YAAEADRLRNWAE+RTR SFTDAME
Sbjct  452  GRWFDDQGRALYAAEADRLRNWAENRTRFSFTDAME  487



>ref|XP_002988833.1| hypothetical protein SELMODRAFT_128787, partial [Selaginella 
moellendorffii]
 gb|EFJ10095.1| hypothetical protein SELMODRAFT_128787, partial [Selaginella 
moellendorffii]
Length=402

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGS G+ TPLTAVYG++K GLRQL  SL KEC+ S+VG+HTASPGMVLTDLL
Sbjct  216  GHIFNMDGAGSNGAGTPLTAVYGASKSGLRQLHESLRKECRGSRVGIHTASPGMVLTDLL  275

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSG+S+ NK+MFNIICE PETVAR LVP+MR VKG+GKAI YLTPPRI++A+++AWL RG
Sbjct  276  LSGASLHNKKMFNIICEQPETVARDLVPKMRRVKGTGKAIEYLTPPRIILAIITAWLHRG  335

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFD++GRAVYAAEADRLR WAE R R +F  AMET    TWVS+FS SV+CA+IIL
Sbjct  336  RWFDEEGRAVYAAEADRLRVWAEERQRSNFASAMETVPSGTWVSLFSSSVICAYIIL  392



>ref|XP_002964564.1| hypothetical protein SELMODRAFT_405906 [Selaginella moellendorffii]
 gb|EFJ34897.1| hypothetical protein SELMODRAFT_405906 [Selaginella moellendorffii]
Length=551

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGS G+ TPLTAVYG++K GLRQL  SL KEC+ S+VG+HTASPGMVLTDLL
Sbjct  365  GHIFNMDGAGSNGAGTPLTAVYGASKSGLRQLHESLRKECRGSRVGIHTASPGMVLTDLL  424

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG  412
            LSG+S+ NK+MFNIICE PETVAR LVP+MR VKG+GKAI YLTPPRI++A+++AWL RG
Sbjct  425  LSGASLHNKKMFNIICEQPETVARDLVPKMRRVKGTGKAIEYLTPPRIILAIITAWLHRG  484

Query  411  RWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            RWFD++GRAVYAAEADRLR WAE R R +F  AMET    TWVS+FS SV+CA+IIL
Sbjct  485  RWFDEEGRAVYAAEADRLRVWAEERQRSNFASAMETVPSGTWVSLFSSSVICAYIIL  541



>gb|ADE77501.1| unknown [Picea sitchensis]
Length=191

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -1

Query  708  YGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNIICELPET  529
            YGSTKCGLRQL +SL KECK+S+VG+HTASPGMVLTDLLLSG+S QNK+MFNIICELPET
Sbjct  26   YGSTKCGLRQLNASLLKECKKSRVGIHTASPGMVLTDLLLSGASRQNKKMFNIICELPET  85

Query  528  VARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRGRWFDDQGRAVYAAEADRLRNW  349
            VARTLVPRMR VKG+GKAINYLTPPRIL+ALV+AWLRRGRWFDD+GRA+YAAEADR+R W
Sbjct  86   VARTLVPRMRAVKGTGKAINYLTPPRILLALVTAWLRRGRWFDDKGRALYAAEADRVRIW  145

Query  348  AESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            AE+R R SF DAM+ Y++  WVSVFS S + +FIIL
Sbjct  146  AENRARFSFGDAMDFYSDGAWVSVFSFSAMFSFIIL  181



>ref|XP_001775957.1| predicted protein [Physcomitrella patens]
 gb|EDQ59149.1| predicted protein [Physcomitrella patens]
Length=478

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGG+STPLTA YG+TKCGLRQL +SL +ECK ++VG+HTASPGMVLT+L
Sbjct  290  GGHIFNMDGAGSGGTSTPLTAAYGATKCGLRQLSASLLQECKGTRVGIHTASPGMVLTEL  349

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSG+S+QNKQ+FNIICE PETVA+ LVP +R VKG+GKA+NYLTPPRI++A+++AW RR
Sbjct  350  LLSGASLQNKQVFNIICEQPETVAQALVPGLRTVKGTGKAVNYLTPPRIILAILNAWFRR  409

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFD +GRAVYAAEA+RLR WAE R +   T AME      WVS+FS SV+ A++IL
Sbjct  410  GRWFDKEGRAVYAAEAERLRLWAEGREKSPVTAAMEMIPSGAWVSLFSSSVITAYVIL  467



>ref|XP_006451162.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64402.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
Length=471

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 134/178 (75%), Gaps = 41/178 (23%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAV                                      
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAV--------------------------------------  345

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
               GS++QNKQMFNIICELPETVARTLVPR+R+VKGSGKAINYLTPPRIL+ALV+AWLRR
Sbjct  346  ---GSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRR  402

Query  414  GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            GRWFDDQGRA+YAAEADR+RNWAE+R R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  403  GRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  460



>ref|XP_007013168.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY30787.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=472

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  334  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLR+
Sbjct  394  LLSGSTIKNKQMFNIICELPETVARSLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRQ  453

Query  414  GRWFDDQ  394
            GRWFD+Q
Sbjct  454  GRWFDEQ  460



>gb|KJB54194.1| hypothetical protein B456_009G025000 [Gossypium raimondii]
Length=473

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  330  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  389

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFN+ICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+AL++AWLR+
Sbjct  390  LLSGSTLKNKQMFNLICELPETVARSLVPRMRVVKGAGKAINYLTPPRILLALITAWLRQ  449

Query  414  GRWFDDQ  394
            GRWFD+Q
Sbjct  450  GRWFDEQ  456



>ref|XP_007013169.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY30788.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=461

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQL +SL KECKRSKVG+HTASPGMVLTDL
Sbjct  334  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLHASLLKECKRSKVGIHTASPGMVLTDL  393

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            LLSGS+++NKQMFNIICELPETVAR+LVPRMR+VKG+GKAINYLTPPRIL+ALV+AWLR+
Sbjct  394  LLSGSTIKNKQMFNIICELPETVARSLVPRMRVVKGTGKAINYLTPPRILLALVTAWLRQ  453

Query  414  GR  409
            GR
Sbjct  454  GR  455



>gb|ACN27294.1| unknown [Zea mays]
Length=117

 Score =   209 bits (533),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = -1

Query  561  MFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRGRWFDDQGRAV  382
            MFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RRGRWFDD+GRAV
Sbjct  1    MFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRRGRWFDDEGRAV  60

Query  381  YAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL  241
            YAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct  61   YAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL  107



>ref|XP_006475689.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Citrus sinensis]
Length=116

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  10   GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  69

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKG  487
            LLSGS++QNK MFNIICELPETVA+TLVPR+R+VKG
Sbjct  70   LLSGSTIQNKLMFNIICELPETVAKTLVPRIRVVKG  105



>gb|ADI80447.1| putative oxidoreductase [Aegilops uniaristata]
 gb|ADI80453.1| putative oxidoreductase [Aegilops speltoides var. ligustica]
 gb|ADI80462.1| putative oxidoreductase [Aegilops speltoides subsp. speltoides]
 gb|ADI80463.1| putative oxidoreductase [Aegilops speltoides var. ligustica]
Length=195

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  119  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  178

Query  594  LLSGSSVQNKQMFNIIC  544
            LLSGSS+QNKQMFNIIC
Sbjct  179  LLSGSSLQNKQMFNIIC  195



>gb|ADI80451.1| putative oxidoreductase [Hordeum bogdanii]
Length=193

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  119  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  178

Query  594  LLSGSSVQNKQMFNI  550
            LLSGSS+QNKQMFNI
Sbjct  179  LLSGSSLQNKQMFNI  193



>gb|ADI80440.1| putative oxidoreductase [Aegilops comosa]
Length=192

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  118  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  177

Query  594  LLSGSSVQNKQMFNI  550
            LLSGSS+QNKQMFNI
Sbjct  178  LLSGSSLQNKQMFNI  192



>gb|ADI80458.1| putative oxidoreductase [Aegilops speltoides subsp. speltoides]
 gb|ADI80459.1| putative oxidoreductase [Aegilops speltoides subsp. speltoides]
Length=193

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  119  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  178

Query  594  LLSGSSVQNKQMFNI  550
            LLSGSS+QNKQMFNI
Sbjct  179  LLSGSSLQNKQMFNI  193



>ref|XP_005652224.1| NAD(P)-binding protein, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE27680.1| NAD(P)-binding protein, partial [Coccomyxa subellipsoidea C-169]
Length=349

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 99/152 (65%), Gaps = 5/152 (3%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKR--SKVGVHTASPGMVLT  601
            GGH+FNMDGAG+ G  TP  A YG+TK G+  L+ SL  E  R  + VGVH  SPGMVLT
Sbjct  166  GGHIFNMDGAGADGLPTPQYAAYGATKAGIAHLKGSLGAEAAREGAPVGVHCLSPGMVLT  225

Query  600  DLLLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKA---INYLTPPRILIALVS  430
            +LLL G+S  NKQ+FNI+CE PETVA  LVPR R V   G+A   I +LT PR L+  ++
Sbjct  226  NLLLEGASDINKQIFNILCEQPETVAAFLVPRARTVAARGEAGRYIRFLTLPRALLRFIT  285

Query  429  AWLRRGRWFDDQGRAVYAAEADRLRNWAESRT  334
            A LR  R+F+  G  VYA E +R+      RT
Sbjct  286  APLRTNRFFNADGEPVYAREQERILGQRAKRT  317



>gb|ADI80446.1| putative oxidoreductase [Aegilops sharonensis]
Length=190

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  116  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  175

Query  594  LLSGSSVQNKQMFNI  550
            LLSGSS+QNKQMFNI
Sbjct  176  LLSGSSLQNKQMFNI  190



>gb|ADI80449.1| putative oxidoreductase [Triticum monococcum subsp. aegilopoides]
Length=188

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  115  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  174

Query  594  LLSGSSVQNKQMFN  553
            LLSGSS+QNKQMFN
Sbjct  175  LLSGSSLQNKQMFN  188



>gb|ADI80455.1| putative oxidoreductase [Aegilops speltoides]
Length=179

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  106  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  165

Query  594  LLSGSSVQNKQMFN  553
            LLSGSS+QNKQMFN
Sbjct  166  LLSGSSLQNKQMFN  179



>gb|ADI80448.1| putative oxidoreductase [Aegilops uniaristata]
Length=191

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  118  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  177

Query  594  LLSGSSVQNKQMFN  553
            LLSGSS+QNKQMFN
Sbjct  178  LLSGSSLQNKQMFN  191



>gb|ADI80441.1| putative oxidoreductase [Aegilops comosa]
Length=190

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  117  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  176

Query  594  LLSGSSVQNKQMFN  553
            LLSGSS+QNKQMFN
Sbjct  177  LLSGSSLQNKQMFN  190



>gb|ADI80438.1| putative oxidoreductase [Aegilops longissima]
 gb|ADI80442.1| putative oxidoreductase [Aegilops tauschii]
 gb|ADI80444.1| putative oxidoreductase [Aegilops longissima]
 gb|ADI80454.1| putative oxidoreductase [Aegilops speltoides]
 gb|ADI80457.1| putative oxidoreductase [Aegilops speltoides]
 gb|ADI80461.1| putative oxidoreductase [Aegilops speltoides subsp. speltoides]
Length=189

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  116  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  175

Query  594  LLSGSSVQNKQMFN  553
            LLSGSS+QNKQMFN
Sbjct  176  LLSGSSLQNKQMFN  189



>ref|XP_005847895.1| hypothetical protein CHLNCDRAFT_57711 [Chlorella variabilis]
 gb|EFN55793.1| hypothetical protein CHLNCDRAFT_57711 [Chlorella variabilis]
Length=535

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 117/185 (63%), Gaps = 10/185 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECK--RSKVGVHTASPGMVLT  601
            GGH+FN +GAGS GS TP  A YG+TKC + QL  +L  E     + V +H  SPGMVLT
Sbjct  347  GGHIFNTEGAGSDGSPTPQYAAYGATKCAIAQLLKTLQHEAAGLANPVRIHNLSPGMVLT  406

Query  600  DLLLSGSSVQNKQMFNIICELPETVARTLVPRMR--IVKG-SGKAINYLTPPRILIALVS  430
             LLL G++  +KQ+FNI+CE PETVA  LVPR+R  + +G +G AI +LTP R L   ++
Sbjct  407  PLLLEGATPSSKQVFNILCEHPETVAAFLVPRLRSVVARGEAGTAIRFLTPTRALAKFLT  466

Query  429  AWLRRGRWFDDQGRAVYAAEADRLRNWAESR--TRLSFTDAMETYTENTWVSVFSLSVVC  256
            A LR G++FD +GR VYA E +RL   A+++   RL    A  +     +   +S+ +  
Sbjct  467  APLRAGKYFDREGRPVYAPERERLLGAAQAKRTQRLQRAAARRSV---PFQLAYSMCMAL  523

Query  255  AFIIL  241
            AF+++
Sbjct  524  AFLLI  528



>gb|ADI80437.1| putative oxidoreductase [Aegilops comosa]
Length=189

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  117  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  176

Query  594  LLSGSSVQNKQMF  556
            LLSGSS+QNKQMF
Sbjct  177  LLSGSSLQNKQMF  189



>gb|ADI80439.1| putative oxidoreductase [Aegilops comosa]
 gb|ADI80443.1| putative oxidoreductase [Aegilops tauschii]
Length=188

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  116  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  175

Query  594  LLSGSSVQNKQMF  556
            LLSGSS+QNKQMF
Sbjct  176  LLSGSSLQNKQMF  188



>ref|XP_001697080.1| chlorophyll b reductase [Chlamydomonas reinhardtii]
 gb|EDP00772.1| chlorophyll b reductase [Chlamydomonas reinhardtii]
Length=470

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 95/142 (67%), Gaps = 3/142 (2%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAG+ G +TP  A YG+TK G+ QL  +L +E   + + +HT SPGM+LTDL
Sbjct  282  GGHIFNMDGAGADGFATPNYAAYGATKAGITQLTGTLQRELADTPIKLHTVSPGMILTDL  341

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKG---SGKAINYLTPPRILIALVSAW  424
            LL G++  NKQ FNI+CE PETVA  LVPR++       SG    +LTP   L  L +A 
Sbjct  342  LLEGATTANKQAFNILCEHPETVAAFLVPRIKSAVARDVSGTYTRFLTPGSALYRLATAP  401

Query  423  LRRGRWFDDQGRAVYAAEADRL  358
             R GR+FD +GRAVY  E +RL
Sbjct  402  ARLGRFFDKEGRAVYPPERERL  423



>gb|ADI80450.1| putative oxidoreductase [Triticum urartu]
Length=185

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  114  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  173

Query  594  LLSGSSVQNKQM  559
            LLSGSS+QNKQM
Sbjct  174  LLSGSSLQNKQM  185



>gb|ADI80456.1| putative oxidoreductase [Aegilops speltoides]
Length=187

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  116  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  175

Query  594  LLSGSSVQNKQM  559
            LLSGSS+QNKQM
Sbjct  176  LLSGSSLQNKQM  187



>gb|ADI80445.1| putative oxidoreductase [Aegilops sharonensis]
Length=185

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  114  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  173

Query  594  LLSGSSVQNKQM  559
            LLSGSS+QNKQM
Sbjct  174  LLSGSSLQNKQM  185



>ref|XP_002948073.1| hypothetical protein VOLCADRAFT_103703 [Volvox carteri f. nagariensis]
 gb|EFJ51061.1| hypothetical protein VOLCADRAFT_103703 [Volvox carteri f. nagariensis]
Length=414

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 109/182 (60%), Gaps = 7/182 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFN+DGAG+ G  TP  A YG+TK G+  L ++L +E + + V +HT SPGM+LTDL
Sbjct  227  GGHVFNVDGAGADGFPTPNYAAYGATKAGVTHLTATLQRELEGTAVRLHTVSPGMILTDL  286

Query  594  LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKG---SGKAINYLTPPRILIALVSAW  424
            LL G++  NKQ FNI+CE PETVA  LVPR++       SG    YLTP   L+ L +A 
Sbjct  287  LLEGATAANKQAFNILCEHPETVAAFLVPRIKSAVARDVSGTYTRYLTPTSALLRLATAP  346

Query  423  LRRGRWFDDQGRAVYAAEADR-LRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFI  247
             R GR+FD  G+ VY +E DR L   A+   RL    A            ++LSV+   +
Sbjct  347  SRLGRFFDGSGQPVYPSERDRILGRHAKVTARL---QAAARRQNGGLALAYNLSVLAGVL  403

Query  246  IL  241
            ++
Sbjct  404  VM  405



>gb|ADI80460.1| putative oxidoreductase [Aegilops speltoides subsp. speltoides]
 gb|ADI80464.1| putative oxidoreductase [Aegilops speltoides var. ligustica]
Length=184

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  114  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  173

Query  594  LLSGSSVQNKQ  562
            LLSGSS+QNKQ
Sbjct  174  LLSGSSLQNKQ  184



>gb|ADI80452.1| putative oxidoreductase [Hordeum marinum]
Length=140

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct  73   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLMKESRRSKVGVHTASPGMVLTDL  132

Query  594  LLSGSSVQ  571
            LLSGSS+Q
Sbjct  133  LLSGSSLQ  140



>ref|XP_004334914.1| oxidoreductase, short chain dehydrogenase/reductase superfamily 
protein [Acanthamoeba castellanii str. Neff]
 gb|ELR12901.1| oxidoreductase, short chain dehydrogenase/reductase superfamily 
protein [Acanthamoeba castellanii str. Neff]
Length=252

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GHVFNMDGAG+ G STP  AVYG+TK  L QL  SL KE   + VG+HT SPGMVLTDLL
Sbjct  115  GHVFNMDGAGANGMSTPNFAVYGATKAALPQLMKSLVKETAGTNVGIHTLSPGMVLTDLL  174

Query  591  LSGS-SVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            +SG+   +  ++FNI+ E P TVA+ LVPR+R   GSG+ I +LT         + + R+
Sbjct  175  MSGNREPRVLKVFNILAERPRTVAQWLVPRIRAASGSGRYIKFLTAVGAAWRFATFFRRK  234

Query  414  GRWFDDQG  391
             R+FD QG
Sbjct  235  NRFFDAQG  242



>gb|KCW79681.1| hypothetical protein EUGRSUZ_C01035 [Eucalyptus grandis]
Length=460

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL KECKRSKVGVHTASPGMVLTDL
Sbjct  332  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLLKECKRSKVGVHTASPGMVLTDL  391

Query  594  LLSG  583
            LL G
Sbjct  392  LLRG  395



>gb|KDO50904.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=396

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ+SLFKE KRSKVGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDL  383

Query  594  LL  589
            LL
Sbjct  384  LL  385



>gb|KIZ05848.1| chlorophyll(ide) b reductase [Monoraphidium neglectum]
Length=445

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 96/186 (52%), Gaps = 47/186 (25%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKEC-------------------  652
            GGH+F MDGAGS G +TP  A YG+TK  L QL  +L +E                    
Sbjct  211  GGHIFLMDGAGSDGGATPYYAAYGATKAALPQLALTLRRELGAAASQRHNAGARQQSRQL  270

Query  651  -------------------------KRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNII  547
                                     +R  VGVH  SPGM++TDLLL  +S  NKQ+FNI+
Sbjct  271  REGGDDGQQQQQEQQEEQQQQQEQQERHPVGVHVLSPGMMITDLLLENASHANKQVFNIL  330

Query  546  CELPETVARTLVPRMR--IVKGSGKA-INYLTPPRILIALVSAWLRRGRWFDDQGRAVYA  376
            CE PETVA  LVPR+R  + +G G +   YLTP       ++A  R GR+FD +GR VYA
Sbjct  331  CEHPETVAAFLVPRLRTAVARGQGGSYTRYLTPAAAAWRFLTAPARVGRFFDGEGRPVYA  390

Query  375  AEADRL  358
             E +R+
Sbjct  391  PEGERI  396



>ref|XP_006583379.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
isoform X2 [Glycine max]
Length=437

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ SL KECKRSKVGVHTASPGMVLTDLL
Sbjct  328  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQGSLLKECKRSKVGVHTASPGMVLTDLL  387

Query  591  L  589
            L
Sbjct  388  L  388



>tpg|DAA52781.1| TPA: hypothetical protein ZEAMMB73_885268 [Zea mays]
Length=386

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FNMDGAGSGGSSTPLTAVYGSTKCGL+Q Q SL  E +RSKVGVHTASPGMVLTDL
Sbjct  324  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLKQFQGSLLNESRRSKVGVHTASPGMVLTDL  383

Query  594  LL  589
            LL
Sbjct  384  LL  385



>ref|XP_003620674.1| Oxidoreductase [Medicago truncatula]
 gb|AES76892.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=389

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   SL  ECKRSKVGVHTASPGMVLT+LL
Sbjct  328  GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSLLTECKRSKVGVHTASPGMVLTELL  387

Query  591  L  589
            L
Sbjct  388  L  388



>ref|XP_001783689.1| predicted protein [Physcomitrella patens]
 gb|EDQ51519.1| predicted protein [Physcomitrella patens]
Length=289

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FNMDGAG+ G+ TP  A YG+TK  L Q   SL  E K++ +    VH  SPGMV 
Sbjct  152  GGHIFNMDGAGADGNPTPRFAAYGATKRSLAQFTKSLQAELKQANIQNVVVHNISPGMVT  211

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSGKAINYLTPPRIL  445
            TDLL+SGS  +  + F N++ E P+TVA+ LVPR+R +    K  N  T PR L
Sbjct  212  TDLLMSGSDTRQAKFFINVLAETPDTVAKYLVPRVRKIVEENK--NSSTYPRFL  263



>ref|XP_005537824.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81788.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=383

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FN+DGAG  G+ TP  A YG+TK  + QL  SL +E   + V VHT SPGM++TDLL
Sbjct  243  GHIFNVDGAGVFGNGTPYFAAYGTTKRAMPQLMRSLNRELAGTNVSVHTISPGMMITDLL  302

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGS-----GKAINYLTPPRILIALVSA  427
            L  S+ Q +  FN++ E PETVA  LVPR+  V  S     G  I + T P    ++  A
Sbjct  303  LRDSTAQMRLFFNLLAERPETVAAFLVPRIIQVARSQPPLRGAYIRFKTLPGAFASI--A  360

Query  426  WL-----RRGRWFDDQGRAV  382
            W      RR R+FD  G  V
Sbjct  361  WNAIVPGRRYRFFDRHGNLV  380



>ref|XP_005716045.1| unnamed protein product [Chondrus crispus]
 emb|CDF36226.1| unnamed protein product [Chondrus crispus]
Length=331

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (63%), Gaps = 7/132 (5%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLL  589
            HVF MDG+GS G++TP  A YG+TK  + QL +SL  E K   V  HT SPGMVLTDLLL
Sbjct  179  HVFIMDGSGSRGNTTPNYAAYGATKRSIPQLVASLAIEGKGDPVRFHTLSPGMVLTDLLL  238

Query  588  SGSSVQ-NKQMFNIICELPETVARTLVPRMRIVKGSGKA---INYLTPPRILIALVSAW-  424
            + +     +++FN + E PETVA  LVPR+R V  S K+   I +LT P+    L + + 
Sbjct  239  AENQEPIARKVFNFLAEEPETVAENLVPRIRSVVRSDKSKTYIQFLTIPKAFFQLATGFV  298

Query  423  --LRRGRWFDDQ  394
              LR  ++FD++
Sbjct  299  LGLRGNKFFDNR  310



>ref|XP_005646276.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21732.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=303

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 81/144 (56%), Gaps = 17/144 (12%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKR---SKVGVHTASPGMVL  604
            GGH+FNMDGAG+ G +TP  A YG+TK GL QL  SL  E K    + VG+H  SPGMV 
Sbjct  160  GGHIFNMDGAGADGGATPRFAAYGATKRGLMQLSKSLQAELKMLNINNVGIHNLSPGMVT  219

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVK----------GSGKAINYLTP  457
            TDLL++G+     + F N + + PE VA  LVPR+R V           G G  I YLT 
Sbjct  220  TDLLMAGADTATAKFFINCLADPPEEVAAYLVPRIRRVPLDSRTLGGAIGQGSYIKYLTK  279

Query  456  PRI---LIALVSAWLRRGRWFDDQ  394
             +    ++A +    R+ R+  ++
Sbjct  280  SKAYGQILARLLTGARKDRFVPEE  303



>ref|XP_002671992.1| predicted protein [Naegleria gruberi]
 gb|EFC39248.1| predicted protein [Naegleria gruberi]
Length=608

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 86/142 (61%), Gaps = 3/142 (2%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHV+ M+G GS G ++P  ++YG +K   RQ  SSL  E   SKVGVH  SPGMV+T +
Sbjct  184  GGHVYLMEGLGSDGRTSPELSIYGMSKASYRQFVSSLVGETADSKVGVHRVSPGMVITSM  243

Query  594  LLSGS-SVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLR  418
            L + + + + K +FNI+ E  + VA+ L+ ++   +G+     +LTP  ++   ++ ++R
Sbjct  244  LCTDTMNSKVKNIFNILAEDRDVVAKYLIGKVVKTQGTDSFYAFLTPLSVIFRFLTFFMR  303

Query  417  RGRWFDDQG--RAVYAAEADRL  358
            R ++FD  G  +  YA + D +
Sbjct  304  RNKFFDKDGKLKEKYANQCDSV  325



>ref|XP_005649562.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25018.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=269

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 79/126 (63%), Gaps = 2/126 (2%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSK-VGVHTASPGMVLTD  598
            GG +F +DG GS G++TP    YG++K  + QL++SL  E K+ + + +H ASPGMV T+
Sbjct  143  GGKLFFIDGTGSWGNATPGNVAYGASKRAITQLKASLVAETKKEREIAIHIASPGMVATE  202

Query  597  LLLSGS-SVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWL  421
            LLL G    +  +  NI+ E   TVA  +VPRMR V+GSGK   +LT   ++   ++A  
Sbjct  203  LLLGGDRDARASKFINILAEDASTVAAWMVPRMRGVRGSGKYFKFLTTRGVIWRFLTAKG  262

Query  420  RRGRWF  403
            R+GR+ 
Sbjct  263  RKGRFL  268



>ref|XP_011396096.1| putative chlorophyll(ide) b reductase NYC1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23226.1| putative chlorophyll(ide) b reductase NYC1, chloroplastic [Auxenochlorella 
protothecoides]
Length=318

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 73/126 (58%), Gaps = 1/126 (1%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G  F M G GS G +TP   VYG+TK  L QL +SL    + S V VH  SPGMV TDLL
Sbjct  181  GKFFLMAGRGSRGDATPKNPVYGATKQALVQLSASLAASVQGSPVSVHLVSPGMVATDLL  240

Query  591  LS-GSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR  415
            L    + ++ ++ NI+ E PETVA  LVPR+R   G+G  + YLT P  L    +A  RR
Sbjct  241  LPLADTAKSARLINILAEEPETVAGWLVPRLRGATGNGGYLQYLTIPGALFRFATAGRRR  300

Query  414  GRWFDD  397
             R+  +
Sbjct  301  NRFVSE  306



>ref|XP_005851270.1| hypothetical protein CHLNCDRAFT_33893 [Chlorella variabilis]
 gb|EFN59168.1| hypothetical protein CHLNCDRAFT_33893 [Chlorella variabilis]
Length=324

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 85/142 (60%), Gaps = 3/142 (2%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GG  F +DG+GS G+ TP  A YG+TK  L QL+ SL  E + S V VH  SPGMV TD+
Sbjct  179  GGKFFLVDGSGSWGNPTPGNAAYGATKRALVQLKDSLAAEVQGSGVAVHLFSPGMVATDM  238

Query  594  LLS-GSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGK-AINYLTPPRILIALVSAWL  421
            L+    + ++ +M NI+ E P  VA  LVPR+R V+G+G  +I YLT P +L    +A  
Sbjct  239  LMRYADNPRSARMINILAEDPAVVAGWLVPRLRGVQGNGSYSIRYLTMPGVLWRFATASK  298

Query  420  RRGRWFDDQGRAVYAAEADRLR  355
            RR R F  +G AV  + A   R
Sbjct  299  RRNR-FVPEGNAVGTSSAGYQR  319



>ref|XP_005768220.1| hypothetical protein EMIHUDRAFT_445538 [Emiliania huxleyi CCMP1516]
 gb|EOD15791.1| hypothetical protein EMIHUDRAFT_445538 [Emiliania huxleyi CCMP1516]
Length=335

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (53%), Gaps = 16/155 (10%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKE-------------CKRSKVGVH  628
            HVFN  G+G  G  TP  A YG+TK GL QL  SL KE              + +KV VH
Sbjct  175  HVFNTVGSGVKGGGTPGYACYGATKRGLPQLTDSLVKELEDGVEGYEPDEAARGAKVNVH  234

Query  627  TASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPR  451
            T SPGMV TDLLL+ S+ + ++  F ++   P  VA+ LVP++    G+G+ + +LT  R
Sbjct  235  TLSPGMVFTDLLLNDSTPKLRKFPFGVLAAQPPEVAQDLVPKILATSGNGQKVEFLTTDR  294

Query  450  ILIALVSAWL--RRGRWFDDQGRAVYAAEADRLRN  352
            IL      ++  ++  + DD G  +    A  L N
Sbjct  295  ILTKFFERFVQGKKSEYIDDNGNVIKVPGAQYLDN  329



>ref|XP_005764911.1| hypothetical protein EMIHUDRAFT_445986 [Emiliania huxleyi CCMP1516]
 gb|EOD12482.1| hypothetical protein EMIHUDRAFT_445986 [Emiliania huxleyi CCMP1516]
Length=334

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (53%), Gaps = 16/155 (10%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKE-------------CKRSKVGVH  628
            HVFN  G+G  G  TP  A YG+TK GL QL  SL KE              + +KV VH
Sbjct  174  HVFNTVGSGVKGGGTPGYACYGATKRGLPQLTDSLVKELDDGVEGYEPDEAARGAKVNVH  233

Query  627  TASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPR  451
            T SPGMV TDLLL+ S+ + ++  F ++   P  VA+ LVP++    G+G+ + +LT  R
Sbjct  234  TLSPGMVFTDLLLNDSTPKLRKFPFGVLAAQPPEVAQDLVPKILATSGNGQKVEFLTTDR  293

Query  450  ILIALVSAWL--RRGRWFDDQGRAVYAAEADRLRN  352
            IL      ++  ++  + DD G  +    A  L N
Sbjct  294  ILTKFFERFVQGKKSEYIDDNGNVIKVPGAQYLDN  328



>gb|ABK24799.1| unknown [Picea sitchensis]
Length=373

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAG+ GS TP  A YG+TK  L  L  SL  E +     KV VH  SPGMV 
Sbjct  222  GGHIFNIDGAGADGSPTPRFAAYGATKRSLVHLTKSLQAELRMQGIKKVAVHNLSPGMVT  281

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKG  487
            TDLL+SGS+ +  + F N++ E  +TVA+ LVPR+R V G
Sbjct  282  TDLLMSGSNTKQAKFFINVLAEPADTVAKFLVPRVRAVSG  321



>gb|AEO19897.1| chlorophyll(ide) b reductase, partial [Pyrus x bretschneideri]
Length=178

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +      V VH  SPGMV 
Sbjct  46   GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVAVHNLSPGMVT  105

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E PE VA  LVP +R V  +G
Sbjct  106  TDLLMSGATTKQAKFFINVLAEPPEVVAEYLVPNIRSVPANG  147



>ref|XP_009035569.1| hypothetical protein AURANDRAFT_24309 [Aureococcus anophagefferens]
 gb|EGB09505.1| hypothetical protein AURANDRAFT_24309 [Aureococcus anophagefferens]
Length=267

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 76/146 (52%), Gaps = 16/146 (11%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECK-------------RSKVGV  631
            GHVFN  G+G  G  TP    YG+ K GL Q+  SL  E +                V V
Sbjct  106  GHVFNTVGSGVRGGGTPGYVTYGAAKRGLPQMTDSLVAELEGKTQGYSWPPSSTPGAVNV  165

Query  630  HTASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPP  454
            HT SPGMV TDLLL  S+ + ++  F ++   PE VAR LVP+M    G+G  + YLT P
Sbjct  166  HTLSPGMVFTDLLLKDSTPELRKFPFGVLAATPEEVARDLVPKMLATTGTGTFVEYLTRP  225

Query  453  RILIALVSAWLRRGR--WFDDQGRAV  382
            R L+   + ++++ +    DD G  +
Sbjct  226  RTLLKFFNRFVKQEKSDIIDDDGNVI  251



>ref|XP_005647798.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23254.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=278

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 83/141 (59%), Gaps = 8/141 (6%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKV---GVHTASPGMVLTD  598
            H+FN+  +  G S +     + +TK  L QL  SL +E + + V   GVH  SPGMVLTD
Sbjct  123  HIFNLGFSRWGASFSKSAVTHKATKSALTQLTQSLTEELQEAGVRSIGVHNLSPGMVLTD  182

Query  597  LLLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTP----PRILIALVS  430
            LLL  +S   ++ FN + E PETVA  LVP++R ++G+  ++++L+P     R++I    
Sbjct  183  LLLKDASPVARRFFNALAEEPETVAEALVPQIRAMQGTNGSVDFLSPVSAFGRVVIG-AP  241

Query  429  AWLRRGRWFDDQGRAVYAAEA  367
              +  GR+FD +G  V AA A
Sbjct  242  QIIGGGRFFDKEGNRVRAAGA  262



>ref|NP_001289228.1| chlorophyll(ide) b reductase NOL, chloroplastic [Pyrus x bretschneideri]
 gb|AHM26632.1| chlorophyll b reductase NOL protein [Pyrus x bretschneideri]
Length=353

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +      V VH  SPGMV 
Sbjct  216  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVAVHNLSPGMVT  275

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E PE VA  LVP +R V  +G
Sbjct  276  TDLLMSGATTKQAKFFINVLAEPPEVVAEYLVPNIRSVPANG  317



>gb|KIY92204.1| chlorophyll(ide) b reductase [Monoraphidium neglectum]
Length=138

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 77/137 (56%), Gaps = 18/137 (13%)
 Frame = -1

Query  756  MDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKR---SKVGVHTASPGMVLTDLLLS  586
            MDGAG+ G++TP  A YG+TK  L QL  SL  E K      VG+H  SPGMV T+LL+S
Sbjct  1    MDGAGADGNATPRFAAYGATKRSLAQLGKSLEAELKLLGVKNVGMHNLSPGMVTTELLMS  60

Query  585  GSSVQNKQMF-NIICELPETVARTLVPRMRIVKG---------SGKAINYLTPPR----I  448
            G+     + F N + E P+ VA+ LVPR+R V           S + I YLTPP+    I
Sbjct  61   GADTPVAKFFINCLAEEPQEVAQYLVPRLRRVPQESATLTGGISSQYIKYLTPPKAYSQI  120

Query  447  LIALVSAWLRRGRWFDD  397
            L  LV A  R+ RW  +
Sbjct  121  LKRLV-AGERKSRWVPE  136



>ref|XP_008456630.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Cucumis melo]
Length=224

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  87   GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVKNVVVHNLSPGMVT  146

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG+  +  + F N++ E PE VA  LVP +R +  +G
Sbjct  147  TDLLMSGADTKQAKFFINVLAEPPEVVAEYLVPNIRSIPTNG  188



>ref|XP_004140918.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004159455.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46061.1| hypothetical protein Csa_6G046390 [Cucumis sativus]
Length=352

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 74/135 (55%), Gaps = 11/135 (8%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  215  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVKNVVVHNLSPGMVT  274

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSGKA----INYLTPPRILIA  439
            TDLL+SG+  +  + F N++ E PE VA  LVP +R +  +G      I +LT  +    
Sbjct  275  TDLLMSGADTKQAKFFINVLAEPPEVVAEYLVPNIRSIPTNGSTRPTYIRFLTGLKAYSQ  334

Query  438  LVSAW---LRRGRWF  403
            + S      RR R+F
Sbjct  335  IFSRLAFGARRNRYF  349



>ref|XP_007218803.1| hypothetical protein PRUPE_ppa009825mg [Prunus persica]
 gb|EMJ20002.1| hypothetical protein PRUPE_ppa009825mg [Prunus persica]
Length=275

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK     L  SL  E +      V +H  SPGMV 
Sbjct  137  GGHIFNIDGAGSDGRPTPRFAAYGATKRSAVHLTKSLQAELQMQDVKNVAMHNLSPGMVT  196

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E PE VA  LVP +R V  +G
Sbjct  197  TDLLMSGATTKQAKFFINVLAEPPEVVAEYLVPNIRSVPANG  238



>ref|XP_007218802.1| hypothetical protein PRUPE_ppa009825mg [Prunus persica]
 gb|EMJ20001.1| hypothetical protein PRUPE_ppa009825mg [Prunus persica]
Length=274

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK     L  SL  E +      V +H  SPGMV 
Sbjct  137  GGHIFNIDGAGSDGRPTPRFAAYGATKRSAVHLTKSLQAELQMQDVKNVAMHNLSPGMVT  196

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E PE VA  LVP +R V  +G
Sbjct  197  TDLLMSGATTKQAKFFINVLAEPPEVVAEYLVPNIRSVPANG  238



>ref|XP_008231784.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Prunus 
mume]
Length=352

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +      V +H  SPGMV 
Sbjct  215  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVAMHNLSPGMVT  274

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E PE VA  LVP +R V  +G
Sbjct  275  TDLLMSGATTKQAKFFINVLAEPPEVVAEYLVPNIRSVPANG  316



>emb|CDP16548.1| unnamed protein product [Coffea canephora]
Length=344

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGHVFN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  207  GGHVFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  266

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG+  +  + F NI+ E  E VAR LVP +R +  SG
Sbjct  267  TDLLMSGADTKQAKFFINILAEPAEVVARYLVPNIRSIPISG  308



>ref|XP_002508859.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70117.1| predicted protein [Micromonas sp. RCC299]
Length=312

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 76/139 (55%), Gaps = 3/139 (2%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNM+GAGS GS+T   A YG TK G+ QL  ++ +E K   +GVHT SPGMV T+L+
Sbjct  174  GHIFNMEGAGSDGSATRKFAAYGHTKAGMAQLSKTMAEELKDIPIGVHTISPGMVFTELI  233

Query  591  LSGSSV---QNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWL  421
             SG      Q +   N + E  ++ A  +V +++    S  ++N     +IL   V+   
Sbjct  234  SSGRYAFGSQGRLFVNALAEPADSTAELIVEKLKEATESPDSVNRTIAIKILTPDVALRK  293

Query  420  RRGRWFDDQGRAVYAAEAD  364
              GR+   + +  Y  EAD
Sbjct  294  MFGRFVLGENKDRYYPEAD  312



>ref|XP_008456629.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Cucumis melo]
Length=390

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  253  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVKNVVVHNLSPGMVT  312

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG+  +  + F N++ E PE VA  LVP +R +  +G
Sbjct  313  TDLLMSGADTKQAKFFINVLAEPPEVVAEYLVPNIRSIPTNG  354



>ref|XP_010667592.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=351

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R + GSG
Sbjct  274  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNVRSMAGSG  315



>ref|XP_010452392.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
[Camelina sativa]
Length=349

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGKPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  313



>ref|XP_010667593.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=347

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  210  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  269

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R + GSG
Sbjct  270  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNVRSMAGSG  311



>gb|KFK24930.1| hypothetical protein AALP_AA8G043400 [Arabis alpina]
Length=349

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F NI+ E  E VA  LVP +R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINILAEPAEVVAEYLVPNIRAIPASG  313



>ref|XP_011091971.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Sesamum indicum]
Length=349

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E K   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELKMQDVKNVIVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +   GSG+   I +LT
Sbjct  272  TDLLMSGANTKQAKFFINVLAEPAEVVAEYLVPNIRAIPTNGSGRPTYIRFLT  324



>dbj|BAB11512.1| unnamed protein product [Arabidopsis thaliana]
Length=341

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  271  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  312



>ref|XP_006445683.1| hypothetical protein CICLE_v10016279mg [Citrus clementina]
 gb|ESR58923.1| hypothetical protein CICLE_v10016279mg [Citrus clementina]
Length=265

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  128  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  187

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  + VA  LVP++R +  SG
Sbjct  188  TDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASG  229



>gb|EJK52057.1| hypothetical protein THAOC_28713 [Thalassiosira oceanica]
Length=332

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 80/144 (56%), Gaps = 14/144 (10%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKEC---------KRSK--VGVHT  625
            GH+FN  G+G  G  TP  A YG+TK GL QL +SL KE          K++K  + VH+
Sbjct  173  GHIFNTVGSGVKGGGTPGYATYGATKRGLPQLTASLVKEIDEGVQGYEKKKTKGTIQVHS  232

Query  624  ASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRI  448
             SPGMV T LLL  S+ + ++  F ++   PE VA  LVP++   K +G  + +L+  R+
Sbjct  233  ISPGMVFTKLLLDDSTPELRKFPFGVLAAQPEEVAADLVPKILAQKTNGGLVEFLSTDRV  292

Query  447  LIALVSAWL--RRGRWFDDQGRAV  382
            L+     ++  ++  + DD G  +
Sbjct  293  LVKFFERFVLQKKSEYIDDDGNVI  316



>ref|XP_002871122.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47381.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=349

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  313



>gb|ACR37801.1| unknown [Zea mays]
 gb|AFW68116.1| short-chain dehydrogenase/reductase SDR [Zea mays]
Length=341

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  204  GGHIFNLDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  263

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMR  499
            TDLL+SG++ +  ++F NI+ E P+ VA  LVP +R
Sbjct  264  TDLLMSGATTKQAKIFINILAEPPDVVADYLVPNVR  299



>ref|NP_568145.1| chlorophyll(ide) b reductase NOL [Arabidopsis thaliana]
 sp|Q8LEU3.1|NOL_ARATH RecName: Full=Chlorophyll(ide) b reductase NOL, chloroplastic; 
AltName: Full=Protein NON-YELLOW COLORING 1-LIKE; Short=AtNOL; 
Short=Protein NYC1-LIKE; AltName: Full=Short-chain dehydrogenase/reductase 
NOL; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM62462.1| unknown [Arabidopsis thaliana]
 gb|ABF18991.1| At5g04900 [Arabidopsis thaliana]
 dbj|BAF49742.1| short-chain dehydrogenase/reductase AtNOL1 [Arabidopsis thaliana]
 gb|AED90802.1| chlorophyll(ide) b reductase NOL [Arabidopsis thaliana]
Length=348

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  271  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  312



>ref|XP_002292477.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90452.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=340

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 14/144 (10%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKEC---------KRSK--VGVHT  625
            GH+FN  G+G  G  TP  A YG+TK GL QL +SL KE          K++K  + VH+
Sbjct  181  GHIFNTVGSGVKGGGTPGYATYGATKRGLPQLTASLVKEIDEGVQGYEKKQTKGTIQVHS  240

Query  624  ASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRI  448
             SPGMV T LLL  S+ + ++  F ++   PE VA  LVP++   K +G  + +LT  RI
Sbjct  241  LSPGMVFTKLLLDDSTPELRKFPFGVLAAQPEEVAADLVPKILAQKTNGGIVEFLTTDRI  300

Query  447  LIALVSAWL--RRGRWFDDQGRAV  382
            L      ++  ++  + DD G  +
Sbjct  301  LNKFFERFILQKKSEYIDDDGNVI  324



>ref|XP_010491019.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Camelina 
sativa]
Length=349

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   +    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGKPTPRFAAYGATKRSVVHLTKSLQAELQMQDIKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  313



>ref|XP_006289440.1| hypothetical protein CARUB_v10002945mg [Capsella rubella]
 gb|EOA22338.1| hypothetical protein CARUB_v10002945mg [Capsella rubella]
Length=349

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGKPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAILASG  313



>emb|CDX80928.1| BnaC03g01820D [Brassica napus]
Length=347

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  210  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  269

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  270  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  311



>ref|NP_001146883.1| short-chain dehydrogenase/reductase SDR [Zea mays]
 gb|ACG24160.1| short-chain dehydrogenase/reductase SDR [Zea mays]
Length=341

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  204  GGHIFNLDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  263

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R +
Sbjct  264  TDLLMSGATTKQAKFFINILAEPPDVVADYLVPNVREI  301



>emb|CDY11316.1| BnaA03g01520D [Brassica napus]
Length=349

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  313



>ref|XP_009130847.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Brassica 
rapa]
Length=347

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  210  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  269

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  270  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  311



>ref|XP_003074351.1| putative short chain dehydrogenase (ISS) [Ostreococcus tauri]
 emb|CAL50202.1| Short-chain dehydrogenase/reductase SDR [Ostreococcus tauri]
Length=329

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 75/139 (54%), Gaps = 3/139 (2%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH+FNM+GAGS GS+T   A YG TK G+ QL  ++  E K S +GVHT SPGMV T+L+
Sbjct  191  GHIFNMEGAGSDGSATRKFAAYGHTKAGMAQLSKTMAVELKGSSIGVHTISPGMVFTELI  250

Query  591  LSGS---SVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWL  421
             SG      Q +   N + E     A  +V ++++   S +++N     +IL   V+   
Sbjct  251  SSGRFAFGSQGRMFVNALAEPANVTAEQIVKKIKVATESPESVNKTLAIKILTPDVALKK  310

Query  420  RRGRWFDDQGRAVYAAEAD  364
              GR+   + +  Y  E +
Sbjct  311  MFGRFILGENKDRYYPEKE  329



>ref|XP_006398945.1| hypothetical protein EUTSA_v10013856mg [Eutrema salsugineum]
 gb|ESQ40398.1| hypothetical protein EUTSA_v10013856mg [Eutrema salsugineum]
Length=373

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  236  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  295

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  296  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG  337



>ref|XP_001415854.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94146.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=309

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 73/137 (53%), Gaps = 3/137 (2%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GHVFNM+GAGS G++T   A YG TK G+ QL  ++  E K   +GVHT SPGMV T+L+
Sbjct  173  GHVFNMEGAGSDGAATRKFAAYGHTKAGMSQLAKTMAVELKDVPIGVHTISPGMVFTELI  232

Query  591  LSGSSV---QNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWL  421
             SG      Q +   N + E  E  A  +V ++++   S  ++N     +IL   V+   
Sbjct  233  SSGRDAFGSQGRMFVNALAEPAEVAAEQIVDKLKVATVSPDSVNKTIAIKILTPDVALRK  292

Query  420  RRGRWFDDQGRAVYAAE  370
              GR+   + R  +  E
Sbjct  293  MFGRFVLGENRDRFQKE  309



>dbj|BAK00206.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSK---VGVHTASPGMVL  604
            GGHVFN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++   V VH  SPGMV 
Sbjct  209  GGHVFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEMNNVVVHNLSPGMVT  268

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R +
Sbjct  269  TDLLMSGATTKQAKFFINILAEPPDVVADYLVPNIREI  306



>ref|XP_006485528.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=350

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  213  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  272

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  + VA  LVP++R +  SG
Sbjct  273  TDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASG  314



>ref|XP_009383124.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=355

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +  +V    VH  SPGMV 
Sbjct  218  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQEVKNVMVHNLSPGMVT  277

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGS  484
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R V  S
Sbjct  278  TDLLMSGATTKQAKFFINILAEPPDVVAAFLVPSIRSVPSS  318



>ref|XP_006485529.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=349

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 63/102 (62%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  + VA  LVP++R +  SG
Sbjct  272  TDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASG  313



>gb|KHG22371.1| Chlorophyll (ide) b reductase NOL, chloroplastic -like protein 
[Gossypium arboreum]
Length=351

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  274  TDLLMSGATTKQAKFFINVLAEPAEVVADYLVPNIRSIPASG  315



>ref|XP_002464146.1| hypothetical protein SORBIDRAFT_01g013080 [Sorghum bicolor]
 gb|EER91144.1| hypothetical protein SORBIDRAFT_01g013080 [Sorghum bicolor]
Length=541

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  204  GGHIFNLDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  263

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R +
Sbjct  264  TDLLMSGATTKQAKFFINILAEPPDVVADYLVPNVRAI  301



>gb|KJB73294.1| hypothetical protein B456_011G226100 [Gossypium raimondii]
Length=351

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct  274  TDLLMSGATTKQAKFFINVLAEPAEVVADYLVPNIRSIPASG  315



>ref|XP_006651647.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like, 
partial [Oryza brachyantha]
Length=488

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  158  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  217

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E P  VA  LVP +R +
Sbjct  218  TDLLMSGATTKQAKFFINILAEPPNVVADYLVPNIRAI  255



>ref|XP_011032940.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Populus euphratica]
Length=360

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (55%), Gaps = 11/135 (8%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  223  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVQNVVVHNLSPGMVT  282

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSGKA----INYLTPPRILIA  439
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G      I +LT  +    
Sbjct  283  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANGSTKPTYIRFLTGVKAYSQ  342

Query  438  LVSAW---LRRGRWF  403
            + S +    RR R+ 
Sbjct  343  IFSRFAFGARRNRYL  357



>ref|XP_011032939.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Populus euphratica]
Length=361

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  223  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVQNVVVHNLSPGMVT  282

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G
Sbjct  283  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANG  324



>ref|XP_004986341.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
[Setaria italica]
Length=538

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 4/96 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  224  GGHIFNLDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  283

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMR  499
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R
Sbjct  284  TDLLMSGATTKQAKFFINILAEPPDVVADYLVPNIR  319



>gb|KDP39501.1| hypothetical protein JCGZ_04165 [Jatropha curcas]
Length=346

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  209  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVQNVVVHNLSPGMVT  268

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G
Sbjct  269  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANG  310



>ref|XP_007010600.1| NYC1-like [Theobroma cacao]
 gb|EOY19410.1| NYC1-like [Theobroma cacao]
Length=356

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  219  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  278

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G
Sbjct  279  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANG  320



>ref|XP_010423519.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=382

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  245  GGHIFNIDGAGSDGKPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  304

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  +VP +R +  SG
Sbjct  305  TDLLMSGATTKQAKFFINVLAEPAEVVAEYVVPNIRAIPASG  346



>ref|XP_010423518.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=390

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  253  GGHIFNIDGAGSDGKPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  312

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  +VP +R +  SG
Sbjct  313  TDLLMSGATTKQAKFFINVLAEPAEVVAEYVVPNIRAIPASG  354



>ref|XP_002514449.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF47945.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=325

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  201  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVQNVMVHNLSPGMVT  260

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R V  +G
Sbjct  261  TDLLMSGATTKQAKFFINVLAEPAEVVAAYLVPNIRSVPANG  302



>ref|XP_010654105.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Vitis vinifera]
Length=316

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  179  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  238

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMR--IVKGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  E VA  LVP +R   V GS K   I +LT
Sbjct  239  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPVNGSTKPTYIRFLT  291



>ref|XP_010909530.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Elaeis 
guineensis]
Length=344

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +  +V    VH+ SPGMV 
Sbjct  207  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMHEVKNVMVHSLSPGMVT  266

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGS  484
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R +  +
Sbjct  267  TDLLMSGATTKQAKFFINILAEPPDVVAEYLVPCIRSIPNT  307



>ref|XP_007133514.1| hypothetical protein PHAVU_011G185400g [Phaseolus vulgaris]
 gb|ESW05508.1| hypothetical protein PHAVU_011G185400g [Phaseolus vulgaris]
Length=350

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  213  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVKNVLVHNLSPGMVT  272

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG + +  + F N++ E  E VA  LVP +R +  +G
Sbjct  273  TDLLMSGVNTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANG  314



>ref|XP_002266979.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Vitis vinifera]
 emb|CBI27402.3| unnamed protein product [Vitis vinifera]
Length=345

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  208  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  267

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMR--IVKGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  E VA  LVP +R   V GS K   I +LT
Sbjct  268  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPVNGSTKPTYIRFLT  320



>gb|EYU24451.1| hypothetical protein MIMGU_mgv1a020679mg [Erythranthe guttata]
Length=350

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 59/96 (61%), Gaps = 4/96 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGHVFN+DGAGS G  TP  A YG+TK  +  L  SL  E K   V    VH  SPGMV 
Sbjct  213  GGHVFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELKMQDVKNVVVHNLSPGMVT  272

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMR  499
            TDLL+SG++ +  + F N++ E  E VA  LVP +R
Sbjct  273  TDLLMSGANTKQAKFFINVLAEPAEVVAEYLVPNIR  308



>ref|XP_009796256.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X3 [Nicotiana sylvestris]
Length=224

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  87   GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVIVHNLSPGMVT  146

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +  +G
Sbjct  147  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNG  188



>ref|XP_004306432.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=347

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 11/134 (8%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGHVFN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  210  GGHVFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKDVIVHNLSPGMVT  269

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSGKA----INYLTPPRILIA  439
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G      I +LT  +    
Sbjct  270  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPTNGSVKPTYIRFLTGIKAYSQ  329

Query  438  LVSAW---LRRGRW  406
            + S +    RR R+
Sbjct  330  IFSRFAFGARRNRY  343



>ref|XP_003546651.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN24318.1| Chlorophyll(ide) b reductase NOL, chloroplastic [Glycine soja]
Length=349

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG + +  + F N++ E  E VA  LVP +R V  +G
Sbjct  272  TDLLMSGVNTKQAKFFINVLAEPAEVVAEYLVPNIRSVPANG  313



>ref|XP_010321272.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X4 [Solanum lycopersicum]
Length=346

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  209  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  268

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  269  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  321



>ref|XP_004239607.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=350

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  213  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  272

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  273  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  325



>ref|XP_010321271.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X3 [Solanum lycopersicum]
Length=347

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  210  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  269

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  270  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  322



>ref|XP_010321270.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=351

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  274  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  326



>ref|XP_006346694.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X4 [Solanum tuberosum]
Length=319

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  182  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  241

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  242  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  294



>ref|XP_002310986.2| hypothetical protein POPTR_0008s01480g [Populus trichocarpa]
 gb|EEE88353.2| hypothetical protein POPTR_0008s01480g [Populus trichocarpa]
Length=367

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V     H  SPGMV 
Sbjct  230  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVQNVVAHNLSPGMVT  289

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G
Sbjct  290  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANG  331



>ref|XP_006346693.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=348

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  271  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  323



>ref|XP_006346691.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006346692.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=349

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVLVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +   GS KA  I +LT
Sbjct  272  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNGSTKATYIRFLT  324



>ref|XP_002310976.2| hypothetical protein POPTR_0008s01480g [Populus trichocarpa]
 gb|EEE88343.2| hypothetical protein POPTR_0008s01480g [Populus trichocarpa]
Length=383

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V     H  SPGMV 
Sbjct  246  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVQNVVAHNLSPGMVT  305

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G
Sbjct  306  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPANG  347



>ref|XP_002179032.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49730.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=877

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 80/144 (56%), Gaps = 14/144 (10%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKEC---------KRSK--VGVHT  625
            GH+FN  G+G  G  TP  A YG+TK GL QL ++L KE          K++K  + VH+
Sbjct  718  GHIFNTVGSGVKGGGTPGYACYGATKRGLPQLTATLVKELDEGVQGYEKKKTKGTIQVHS  777

Query  624  ASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRI  448
             SPGMV T LLL  S+ + ++  F ++   PE VA  LVP++   K +G ++ +LT  RI
Sbjct  778  LSPGMVFTKLLLDDSTPELRKFPFGVLAAQPEEVAADLVPKILAQKSNGGSVEFLTTDRI  837

Query  447  LIALVSAWL--RRGRWFDDQGRAV  382
            L      ++  ++  + DD G  +
Sbjct  838  LNKFFERFILQKKSAYIDDDGNVI  861



>ref|XP_010266684.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Nelumbo 
nucifera]
Length=359

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  222  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVRNVIVHNLSPGMVT  281

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +G
Sbjct  282  TDLLMSGANTKQAKFFINVLAEPAEVVAEYLVPSIRSIPTNG  323



>ref|XP_010543634.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Tarenaya 
hassleriana]
Length=352

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  215  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  274

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            T+LL+SG++ +  + F N++ E  E VA  L+P +R +  SG
Sbjct  275  TELLMSGATTKQAKFFINVLAEPAEVVAEYLIPNIRAILASG  316



>sp|Q84ST4.1|NOL_ORYSJ RecName: Full=Chlorophyll(ide) b reductase NOL, chloroplastic; 
AltName: Full=Protein NON-YELLOW COLORING 1-LIKE; Short=OsNOL; 
Short=Protein NYC1-LIKE; AltName: Full=Short-chain dehydrogenase/reductase 
NOL; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAO73232.1| putative oxidoreductase protein [Oryza sativa Japonica Group]
 gb|AAT78833.1| putative short chain dehydrogenase (having alternative splicing 
products) [Oryza sativa Japonica Group]
 dbj|BAF49741.1| short-chain dehydrogenase/reductase NOL1 [Oryza sativa Japonica 
Group]
 gb|EEC75847.1| hypothetical protein OsI_12846 [Oryza sativa Indica Group]
 gb|EEE59614.1| hypothetical protein OsJ_11943 [Oryza sativa Japonica Group]
Length=343

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  206  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  265

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E    VA  LVP +R +
Sbjct  266  TDLLMSGATTKQAKFFINILAEPANVVADYLVPNIRAI  303



>gb|KEH19223.1| chlorophyll(ide) B reductase, putative [Medicago truncatula]
Length=341

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  204  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVMVHNLSPGMVT  263

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGS  484
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +  +
Sbjct  264  TDLLMSGANTKQAKFFINVLAEPAEVVAEYLVPNIRSIPAN  304



>ref|XP_009611197.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=348

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVIVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +  +G
Sbjct  271  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNG  312



>ref|XP_004511171.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
[Cicer arietinum]
Length=341

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  204  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVMVHNLSPGMVT  263

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +
Sbjct  264  TDLLMSGANTKQAKFFINVLAEPAEVVAEYLVPNIRSI  301



>ref|XP_009796254.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=348

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVIVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  + VA  LVP +R +  +G
Sbjct  271  TDLLMSGANTKQAKFFINVLAEPADVVAEYLVPNIRSIPTNG  312



>ref|XP_010067082.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X1 [Eucalyptus grandis]
 gb|KCW65149.1| hypothetical protein EUGRSUZ_G02650 [Eucalyptus grandis]
Length=354

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FNMDGAG+ G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  217  GGHIFNMDGAGADGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVLVHNLSPGMVT  276

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            TDLL+ G +    + F N++ E  E VA+ LVP +R V  +G
Sbjct  277  TDLLMCGVTTNQAKFFINVLAEPAEVVAKYLVPNIRSVPTNG  318



>ref|XP_010103987.1| Chlorophyll(ide) b reductase NOL [Morus notabilis]
 gb|EXB97690.1| Chlorophyll(ide) b reductase NOL [Morus notabilis]
Length=354

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVRNVVVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F N++ E  E VA  LVP +R +
Sbjct  274  TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSI  311



>gb|ABF97956.1| myb-like DNA-binding domain, SHAQKYF class family protein, expressed 
[Oryza sativa Japonica Group]
Length=556

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  223  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT  282

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E    VA  LVP +R +
Sbjct  283  TDLLMSGATTKQAKFFINILAEPANVVADYLVPNIRAI  320



>ref|XP_002956541.1| hypothetical protein VOLCADRAFT_67034 [Volvox carteri f. nagariensis]
 gb|EFJ42478.1| hypothetical protein VOLCADRAFT_67034 [Volvox carteri f. nagariensis]
Length=303

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 75/142 (53%), Gaps = 17/142 (12%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKE---CKRSKVGVHTASPGMVLT  601
            GH+FNMDGAG+ G++TP  A YG+TK  L QL  SL  E        V VH  SPGMV T
Sbjct  160  GHIFNMDGAGADGNATPRFAAYGATKRSLAQLGRSLGAELGILGIRHVAVHNLSPGMVTT  219

Query  600  DLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKG----------SGKAINYLTPP  454
            +LL++G++    + F N + E    VA  LVPR+R V            S   I YLT  
Sbjct  220  ELLMTGANTPTAKFFINCLAEPAADVAAYLVPRIRAVPQSSVNPLTGSLSATYIRYLTQS  279

Query  453  RILIALVSAWL---RRGRWFDD  397
            + L  + +  L   R+GR+  +
Sbjct  280  KALQQIAARLLTGARKGRYVPE  301



>ref|XP_002505343.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66601.1| predicted protein [Micromonas sp. RCC299]
Length=333

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 3/111 (3%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVLTD  598
            HV+N   +  G S +  T  + +TK GL QL +SL +E   +    VGVH  SPGMVLTD
Sbjct  178  HVYNFGFSQWGASFSKSTCTHKATKRGLSQLTASLSEELLEAGVDSVGVHQLSPGMVLTD  237

Query  597  LLLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRIL  445
            LLL G+S   ++ FN++ E PE VA  L P++R   G+  AI +LT P  L
Sbjct  238  LLLEGASPVARRFFNVLAEEPEVVAADLCPKIRETVGTRTAIEFLTLPDAL  288



>ref|XP_008777050.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic, partial 
[Phoenix dactylifera]
Length=268

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 63/110 (57%), Gaps = 13/110 (12%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL------------FKECKRSKVGV  631
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL             +  +   V V
Sbjct  122  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQLKSTLGFDKAELQMHQVKNVMV  181

Query  630  HTASPGMVLTDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGS  484
            H+ SPGMV TDLL+SG++ +  + F NI+ E P+ VA  LVP +R +  S
Sbjct  182  HSLSPGMVTTDLLMSGATTKQAKFFINILAEPPDVVAEYLVPCIRSIPSS  231



>gb|KJB73296.1| hypothetical protein B456_011G226100 [Gossypium raimondii]
Length=355

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPET----VARTLVPRMRIVKGSG  481
            TDLL+SG++ +  + F N++ E  E     VA  LVP +R +  SG
Sbjct  274  TDLLMSGATTKQAKFFINVLAEPAEVVRLRVADYLVPNIRSIPASG  319



>ref|XP_011400485.1| Chlorophyll(ide) b reductase NOL, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27508.1| Chlorophyll(ide) b reductase NOL, chloroplastic [Auxenochlorella 
protothecoides]
Length=247

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 81/134 (60%), Gaps = 18/134 (13%)
 Frame = -1

Query  744  GSGGSSTPLTAVYGSTKCGLRQLQSSLFKECK----RSKVGVHTASPGMVLTDLLLSGSS  577
            G+ G +TP  A YG++K  L QL  SL  E +    R ++ VHT SPGMV T+LL++G+ 
Sbjct  115  GADGGATPRFAAYGASKRALSQLGKSLNAELRGSPRRGRITVHTMSPGMVTTELLMAGAD  174

Query  576  VQNKQMF-NIICELPETVARTLVPRMR-IVKGS-------GKAINYLTPPR----ILIAL  436
             +  + F N++ E PETVA  LVPR+R +V+GS        + I YLT P+    IL+ L
Sbjct  175  TRVARFFINVLAETPETVAANLVPRLRQVVEGSRGVLGSRPQYIRYLTKPKAYGQILMRL  234

Query  435  VSAWLRRGRWFDDQ  394
            + A  R+ ++ +++
Sbjct  235  L-AKQRKNKFVEEE  247



>ref|XP_005828297.1| hypothetical protein GUITHDRAFT_74825 [Guillardia theta CCMP2712]
 gb|EKX41317.1| hypothetical protein GUITHDRAFT_74825 [Guillardia theta CCMP2712]
Length=364

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 72/144 (50%), Gaps = 15/144 (10%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG------------VHT  625
            HVFN  G+G  G  TP    YG+TK G  Q+  SL  E  +   G            VHT
Sbjct  205  HVFNTVGSGVKGGGTPGYVCYGATKRGQPQMTKSLVDELTKGVQGYEKKEYPGDVKQVHT  264

Query  624  ASPGMVLTDLLLSGSSVQNKQM-FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRI  448
             SPGMV T LLL  S+ + ++  F ++   PE VA  LVP++      G ++ +LT  +I
Sbjct  265  LSPGMVFTQLLLDDSTPELRKFPFGVLAAQPEEVAADLVPKILSTTEQGSSVEFLTTDKI  324

Query  447  LIALVSAWL--RRGRWFDDQGRAV  382
            L  L S ++  ++  + DD G  +
Sbjct  325  LFKLFSRFVLQQKSEYIDDDGNVI  348



>gb|KIZ02557.1| hypothetical protein MNEG_5398 [Monoraphidium neglectum]
Length=429

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 6/118 (5%)
 Frame = -1

Query  726  TPLTAVYGSTKCGLRQLQSSLFKECKRSKV---GVHTASPGMVLTDLLLSGSSVQNKQMF  556
            T   A + STK  L QL  SL  E   S V   GVH  SPGM+LT LLL  S+   ++ F
Sbjct  189  TKSAATHKSTKRALTQLCESLAAELAESGVTSIGVHNLSPGMMLTGLLLKDSTPAARRFF  248

Query  555  NIICELPETVARTLVPRMRIVKGSGKAINYLTPPRI---LIALVSAWLRRGRWFDDQG  391
            N + E PETVA  L  R+R V+GSG +++YLTP      +++ V   +  GR+FD +G
Sbjct  249  NALAEEPETVAAALAQRIRGVQGSGGSVDYLTPADAAFRVLSSVPQIINGGRFFDKEG  306



>ref|XP_003061611.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH54241.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=275

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 71/138 (51%), Gaps = 15/138 (11%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECK---RSKVGVHTASPGMVLT  601
            GH+FNM+GAGS G +T   A YG TK G+ QL  ++ +E K      V VHT SPGMV T
Sbjct  136  GHIFNMEGAGSDGGATKKYAAYGHTKAGMAQLAKTMREELKVRLGENVAVHTISPGMVFT  195

Query  600  DLLLSGSSV---QNKQMFNIICELPETVARTLVPRMRIVKGSGKAIN------YLTPPRI  448
            +L+ SG      Q +   N + E  +  A  +V R++    +  A+        LTP   
Sbjct  196  ELISSGRYAFGGQGRMFVNALAEDADDTAAVIVERVKEAIAAADAVEKTIAVKVLTPDVA  255

Query  447  LIALVSAWLR---RGRWF  403
            L  + + ++R   + RW+
Sbjct  256  LKKMFNRFVRGVNKDRWY  273



>ref|XP_006856083.1| hypothetical protein AMTR_s00059p00121300 [Amborella trichopoda]
 gb|ERN17550.1| hypothetical protein AMTR_s00059p00121300 [Amborella trichopoda]
Length=354

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct  217  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMNEVKNVMVHNLSPGMVT  276

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            T+LL+SG+  +  + F N++ E  E VA  LV  +R V  SG
Sbjct  277  TELLMSGALTKQAKFFVNVLAEPAEVVAEYLVRCIRSVVSSG  318



>ref|XP_010231930.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Brachypodium 
distachyon]
Length=342

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTA---SPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V        SPGMV 
Sbjct  205  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVVVHNLSPGMVT  264

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F NI+ E P+ VA  LVP +R +
Sbjct  265  TDLLMSGATTKQAKFFINILAEPPDVVADYLVPNVRAI  302



>ref|WP_010932815.1| short-chain dehydrogenase [Chlorobaculum tepidum]
 ref|NP_662034.1| short chain dehydrogenase/reductase oxidoreductase [Chlorobium 
tepidum TLS]
 gb|AAM72376.1| oxidoreductase, short chain dehydrogenase/reductase family [Chlorobium 
tepidum TLS]
Length=278

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 76/133 (57%), Gaps = 7/133 (5%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVLTD  598
            H+FNM  + +G  S+P +  + ++K  +  +   L +E + +    VG+H  SPG+VLTD
Sbjct  144  HLFNMGFSSAGLRSSPTSVPHRASKRAVAIMSKLLRQELEAAGIRSVGIHELSPGLVLTD  203

Query  597  LLLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSA---  427
            LLL  ++   K+ FN + E  ETVA TLVP +R + G G  + Y  P   + A ++A   
Sbjct  204  LLLRDATPAQKRFFNAMAETSETVAATLVPAIRAITGRGSTLRY-QPVLFMFAKLAASAF  262

Query  426  WLRRGRWFDDQGR  388
              R+ R+FD +G+
Sbjct  263  GYRKERFFDSEGK  275



>ref|XP_001768174.1| predicted protein [Physcomitrella patens]
 gb|EDQ67047.1| predicted protein, partial [Physcomitrella patens]
Length=228

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKR---SKVGVHTASPGMVLTD  598
            H+FNM  +  G S T     + STK  L QL  SL +E +    S +GVH  SPGMVLTD
Sbjct  135  HIFNMGFSRWGASFTKSACTHKSTKVALTQLTRSLSEELQAAGLSSIGVHNLSPGMVLTD  194

Query  597  LLLSGSSVQNKQMFNIICELPETVARTLVPRM  502
            LLL  S+   ++ FN + E PETVA+ LVPR+
Sbjct  195  LLLKDSTPVARRFFNTLAEEPETVAKDLVPRI  226



>ref|XP_008344535.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
[Malus domestica]
Length=326

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +      V VH  SPGMV 
Sbjct  218  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVAVHNLSPGMVT  277

Query  603  TDLLLSGSSVQNKQMF-NIICELPETV  526
            TDLL+SG++ +  + F N++ E PE V
Sbjct  278  TDLLMSGATTKQAKFFINVLAEPPEVV  304



>ref|XP_007511401.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17522.1| predicted protein [Bathycoccus prasinos]
Length=387

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 77/144 (53%), Gaps = 17/144 (12%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKE------CKRSKVGVHTASPG  613
            G H+FNM+GAGS G  T   A YG TK GL QL  +L KE       K   + VHT SPG
Sbjct  190  GYHIFNMEGAGSDGMETRKYAAYGFTKAGLSQLTKTLNKEMSSNEKMKDKMIKVHTVSPG  249

Query  612  MVLTDLLLSGSSVQNKQ--MF-NIICELPETVARTLVPRMRIVKGSGK-----AINYLTP  457
            MV TDL+ SG     KQ  MF N + E  +  A  +V +++   G+ +     AI  LTP
Sbjct  250  MVFTDLISSGRYAFGKQGRMFVNALAEPADVAASGVVRKIKTELGNSRGKKSLAIKLLTP  309

Query  456  PRILIALVSAWLR---RGRWFDDQ  394
               ++ L + +++   + R++ ++
Sbjct  310  DVAVVKLFNRFVKQIGKDRYYPEE  333



>ref|WP_041465674.1| short-chain dehydrogenase [Chlorobium limicola]
Length=275

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 69/135 (51%), Gaps = 6/135 (4%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G +FNM+G GS G       VYG+TK  L     S   E + S V V T SPGMV+TDLL
Sbjct  139  GKIFNMEGFGSDGFMLDGMTVYGTTKRSLSYFTRSFAHEARSSGVQVGTLSPGMVVTDLL  198

Query  591  L------SGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVS  430
                   S  S++ ++ FN++ +  ETV+  L  RM   +     I +LT PR+L  L+ 
Sbjct  199  RMTAAESSQESLKKRKFFNVMADDVETVSVFLADRMLAARELSPEIRWLTKPRMLGKLLL  258

Query  429  AWLRRGRWFDDQGRA  385
            A  R+  +F     A
Sbjct  259  APFRKRDFFSQHDSA  273



>gb|ACD90027.1| short-chain dehydrogenase/reductase SDR [Chlorobium limicola 
DSM 245]
Length=276

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 69/135 (51%), Gaps = 6/135 (4%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G +FNM+G GS G       VYG+TK  L     S   E + S V V T SPGMV+TDLL
Sbjct  140  GKIFNMEGFGSDGFMLDGMTVYGTTKRSLSYFTRSFAHEARSSGVQVGTLSPGMVVTDLL  199

Query  591  L------SGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVS  430
                   S  S++ ++ FN++ +  ETV+  L  RM   +     I +LT PR+L  L+ 
Sbjct  200  RMTAAESSQESLKKRKFFNVMADDVETVSVFLADRMLAARELSPEIRWLTKPRMLGKLLL  259

Query  429  AWLRRGRWFDDQGRA  385
            A  R+  +F     A
Sbjct  260  APFRKRDFFSQHDSA  274



>ref|WP_014254598.1| alcohol dehydrogenase [[Clostridium] clariflavum]
 gb|AEV67984.1| short-chain alcohol dehydrogenase [ [[Clostridium] clariflavum 
DSM 19732]
Length=264

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 68/128 (53%), Gaps = 9/128 (7%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G ++NM+G GS G     T +Y S+K  +      L KE K S V +   SPGM+LTDL+
Sbjct  131  GQIWNMEGLGSDGRIVEKTLLYASSKAAITYFTKGLAKELKNSPVKIGRLSPGMMLTDLM  190

Query  591  LSGSS---------VQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIA  439
            +  S+          Q K++FNI+ E PETVA+ LVPR+         I +LT  + +  
Sbjct  191  VKTSTGEPSSVNQDAQFKKIFNILGERPETVAKFLVPRILSNTKQDAHIVWLTNFKAMRK  250

Query  438  LVSAWLRR  415
             ++A  R+
Sbjct  251  FITAPFRK  258



>ref|XP_003060272.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55041.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=227

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 3/93 (3%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVLTD  598
            HV+N   +  G S +  T  + +TK GL QL +SL +E K +    VG+H  SPGMVLTD
Sbjct  135  HVYNFGFSRWGASFSKSTCTHKATKRGLSQLTASLSEELKEAGVHAVGIHQLSPGMVLTD  194

Query  597  LLLSGSSVQNKQMFNIICELPETVARTLVPRMR  499
            LLL G+S   ++ FN++ E PE VA  L P++R
Sbjct  195  LLLDGASPVARRFFNVLAEEPEVVAADLAPKIR  227



>ref|XP_011091972.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Sesamum indicum]
Length=332

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 62/110 (56%), Gaps = 19/110 (17%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL               PGMV TDL
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSL--------------QPGMVTTDL  257

Query  594  LLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV--KGSGKA--INYLT  460
            L+SG++ +  + F N++ E  E VA  LVP +R +   GSG+   I +LT
Sbjct  258  LMSGANTKQAKFFINVLAEPAEVVAEYLVPNIRAIPTNGSGRPTYIRFLT  307



>ref|XP_011397241.1| putative chlorophyll(ide) b reductase NYC1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24353.1| putative chlorophyll(ide) b reductase NYC1, chloroplastic [Auxenochlorella 
protothecoides]
Length=298

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG-------VHTASP  616
            GGHVFNMDGAG+GG  TP  A YG+TK G+ QL  S+ +E      G       +H  SP
Sbjct  198  GGHVFNMDGAGAGGGPTPGFATYGATKAGIAQLLESVVRERAGKASGREGGGAALHNLSP  257

Query  615  GMVLTDLLLSGSSVQNKQMFNIICELPETVARTL  514
            GM LTDLLL+G++   K  FN++CE PETVA  L
Sbjct  258  GMALTDLLLAGATPGTKAAFNVLCEQPETVAAHL  291



>gb|KJB73295.1| hypothetical protein B456_011G226100 [Gossypium raimondii]
Length=327

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 58/98 (59%), Gaps = 10/98 (10%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  214  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT  273

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            TDLL+SG++ +  + F N++ E  E V      R+R+V
Sbjct  274  TDLLMSGATTKQAKFFINVLAEPAEVV------RLRVV  305



>ref|WP_027622787.1| alcohol dehydrogenase [[Clostridium] clariflavum]
Length=264

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 68/130 (52%), Gaps = 9/130 (7%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G ++NM+G GS G     T +Y S+K  +      L KE K S V +   SPGM+LTDL+
Sbjct  131  GQIWNMEGLGSDGRIVEKTLLYASSKAAITYFTKGLAKELKNSPVKIGRLSPGMMLTDLM  190

Query  591  LSGSS---------VQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIA  439
            +  S+          Q K++FNI+ E PETVA+ LVPR+         I +LT  + +  
Sbjct  191  VKTSTGEPSSVNQDAQFKKIFNILGERPETVAKFLVPRILSNTKQDAHIVWLTNFKAMKK  250

Query  438  LVSAWLRRGR  409
             + A  ++G 
Sbjct  251  FMLAPFKKGE  260



>dbj|BAO56869.1| chlorophyll b reductase, partial [Egeria densa]
Length=126

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGHVFNMDGAGS G  TP  A YG+TK  +  L  SL  E +  +V    VH  SPGMV 
Sbjct  51   GGHVFNMDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMHEVKNVMVHNLSPGMVT  110

Query  603  TDLLLSGSSVQNKQMF  556
            TDLL+SG++ +  + F
Sbjct  111  TDLLMSGATTKQAKFF  126



>gb|EMT28465.1| Granaticin polyketide synthase putative ketoacyl reductase 1 
[Aegilops tauschii]
Length=381

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 15/93 (16%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL               PGMV TDL
Sbjct  137  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSL--------------QPGMVTTDL  182

Query  594  LLSGSSVQNKQMF-NIICELPETVARTLVPRMR  499
            L+SG++ +  + F NI+ E P+ VA  LVP +R
Sbjct  183  LMSGATTKQAKFFINILAETPDVVADYLVPNIR  215



>ref|XP_006598008.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X2 [Glycine max]
Length=332

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 55/99 (56%), Gaps = 15/99 (15%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL               PGMV TDL
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSL--------------QPGMVTTDL  257

Query  594  LLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG  481
            L+SG + +  + F N++ E  E VA  LVP +R V  +G
Sbjct  258  LMSGVNTKQAKFFINVLAEPAEVVAEYLVPNIRSVPANG  296



>ref|WP_012502328.1| short-chain dehydrogenase [Chlorobaculum parvum]
 gb|ACF11495.1| short-chain dehydrogenase/reductase SDR [Chlorobaculum parvum 
NCIB 8327]
Length=282

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -1

Query  768  HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSK---VGVHTASPGMVLTD  598
            H+FNM  + +G  S+P +  + ++K  +  +   L +E +RS    +GVH  SPG+VLT+
Sbjct  147  HLFNMGFSSAGLRSSPTSVAHRASKRAVALMSELLLEELERSSNRSIGVHELSPGLVLTE  206

Query  597  LLLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWL-  421
            LLL  +++++K+ FN + E  ETVA  LVP +R +     A+ Y     +L+ LV++   
Sbjct  207  LLLRDATIEHKRFFNAMAETAETVAARLVPAIRRIDKRDGAVRYQPVITMLLRLVASRFG  266

Query  420  -RRGRWFDDQG  391
             R+ R+FD  G
Sbjct  267  YRKERFFDSGG  277



>gb|EMS50882.1| Chlorophyll(ide) b reductase NOL, chloroplastic [Triticum urartu]
Length=467

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 15/95 (16%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL               PGMV TDL
Sbjct  151  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSL--------------QPGMVTTDL  196

Query  594  LLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV  493
            L+SG++ +  + F NI+ E P+ VA  LVP +R +
Sbjct  197  LMSGATTKQAKFFINILAETPDVVADYLVPNIREI  231



>ref|WP_040936382.1| hypothetical protein, partial [Prochloron didemni]
Length=252

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 6/115 (5%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH++NM+G GS G      + YG++K  +R L  +L KE K + V V T SPGMV TDL+
Sbjct  133  GHIYNMEGHGSDGQIMAGMSGYGTSKSAVRYLTKALIKETKGTGVKVSTLSPGMVTTDLV  192

Query  591  ---LSGSSV---QNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRIL  445
                 G      + K +F+I+ +  E VA  LV RM     +G +I++ T P+IL
Sbjct  193  QDQFEGDPAGLERAKVIFDIMGDPVEKVAPWLVDRMLANNKTGASISWFTAPKIL  247



>ref|WP_040932739.1| hypothetical protein, partial [Prochloron didemni]
Length=252

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 6/115 (5%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH++NM+G GS G      + YG++K  +R L  +L KE K + V V T SPGMV TDL+
Sbjct  133  GHIYNMEGHGSDGQIMAGMSGYGTSKSAVRYLTKALIKETKGTGVKVSTLSPGMVTTDLV  192

Query  591  ---LSGSSV---QNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRIL  445
                 G      + K +F+I+ +  E VA  LV RM     +G +I++ T P+IL
Sbjct  193  QDQFEGDPAGLERAKVIFDIMGDPVEKVAPWLVDRMLANNKTGASISWFTAPKIL  247



>ref|WP_040714435.1| chitin-binding protein [Nocardia takedensis]
Length=255

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 67/130 (52%), Gaps = 5/130 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHV+NM+G GS G       VYG++K GL     +L +E     V V   SPGMV+TDL
Sbjct  127  GGHVWNMEGLGSDGRIVDGLGVYGASKRGLTYFTEALAREVP-DGVTVGLLSPGMVITDL  185

Query  594  LLSGSS----VQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSA  427
            LL G      V+ +++ NI+ +  ETVA  L  R      +G  +  LT PRI      A
Sbjct  186  LLHGYDDAELVRIRKVMNILADRVETVAPWLAERALTRTRNGAHVRRLTGPRIAARFALA  245

Query  426  WLRRGRWFDD  397
             +RR   F D
Sbjct  246  PVRRRDLFTD  255



>ref|WP_009151323.1| short-chain dehydrogenase of unknown substrate specificity [Thiorhodovibrio 
sp. 970]
 gb|EIC20920.1| short-chain dehydrogenase of unknown substrate specificity [Thiorhodovibrio 
sp. 970]
Length=271

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 4/133 (3%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            GH++ ++G GSGG     + +YG++K  LR    SL  E + + V + + +PG+V TDLL
Sbjct  137  GHIYTLEGWGSGGERRHGSTLYGTSKAALRYFTKSLAAELRGTPVKLSSLNPGVVPTDLL  196

Query  591  -LSGSSVQNKQM---FNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAW  424
             LS    Q KQ+    NI  +  ETVA  L  R+   +  G  I +L P R+L+ L+ A 
Sbjct  197  ALSMRPEQAKQIRRFINIFGDKVETVASGLAERVLNNQRHGARIQWLPPRRMLMRLLQAP  256

Query  423  LRRGRWFDDQGRA  385
             R+ R  D +G +
Sbjct  257  FRQRRIIDPRGES  269



>gb|KCW65150.1| hypothetical protein EUGRSUZ_G02650 [Eucalyptus grandis]
Length=340

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 4/100 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FNMDGAG+ G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  217  GGHIFNMDGAGADGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVLVHNLSPGMVT  276

Query  603  TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKG  487
            TDLL+ G +    + F N++ E  E V+    P +++  G
Sbjct  277  TDLLMCGVTTNQAKFFINVLAEPAEVVSSYSRPGVKLFFG  316



>ref|XP_009611198.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=311

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVIVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICE  541
            TDLL+SG++ +  + F N++ E
Sbjct  271  TDLLMSGANTKQAKFFINVLAE  292



>ref|WP_042455527.1| hypothetical protein [Bacillus sp. FF4]
Length=255

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G ++NM+G GS G       +YG++K  +     SL  E K + + + T SPGMV TD L
Sbjct  132  GQIYNMEGFGSNGMMREKMTIYGTSKSAITYFTRSLAIEAKDTNIKMGTLSPGMVATDFL  191

Query  591  LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRIL  445
                   N++++NI+ +  E V R LV ++   + +G  I +LT P+++
Sbjct  192  KKSLDEHNQKIYNILGDKVEPVTRFLVAQILNNRKNGARIQWLTNPKVM  240



>ref|XP_009796255.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=311

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  211  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELEMQDVKNVIVHNLSPGMVT  270

Query  603  TDLLLSGSSVQNKQMF-NIICE  541
            TDLL+SG++ +  + F N++ E
Sbjct  271  TDLLMSGANTKQAKFFINVLAE  292



>ref|XP_006598009.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like 
isoform X3 [Glycine max]
Length=312

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL  604
            GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +   V    VH  SPGMV 
Sbjct  212  GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELRMQDVKNVVVHNLSPGMVT  271

Query  603  TDLLLSGSSVQNKQMF-NIICELPE  532
            TDLL+SG + +  + F N++ E  E
Sbjct  272  TDLLMSGVNTKQAKFFINVLAEPAE  296



>ref|WP_018679854.1| hypothetical protein [Acinetobacter tjernbergiae]
 gb|ESK55113.1| hypothetical protein F990_02151 [Acinetobacter tjernbergiae DSM 
14971 = CIP 107465]
Length=277

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 7/126 (6%)
 Frame = -1

Query  771  GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL  592
            G +FNM+G GS G  +    VYG+TK  +     +L++E K S + V T SPGMV TDLL
Sbjct  139  GQIFNMEGWGSRGEWSAGMTVYGTTKRAISYFSQALYRESKSSPILVGTLSPGMVATDLL  198

Query  591  LS---GSSVQN----KQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALV  433
            +S     +VQN    K++F  I + PE V   L   +   K +   I ++TP R+LI   
Sbjct  199  ISSWQNGNVQNWKKMKRLFLFIIDPPEKVCAYLAQGIINNKKTNVRIVWMTPWRLLIRFF  258

Query  432  SAWLRR  415
              +  R
Sbjct  259  QPYYWR  264



>ref|WP_040796361.1| chitin-binding protein [Nocardia higoensis]
Length=264

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 5/131 (4%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHV+NM+G GS G       +YG+TK  +  L  +L KE     V +   SPGMV+TDL
Sbjct  131  GGHVWNMEGLGSDGRMVAGLGLYGATKRAVGYLSQALAKEAPEG-VSIGRLSPGMVVTDL  189

Query  594  LLSGSS----VQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSA  427
            LL G S    V  K++ NI+ +  ETV   L  ++     +G  + +LT P+I      A
Sbjct  190  LLHGYSADELVAVKKVMNILADKVETVTPWLAEQVVSQTRNGAHVRWLTTPKIAARFAMA  249

Query  426  WLRRGRWFDDQ  394
             +R+   F D 
Sbjct  250  PIRKRDLFGDN  260



>ref|WP_019925584.1| hypothetical protein [Nocardia sp. BMG111209]
Length=262

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = -1

Query  774  GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL  595
            GGHV+NM+G GS G S P   VYG+TK  +  L   L +E   + V V   SPGMV+TDL
Sbjct  129  GGHVWNMEGLGSDGRSVPGLTVYGATKRAVTYLTRGLTREVP-AGVSVGLLSPGMVVTDL  187

Query  594  LLSGSS-----VQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVS  430
            L  G +      + +++FNI+ +  ETV   L  R      +G+ + +LT  +++    +
Sbjct  188  LTGGYADPDELAKARKVFNILADRVETVTPWLAERAVTRTRNGEHVAWLTTGKVMRRFAT  247

Query  429  AWLRRGRWFDD  397
            A  RR   F +
Sbjct  248  APFRRRDLFAE  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520