BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015H23

Length=846
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008221466.1|  PREDICTED: histone-lysine N-methyltransferas...    319   2e-102   Prunus mume [ume]
ref|XP_007222801.1|  hypothetical protein PRUPE_ppa005021mg             319   3e-102   Prunus persica
ref|XP_004228642.1|  PREDICTED: histone-lysine N-methyltransferas...    311   1e-99    Solanum lycopersicum
ref|XP_011463173.1|  PREDICTED: histone-lysine N-methyltransferas...    307   8e-99    Fragaria vesca subsp. vesca
gb|KJB50383.1|  hypothetical protein B456_008G168000                    302   1e-98    Gossypium raimondii
ref|XP_009351546.1|  PREDICTED: histone-lysine N-methyltransferas...    307   8e-98    Pyrus x bretschneideri [bai li]
ref|XP_004297442.1|  PREDICTED: histone-lysine N-methyltransferas...    306   2e-97    Fragaria vesca subsp. vesca
gb|KJB50381.1|  hypothetical protein B456_008G168000                    301   6e-97    Gossypium raimondii
ref|XP_008381743.1|  PREDICTED: histone-lysine N-methyltransferas...    304   1e-96    Malus domestica [apple tree]
ref|XP_007045259.1|  Rubisco methyltransferase family protein iso...    303   3e-96    
gb|KJB50382.1|  hypothetical protein B456_008G168000                    301   3e-95    Gossypium raimondii
gb|KHG01954.1|  Histone-lysine N-methyltransferase setd3                300   3e-95    Gossypium arboreum [tree cotton]
ref|XP_009768042.1|  PREDICTED: histone-lysine N-methyltransferas...    300   4e-95    Nicotiana sylvestris
ref|XP_002281246.1|  PREDICTED: histone-lysine N-methyltransferas...    300   5e-95    Vitis vinifera
ref|XP_007045258.1|  Rubisco methyltransferase family protein iso...    304   6e-95    
gb|KHG01953.1|  Histone-lysine N-methyltransferase setd3                300   7e-95    Gossypium arboreum [tree cotton]
ref|XP_007045257.1|  Rubisco methyltransferase family protein iso...    303   1e-94    
ref|XP_002525993.1|  conserved hypothetical protein                     298   4e-94    
ref|XP_009611032.1|  PREDICTED: histone-lysine N-methyltransferas...    298   4e-94    Nicotiana tomentosiformis
ref|XP_008389174.1|  PREDICTED: histone-lysine N-methyltransferas...    296   2e-93    
ref|XP_010499150.1|  PREDICTED: histone-lysine N-methyltransferas...    294   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_002312458.2|  hypothetical protein POPTR_0008s13380g             294   1e-92    
emb|CDY27576.1|  BnaA09g28310D                                          286   1e-92    Brassica napus [oilseed rape]
ref|XP_010107630.1|  Histone-lysine N-methyltransferase setd3           293   2e-92    
ref|XP_011024040.1|  PREDICTED: histone-lysine N-methyltransferas...    293   4e-92    Populus euphratica
ref|XP_010477988.1|  PREDICTED: histone-lysine N-methyltransferas...    292   7e-92    Camelina sativa [gold-of-pleasure]
ref|XP_002890701.1|  hypothetical protein ARALYDRAFT_472886             291   7e-92    
ref|XP_010271179.1|  PREDICTED: histone-lysine N-methyltransferas...    292   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_010460423.1|  PREDICTED: histone-lysine N-methyltransferas...    290   4e-91    Camelina sativa [gold-of-pleasure]
ref|XP_006580887.1|  PREDICTED: histone-lysine N-methyltransferas...    288   7e-91    
ref|XP_006307219.1|  hypothetical protein CARUB_v10008819mg             290   1e-90    
ref|XP_007160424.1|  hypothetical protein PHAVU_002G320700g             288   2e-90    Phaseolus vulgaris [French bean]
emb|CDY27575.1|  BnaA09g28320D                                          288   2e-90    Brassica napus [oilseed rape]
ref|XP_009113825.1|  PREDICTED: histone-lysine N-methyltransferas...    288   3e-90    Brassica rapa
gb|KHN21605.1|  Histone-lysine N-methyltransferase setd3                286   3e-90    Glycine soja [wild soybean]
emb|CDP16308.1|  unnamed protein product                                286   1e-89    Coffea canephora [robusta coffee]
emb|CDX84966.1|  BnaC05g20890D                                          285   5e-89    
ref|XP_006367610.1|  PREDICTED: histone-lysine N-methyltransferas...    283   1e-88    Solanum tuberosum [potatoes]
ref|XP_003630935.1|  SET domain-containing protein                      281   8e-88    Medicago truncatula
ref|XP_009113827.1|  PREDICTED: histone-lysine N-methyltransferas...    281   1e-87    Brassica rapa
gb|KDO60744.1|  hypothetical protein CISIN_1g0129692mg                  272   1e-87    Citrus sinensis [apfelsine]
ref|XP_004503402.1|  PREDICTED: histone-lysine N-methyltransferas...    281   2e-87    
gb|AAK68776.1|  Unknown protein                                         276   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006448172.1|  hypothetical protein CICLE_v10015103mg             275   1e-86    
gb|KDP38111.1|  hypothetical protein JCGZ_04754                         277   5e-86    Jatropha curcas
ref|NP_564222.1|  rubisco methyltransferase-like protein                276   7e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65946.1|  unknown                                                 276   7e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44512.1|  hypothetical protein AALP_AA1G266300                    275   2e-85    Arabis alpina [alpine rockcress]
ref|XP_006448170.1|  hypothetical protein CICLE_v10015103mg             274   6e-85    Citrus clementina [clementine]
gb|EYU30121.1|  hypothetical protein MIMGU_mgv1a005562mg                272   3e-84    Erythranthe guttata [common monkey flower]
ref|XP_011070578.1|  PREDICTED: histone-lysine N-methyltransferas...    272   4e-84    Sesamum indicum [beniseed]
ref|XP_006469244.1|  PREDICTED: histone-lysine N-methyltransferas...    271   6e-84    Citrus sinensis [apfelsine]
ref|XP_003530864.1|  PREDICTED: histone-lysine N-methyltransferas...    270   2e-83    Glycine max [soybeans]
gb|KHN16537.1|  Histone-lysine N-methyltransferase setd3                270   2e-83    Glycine soja [wild soybean]
ref|XP_006415823.1|  hypothetical protein EUTSA_v10007532mg             268   9e-83    Eutrema salsugineum [saltwater cress]
gb|KCW85968.1|  hypothetical protein EUGRSUZ_B02671                     258   9e-80    Eucalyptus grandis [rose gum]
ref|XP_010556222.1|  PREDICTED: histone-lysine N-methyltransferas...    259   2e-79    Tarenaya hassleriana [spider flower]
ref|XP_004150615.1|  PREDICTED: histone-lysine N-methyltransferas...    259   6e-79    Cucumis sativus [cucumbers]
gb|KCW85966.1|  hypothetical protein EUGRSUZ_B02669                     252   1e-78    Eucalyptus grandis [rose gum]
ref|XP_008467099.1|  PREDICTED: histone-lysine N-methyltransferas...    256   1e-78    Cucumis melo [Oriental melon]
ref|XP_010043959.1|  PREDICTED: histone-lysine N-methyltransferas...    257   2e-78    Eucalyptus grandis [rose gum]
ref|XP_008467097.1|  PREDICTED: histone-lysine N-methyltransferas...    256   7e-78    Cucumis melo [Oriental melon]
ref|XP_008467098.1|  PREDICTED: histone-lysine N-methyltransferas...    256   7e-78    Cucumis melo [Oriental melon]
ref|XP_010046478.1|  PREDICTED: uncharacterized protein LOC104435421    251   7e-77    
ref|XP_010906939.1|  PREDICTED: histone-lysine N-methyltransferas...    251   7e-76    Elaeis guineensis
ref|XP_008809406.1|  PREDICTED: histone-lysine N-methyltransferas...    251   8e-76    Phoenix dactylifera
ref|XP_006647850.1|  PREDICTED: histone-lysine N-methyltransferas...    240   1e-71    Oryza brachyantha
gb|EEC73951.1|  hypothetical protein OsI_08832                          239   3e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001048036.1|  Os02g0733800                                       238   6e-71    
ref|XP_010681928.1|  PREDICTED: histone-lysine N-methyltransferas...    238   6e-71    Beta vulgaris subsp. vulgaris [field beet]
gb|ACF87938.1|  unknown                                                 227   3e-68    Zea mays [maize]
ref|XP_002454330.1|  hypothetical protein SORBIDRAFT_04g028760          229   1e-67    Sorghum bicolor [broomcorn]
ref|XP_004953834.1|  PREDICTED: histone-lysine N-methyltransferas...    228   3e-67    Setaria italica
emb|CDY66565.1|  BnaAnng22450D                                          224   7e-67    Brassica napus [oilseed rape]
ref|NP_001151430.1|  SET domain containing protein                      227   1e-66    Zea mays [maize]
ref|XP_003570495.1|  PREDICTED: histone-lysine N-methyltransferas...    226   1e-66    Brachypodium distachyon [annual false brome]
dbj|BAK03360.1|  predicted protein                                      224   1e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12546.1|  hypothetical protein F775_52053                         221   3e-64    
ref|XP_006828432.1|  hypothetical protein AMTR_s00060p00101960          211   2e-60    
gb|ADE75732.1|  unknown                                                 205   5e-60    Picea sitchensis
ref|XP_009113823.1|  PREDICTED: histone-lysine N-methyltransferas...    207   2e-59    Brassica rapa
ref|XP_009420293.1|  PREDICTED: histone-lysine N-methyltransferas...    204   4e-58    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS70598.1|  hypothetical protein M569_04159                         167   1e-44    Genlisea aurea
dbj|BAD26590.1|  SET-domain transcriptional regulator                   154   1e-42    Citrullus lanatus [wild melon]
ref|XP_002964620.1|  hypothetical protein SELMODRAFT_81798              159   2e-41    
ref|XP_002989522.1|  hypothetical protein SELMODRAFT_129980             158   4e-41    
gb|EMS47111.1|  hypothetical protein TRIUR3_10865                       154   5e-41    Triticum urartu
ref|XP_001759585.1|  predicted protein                                  152   1e-39    
gb|EEE57758.1|  hypothetical protein OsJ_08284                          153   3e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008221467.1|  PREDICTED: histone-lysine N-methyltransferas...    142   1e-35    
gb|ACN35906.1|  unknown                                                 130   3e-33    Zea mays [maize]
ref|XP_006448171.1|  hypothetical protein CICLE_v10015103mg             125   1e-29    
ref|XP_001703025.1|  predicted protein                                  115   1e-25    Chlamydomonas reinhardtii
ref|XP_002955706.1|  hypothetical protein VOLCADRAFT_106928             113   7e-25    Volvox carteri f. nagariensis
ref|XP_005644202.1|  SET domain-containing protein                      111   4e-24    Coccomyxa subellipsoidea C-169
ref|XP_001421544.1|  predicted protein                                  109   2e-23    Ostreococcus lucimarinus CCE9901
ref|XP_002506068.1|  set domain protein                               93.6    4e-18    Micromonas commoda
ref|XP_003083454.1|  N-methyltransferase (ISS)                        88.6    2e-16    
emb|CEG00242.1|  Rubisco LS methyltransferase, substrate-binding ...  88.6    3e-16    Ostreococcus tauri
ref|XP_004513627.1|  PREDICTED: uncharacterized protein LOC101503917  83.2    2e-15    
ref|XP_005843772.1|  hypothetical protein CHLNCDRAFT_139898           77.8    8e-13    Chlorella variabilis
ref|XP_011399030.1|  Histone-lysine N-methyltransferase setd3         70.9    1e-10    Auxenochlorella protothecoides
emb|CBJ32910.1|  conserved unknown protein                            64.3    8e-09    Ectocarpus siliculosus
emb|CBJ25550.1|  set domain protein                                   65.9    1e-08    Ectocarpus siliculosus
ref|XP_001417016.1|  predicted protein                                57.0    6e-06    Ostreococcus lucimarinus CCE9901
ref|XP_003062743.1|  predicted protein                                55.5    3e-05    Micromonas pusilla CCMP1545
ref|XP_005716618.1|  unnamed protein product                          53.1    1e-04    Chondrus crispus [carageen]



>ref|XP_008221466.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
 ref|XP_008245922.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
Length=481

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 177/204 (87%), Gaps = 2/204 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
            C+ LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFS PSPWQ
Sbjct  280  CLVLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVSSPNFSVPSPWQ  339

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            +EIL QL LDGE P LKV +GG ELVEGRL+AALR  L++DME+V+   +D LKS+SVE 
Sbjct  340  KEILCQLKLDGEAPLLKVCLGGSELVEGRLLAALRVVLASDMETVQKLDLDKLKSISVE-  398

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
              PLG ANE+AA RTV ALCVIALGHFPTKIMEDE+LL++ VS +T LAI+FRI+KKSVI
Sbjct  399  -APLGIANELAAFRTVIALCVIALGHFPTKIMEDESLLQKGVSDSTQLAIQFRIEKKSVI  457

Query  267  IDVMRDLTRRVKLLLSKESATAQS  196
            IDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  458  IDVMRDLTRRVKLLASKETATAQG  481



>ref|XP_007222801.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
 gb|EMJ24000.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
Length=481

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 178/204 (87%), Gaps = 2/204 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
            C+ LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFS+PSPWQ
Sbjct  280  CLVLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVSSPNFSAPSPWQ  339

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            +EIL QL LDGE P LKV +GG ELVEGRL+AALR  L++DME+V+   +D LKS+SVE 
Sbjct  340  KEILCQLKLDGEAPLLKVCLGGSELVEGRLLAALRVVLASDMETVQKLDLDKLKSISVE-  398

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
              P+G ANE+AA RT+ ALCVIALGHFPTKIMEDE+LL++ VS +T LAI+FRI+KKSVI
Sbjct  399  -APIGIANELAAFRTIIALCVIALGHFPTKIMEDESLLQKGVSDSTQLAIQFRIEKKSVI  457

Query  267  IDVMRDLTRRVKLLLSKESATAQS  196
            IDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  458  IDVMRDLTRRVKLLASKETATAQG  481



>ref|XP_004228642.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Solanum 
lycopersicum]
Length=471

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL++DLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAG  SPNFSSPSPWQ+
Sbjct  278  LLLNYGCLSSDLFLLDYGFVIPSNPYDCIELKYDAALLDAASMAAGFTSPNFSSPSPWQQ  337

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +ILS LNLDG N DLKVT+GG ELVEGRL+AALR  LSND E+V+ H ++TLKSL+VE  
Sbjct  338  QILSHLNLDGPNSDLKVTLGGGELVEGRLLAALRVVLSNDEEAVKQHDLETLKSLTVE--  395

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG + EV+ALRTV ALCVIALGHFPTKIMED++LLKQNVS TT+LA++FRIQKKS+I+
Sbjct  396  APLGISTEVSALRTVVALCVIALGHFPTKIMEDKSLLKQNVSPTTELALQFRIQKKSLIV  455

Query  264  DVMRDLTRRVKLLLSK  217
            DVMRDL++RVKLLL+K
Sbjct  456  DVMRDLSKRVKLLLAK  471



>ref|XP_011463173.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=387

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 177/204 (87%), Gaps = 2/204 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
            C+ LNYG L+NDLFLLDYGFVVPSNPYDCIEL+YD A LDAASMAAG  SP+FS+P+PWQ
Sbjct  186  CLELNYGGLSNDLFLLDYGFVVPSNPYDCIELKYDGAFLDAASMAAGESSPSFSAPAPWQ  245

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            +EIL QL LDGE P LKV +GG E+VEGRL+AALR  L++D+E+V+ H ++TLKS+SVE 
Sbjct  246  KEILCQLKLDGEAPLLKVCLGGSEVVEGRLLAALRVVLASDVETVQKHDLNTLKSISVE-  304

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
              PLG ANEVAA RTV ALCVIALGHFPTK+MEDE++L++ VS +T+LAI+FRI KKSVI
Sbjct  305  -APLGIANEVAAFRTVIALCVIALGHFPTKLMEDESILQKGVSDSTELAIQFRILKKSVI  363

Query  267  IDVMRDLTRRVKLLLSKESATAQS  196
            IDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  364  IDVMRDLTRRVKLLSSKETATAQG  387



>gb|KJB50383.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=269

 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+
Sbjct  71   LLLNYGCLSNDFFLLDYGFVIPSNPYDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQ  130

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL QLNLDGE P+LKVTIGGPELVEGRL+AALR  LSND E V+ + +  LKSLS E  
Sbjct  131  EILFQLNLDGEVPNLKVTIGGPELVEGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--  188

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAA RT+ ALCVIALGHFPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVII
Sbjct  189  GPLGVANEVAAFRTIIALCVIALGHFPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVII  248

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLT+RVKLLLSKE+ TA
Sbjct  249  DVMRDLTKRVKLLLSKETTTA  269



>ref|XP_009351546.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
Length=484

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFS+PSPWQ+
Sbjct  284  LVLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVSSPNFSAPSPWQK  343

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL  L LDGE P LKV +GG ELVEGRL+AALR  L++D+E+V+   ++ LKS+S E  
Sbjct  344  EILCLLKLDGEAPLLKVCLGGSELVEGRLLAALRVVLADDIETVQKQDLNKLKSISAE--  401

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+AA RTV ALCVIALGHFPTKIMEDE+LL + VS +T LAI+FRIQKKSVII
Sbjct  402  APLGIANELAAFRTVIALCVIALGHFPTKIMEDESLLSRGVSDSTQLAIQFRIQKKSVII  461

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDLTRRVKLL SKE+ T+Q 
Sbjct  462  DVMRDLTRRVKLLASKETTTSQG  484



>ref|XP_004297442.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=482

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 177/204 (87%), Gaps = 2/204 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
            C+ LNYG L+NDLFLLDYGFVVPSNPYDCIEL+YD A LDAASMAAG  SP+FS+P+PWQ
Sbjct  281  CLELNYGGLSNDLFLLDYGFVVPSNPYDCIELKYDGAFLDAASMAAGESSPSFSAPAPWQ  340

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            +EIL QL LDGE P LKV +GG E+VEGRL+AALR  L++D+E+V+ H ++TLKS+SVE 
Sbjct  341  KEILCQLKLDGEAPLLKVCLGGSEVVEGRLLAALRVVLASDVETVQKHDLNTLKSISVE-  399

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
              PLG ANEVAA RTV ALCVIALGHFPTK+MEDE++L++ VS +T+LAI+FRI KKSVI
Sbjct  400  -APLGIANEVAAFRTVIALCVIALGHFPTKLMEDESILQKGVSDSTELAIQFRILKKSVI  458

Query  267  IDVMRDLTRRVKLLLSKESATAQS  196
            IDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  459  IDVMRDLTRRVKLLSSKETATAQG  482



>gb|KJB50381.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=362

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+
Sbjct  164  LLLNYGCLSNDFFLLDYGFVIPSNPYDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQ  223

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL QLNLDGE P+LKVTIGGPELVEGRL+AALR  LSND E V+ + +  LKSLS E  
Sbjct  224  EILFQLNLDGEVPNLKVTIGGPELVEGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--  281

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAA RT+ ALCVIALGHFPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVII
Sbjct  282  GPLGVANEVAAFRTIIALCVIALGHFPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVII  341

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLT+RVKLLLSKE+ TA
Sbjct  342  DVMRDLTKRVKLLLSKETTTA  362



>ref|XP_008381743.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=483

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCLNNDLFLLDYGFV+PSNPYD IEL+YD ALLDAASMAAGV SPNF++PSPWQ+
Sbjct  283  LALNYGCLNNDLFLLDYGFVIPSNPYDSIELKYDGALLDAASMAAGVSSPNFNAPSPWQK  342

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL QL LDGE P LKV +GG ELVEGRL+AALR  L++D+E+V+   ++ LKS+S E  
Sbjct  343  EILCQLKLDGEAPLLKVCLGGSELVEGRLLAALRVVLADDIETVQKQDLNKLKSMSAE--  400

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIALGHFPTKIMEDE+LL + VS +T+LAI+FRIQKKS II
Sbjct  401  APLGIANELAVFRTVIALCVIALGHFPTKIMEDESLLSKGVSDSTELAIQFRIQKKSAII  460

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMR+LTRRVKLL SKE+ATAQ 
Sbjct  461  DVMRNLTRRVKLLASKETATAQG  483



>ref|XP_007045259.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY01091.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=473

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 172/201 (86%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L+YGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFS+P+PWQR
Sbjct  275  LLLHYGCLSNDFFLLDYGFVMPSNPYDYIELKYDGALMDAASMAAGVSSPNFSAPAPWQR  334

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQL LDGE  +LKV IGGPELVEGRL++ALR  LSNDME V+ + ++ LKSLS E  
Sbjct  335  QVLSQLKLDGEASNLKVIIGGPELVEGRLLSALRVILSNDMELVQRYDLNVLKSLSAE--  392

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVA  RT+ ALCVIALGHFPTKIM+DE+ +KQ V  +T+LAI+FRIQKKSVII
Sbjct  393  APLGFANEVAVFRTIIALCVIALGHFPTKIMDDESQMKQGVPVSTELAIQFRIQKKSVII  452

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLT+RVKLL SKE+ TA
Sbjct  453  DVMRDLTKRVKLLSSKETTTA  473



>gb|KJB50382.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=475

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+
Sbjct  277  LLLNYGCLSNDFFLLDYGFVIPSNPYDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQ  336

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL QLNLDGE P+LKVTIGGPELVEGRL+AALR  LSND E V+ + +  LKSLS E  
Sbjct  337  EILFQLNLDGEVPNLKVTIGGPELVEGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--  394

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAA RT+ ALCVIALGHFPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVII
Sbjct  395  GPLGVANEVAAFRTIIALCVIALGHFPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVII  454

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLT+RVKLLLSKE+ TA
Sbjct  455  DVMRDLTKRVKLLLSKETTTA  475



>gb|KHG01954.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=476

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = -1

Query  846  RKGDCCRTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAG  667
            + G   R       + LNYGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAG
Sbjct  264  KAGSSEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSNPYDHIELKYDGALMDAASMAAG  323

Query  666  VESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRN  487
            V SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPELVEGRL+AALR  LSND E V+ 
Sbjct  324  VSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPELVEGRLLAALRVLLSNDREMVQR  383

Query  486  HSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTD  307
            + +  LKSLS E   PLG ANEVAA RT+ ALCVIALGHFPTKIM+DE+LLKQ VS +T+
Sbjct  384  YDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALGHFPTKIMDDESLLKQGVSVSTE  441

Query  306  LAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  202
            LAI+FR+QKKSVIIDVMRDLT+RVK+LLSKE+ TA
Sbjct  442  LAIQFRMQKKSVIIDVMRDLTKRVKVLLSKETTTA  476



>ref|XP_009768042.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
sylvestris]
Length=476

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 178/197 (90%), Gaps = 2/197 (1%)
 Frame = -1

Query  798  LNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREI  619
            LNYGCL+NDLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SP FSSPSPWQ++I
Sbjct  281  LNYGCLSNDLFLLDYGFVIPSNPYDCIELKYDAALLDAASMAAGVSSPKFSSPSPWQQQI  340

Query  618  LSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPP  439
            LS LNLDG+N DLKVT+GG ELVEGRL+AALR  LSND E+V+ H ++ LKSL+VE   P
Sbjct  341  LSHLNLDGQNSDLKVTLGGRELVEGRLLAALRVVLSNDEETVQQHDLEALKSLTVE--VP  398

Query  438  LGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDV  259
            LGT+ EVAALRT+ ALCVIALGHFPTKIMEDE+LLKQNVS TT+LA++FRIQKKS I+DV
Sbjct  399  LGTSTEVAALRTIVALCVIALGHFPTKIMEDESLLKQNVSPTTELALQFRIQKKSFIVDV  458

Query  258  MRDLTRRVKLLLSKESA  208
            MRDL++RVKLLL+KESA
Sbjct  459  MRDLSKRVKLLLAKESA  475



>ref|XP_002281246.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Vitis vinifera]
 emb|CBI26837.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCLNND FLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFSSP+PWQ+
Sbjct  283  LVLNYGCLNNDFFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVMSPNFSSPAPWQQ  342

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +ILSQLNLDGE P LKV +GG ELVEGRL+AALR  L++D+E+V+ H ++TLKSL+ E  
Sbjct  343  QILSQLNLDGEAPVLKVNLGGSELVEGRLLAALRVLLASDLETVQKHDLNTLKSLAAE--  400

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG +NEVAALRTV ALCVIALGHFPTKIMEDEALLKQ VS + +LAI+FRIQKKSVII
Sbjct  401  APLGISNEVAALRTVIALCVIALGHFPTKIMEDEALLKQGVSGSAELAIQFRIQKKSVII  460

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMR LT RVKLL SKE  +AQ 
Sbjct  461  DVMRGLTSRVKLLSSKEKISAQG  483



>ref|XP_007045258.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY01090.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=609

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 172/201 (86%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L+YGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFS+P+PWQR
Sbjct  411  LLLHYGCLSNDFFLLDYGFVMPSNPYDYIELKYDGALMDAASMAAGVSSPNFSAPAPWQR  470

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQL LDGE  +LKV IGGPELVEGRL++ALR  LSNDME V+ + ++ LKSLS E  
Sbjct  471  QVLSQLKLDGEASNLKVIIGGPELVEGRLLSALRVILSNDMELVQRYDLNVLKSLSAE--  528

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVA  RT+ ALCVIALGHFPTKIM+DE+ +KQ V  +T+LAI+FRIQKKSVII
Sbjct  529  APLGFANEVAVFRTIIALCVIALGHFPTKIMDDESQMKQGVPVSTELAIQFRIQKKSVII  588

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLT+RVKLL SKE+ TA
Sbjct  589  DVMRDLTKRVKLLSSKETTTA  609



>gb|KHG01953.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=505

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = -1

Query  846  RKGDCCRTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAG  667
            + G   R       + LNYGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAG
Sbjct  293  KAGSSEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSNPYDHIELKYDGALMDAASMAAG  352

Query  666  VESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRN  487
            V SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPELVEGRL+AALR  LSND E V+ 
Sbjct  353  VSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPELVEGRLLAALRVLLSNDREMVQR  412

Query  486  HSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTD  307
            + +  LKSLS E   PLG ANEVAA RT+ ALCVIALGHFPTKIM+DE+LLKQ VS +T+
Sbjct  413  YDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALGHFPTKIMDDESLLKQGVSVSTE  470

Query  306  LAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  202
            LAI+FR+QKKSVIIDVMRDLT+RVK+LLSKE+ TA
Sbjct  471  LAIQFRMQKKSVIIDVMRDLTKRVKVLLSKETTTA  505



>ref|XP_007045257.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01089.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=630

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 172/201 (86%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L+YGCL+ND FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFS+P+PWQR
Sbjct  432  LLLHYGCLSNDFFLLDYGFVMPSNPYDYIELKYDGALMDAASMAAGVSSPNFSAPAPWQR  491

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQL LDGE  +LKV IGGPELVEGRL++ALR  LSNDME V+ + ++ LKSLS E  
Sbjct  492  QVLSQLKLDGEASNLKVIIGGPELVEGRLLSALRVILSNDMELVQRYDLNVLKSLSAE--  549

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVA  RT+ ALCVIALGHFPTKIM+DE+ +KQ V  +T+LAI+FRIQKKSVII
Sbjct  550  APLGFANEVAVFRTIIALCVIALGHFPTKIMDDESQMKQGVPVSTELAIQFRIQKKSVII  609

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLT+RVKLL SKE+ TA
Sbjct  610  DVMRDLTKRVKLLSSKETTTA  630



>ref|XP_002525993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36417.1| conserved hypothetical protein [Ricinus communis]
Length=473

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 180/210 (86%), Gaps = 4/210 (2%)
 Frame = -1

Query  819  PTERC--IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFS  646
            P E+   + +NYGCLNND+FLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFS
Sbjct  266  PIEQADSLLINYGCLNNDIFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVSSPNFS  325

Query  645  SPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLK  466
            SP+ WQ++ILSQLNLDG+ P LKVTIGG EL+EGRL+AALR  L+NDME V+ H +D LK
Sbjct  326  SPARWQQKILSQLNLDGDAPILKVTIGGQELIEGRLLAALRVLLANDMEIVQKHDLDALK  385

Query  465  SLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRI  286
            SLSV    PLG ANEV A RTV ALCVIALGHFPTKIM+DE+LLK +VSA+T+LAI+FRI
Sbjct  386  SLSV--IAPLGIANEVDAFRTVIALCVIALGHFPTKIMDDESLLKPDVSASTELAIQFRI  443

Query  285  QKKSVIIDVMRDLTRRVKLLLSKESATAQS  196
            QKKSVIIDVMRDLTRRVK LLSK+ +T Q 
Sbjct  444  QKKSVIIDVMRDLTRRVKSLLSKDMSTTQG  473



>ref|XP_009611032.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
tomentosiformis]
Length=476

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = -1

Query  828  RTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNF  649
            R       + LNYGCL++DLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SP F
Sbjct  271  RQIKQNDSLLLNYGCLSSDLFLLDYGFVIPSNPYDCIELKYDAALLDAASMAAGVSSPKF  330

Query  648  SSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTL  469
            SSPSPWQ++ILS LNLDG+N DLKVT+GG ELVEGRL+AALR  LS+D E+V+ H ++TL
Sbjct  331  SSPSPWQQQILSHLNLDGQNSDLKVTLGGRELVEGRLLAALRVVLSDDEEAVQQHDLETL  390

Query  468  KSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFR  289
            KSL+VE   PLG + EVAALRT+ ALCVIALGHFPTKIMEDE+LLKQNVS TT+LA++FR
Sbjct  391  KSLTVE--APLGISTEVAALRTIVALCVIALGHFPTKIMEDESLLKQNVSPTTELALQFR  448

Query  288  IQKKSVIIDVMRDLTRRVKLLLSKESA  208
            IQKKS+I+DVMRDL++RVKLLL+KESA
Sbjct  449  IQKKSLIVDVMRDLSKRVKLLLAKESA  475



>ref|XP_008389174.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=478

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFS+PSPWQ+
Sbjct  278  LVLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVSSPNFSAPSPWQK  337

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL QL LDGE   LKV +GG ELVE RL+AALR  L++D E+V+ H ++ LKS+S E  
Sbjct  338  EILCQLKLDGEALLLKVCLGGSELVEXRLLAALRVVLADDKETVQKHDLNKLKSISAE--  395

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+AA RTV ALCVIALGHFPTKIMEDE+LL + VS +T LAI+FRI KKSVII
Sbjct  396  APLGIANELAAFRTVIALCVIALGHFPTKIMEDESLLSKGVSDSTQLAIQFRIXKKSVII  455

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDLT+RVK L SKE+   + 
Sbjct  456  DVMRDLTKRVKFLASKETVATKG  478



>ref|XP_010499150.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Camelina sativa]
 ref|XP_010499151.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 168/201 (84%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+N+ FLLDYGFV+ SNPY+ IEL+YD  L+DAASMAAGV SP FSSP+PWQR
Sbjct  280  LLLNYGCLSNEFFLLDYGFVIESNPYETIELKYDEQLMDAASMAAGVSSPKFSSPAPWQR  339

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AA+R  L  D+  V  H +DTLKSLS    
Sbjct  340  QLLSQLNLAGEIPNLKVTIGGPEPVEGRLLAAIRILLCGDLVEVEKHDLDTLKSLS--ST  397

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A LRTV ALCVIAL HFPTKIMEDEA++KQ VSAT +L++++RIQKKSVII
Sbjct  398  APLGIANEMAVLRTVIALCVIALSHFPTKIMEDEAIIKQGVSATAELSVKYRIQKKSVII  457

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMRDLTRRVKLL SKE+ +A
Sbjct  458  DVMRDLTRRVKLLSSKETPSA  478



>ref|XP_002312458.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
 gb|EEE89825.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
Length=479

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            I LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD A LDAAS+AAGV SP FSSP+PWQ+
Sbjct  279  ILLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGAFLDAASVAAGVSSPKFSSPAPWQQ  338

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            + LSQLNLDGE  +LKVT+GG ELV+GRL+AALR  L++DME VR H MDTLKSLS +  
Sbjct  339  QFLSQLNLDGEAANLKVTLGGQELVDGRLLAALRVLLASDMEMVRKHDMDTLKSLSAD--  396

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAA RT+ ALCVIAL HFPTKIMEDE+ L+Q VSA+T+LAI+FRIQKKSVII
Sbjct  397  APLGIANEVAAYRTIIALCVIALEHFPTKIMEDESSLRQGVSASTELAIQFRIQKKSVII  456

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDLTRR K LLSK++   Q 
Sbjct  457  DVMRDLTRRAKSLLSKDTTACQG  479



>emb|CDY27576.1| BnaA09g28310D [Brassica napus]
Length=238

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFVV SNP+D IEL+YD  LLDAASMAAGV SP FSSP+PWQ 
Sbjct  39   LLLNYGCLSNDFFLLDYGFVVESNPFDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQH  98

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+  DLKVTIGG E VEGRL+AA+R  LS ++  V  H ++TLKSLS    
Sbjct  99   QLLSQLNLAGKLQDLKVTIGGQETVEGRLLAAIRILLSGELVEVEKHDLETLKSLS--ST  156

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIAL HFPTKIMEDEA+LKQ VS T +L+I++RIQKK +II
Sbjct  157  APLGVANEIATFRTVIALCVIALSHFPTKIMEDEAILKQGVSDTAELSIKYRIQKKPMII  216

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL ++E+ +A
Sbjct  217  DVMKDLTRRVKLLSAQETPSA  237



>ref|XP_010107630.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
 gb|EXC16432.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
Length=469

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCLNNDLFLLDYGFV+PSNPYDCIELRYD ALLDAASMAAGV SP+FSSPSPWQ+
Sbjct  269  LALNYGCLNNDLFLLDYGFVIPSNPYDCIELRYDGALLDAASMAAGVSSPSFSSPSPWQQ  328

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             IL QL LDGE P+LKVT+GGPELV+GRL+AALR  ++N++++V  H ++TLKSLS E  
Sbjct  329  LILKQLGLDGEAPNLKVTLGGPELVDGRLLAALRVLVANNLQAVEKHDLETLKSLSAE--  386

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG  NE+AA RTV ALCVIALGHFPTKIMEDE+LLK+ VS + +LA+ FRIQKKS+II
Sbjct  387  APLGVTNEIAAFRTVIALCVIALGHFPTKIMEDESLLKEGVSGSLELAVTFRIQKKSLII  446

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            DV++DLTRRVKLL SKE+ TAQ
Sbjct  447  DVIKDLTRRVKLLSSKETVTAQ  468



>ref|XP_011024040.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Populus 
euphratica]
Length=479

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            I LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD A LDAAS+AAGV SP FSSP+PWQ+
Sbjct  279  ILLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGAFLDAASVAAGVSSPKFSSPAPWQQ  338

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            + LSQLNLDGE  +LKVT+GG ELV+GRL+AALR  L++DME VR H MDTLKSLS +  
Sbjct  339  QFLSQLNLDGEAANLKVTLGGQELVDGRLLAALRVLLASDMEMVRKHDMDTLKSLSAD--  396

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAA RTV ALCVIAL HFPTKIMEDE+ L+Q VSA+T+LAI+FRIQKKSVII
Sbjct  397  APLGIANEVAAYRTVIALCVIALEHFPTKIMEDESSLRQGVSASTELAIQFRIQKKSVII  456

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            DVMR+LTRR K LLSK++   Q
Sbjct  457  DVMRNLTRRAKSLLSKDTTACQ  478



>ref|XP_010477988.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477989.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477990.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
Length=479

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 166/201 (83%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQR
Sbjct  280  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQR  339

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AA+R  L  D+  V  H +DTLKSLS    
Sbjct  340  QLLSQLNLAGEIPNLKVTIGGPEPVEGRLLAAIRILLCGDLVEVEKHDLDTLKSLS--ST  397

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A LRTV ALCVIAL HFPTKIMEDEA+++Q VSAT +L+I++RIQKKSVII
Sbjct  398  APLGIANEMAVLRTVIALCVIALSHFPTKIMEDEAIIEQGVSATAELSIKYRIQKKSVII  457

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVK L SKE+  A
Sbjct  458  DVMKDLTRRVKALSSKETPNA  478



>ref|XP_002890701.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66960.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   291 bits (746),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQ 
Sbjct  272  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQH  331

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AA+R  L  +M  V  H +DTLKSLS    
Sbjct  332  QLLSQLNLAGEMPNLKVTIGGPEPVEGRLLAAIRILLCGEMVEVEKHDLDTLKSLSA--I  389

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIAL HFPTKIMEDEA++K+ V AT +L+I++RIQKKSVII
Sbjct  390  APLGIANEIAVFRTVIALCVIALSHFPTKIMEDEAIIKKGVPATAELSIKYRIQKKSVII  449

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL SKE+ TA
Sbjct  450  DVMKDLTRRVKLLSSKETPTA  470



>ref|XP_010271179.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=494

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 176/203 (87%), Gaps = 3/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            I L+YGCLNNDLFLLDYGFV+ SNPYDCIELRYD ALLDAASMAAGV SPNFSSP+ WQ+
Sbjct  295  ILLDYGCLNNDLFLLDYGFVILSNPYDCIELRYDGALLDAASMAAGVSSPNFSSPTQWQQ  354

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +IL+QLNL GE+  LKV++GG ELVEGRL+AALR  L+NDME+V+ H + TLKSL+ E  
Sbjct  355  QILAQLNLQGEDALLKVSLGGTELVEGRLLAALRVLLANDMETVQKHDLSTLKSLTAE--  412

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG +NEVAALRTV ALCVIALGHFPTKIMEDE+LLK   S  T+LAI+FR+QKKSVII
Sbjct  413  APLGISNEVAALRTVIALCVIALGHFPTKIMEDESLLK-GASGPTELAIQFRVQKKSVII  471

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDLTRRVK+LLSKE+A AQ 
Sbjct  472  DVMRDLTRRVKILLSKETAIAQG  494



>ref|XP_010460423.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460424.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460425.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=479

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 167/201 (83%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQR
Sbjct  280  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQR  339

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AA+R  L  ++  V  H +DTLKSLS    
Sbjct  340  QLLSQLNLAGELPNLKVTIGGPEPVEGRLLAAIRILLCGELVEVEKHDLDTLKSLS--ST  397

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A LRTV ALCVIAL HFPTKI+EDEA++KQ VSAT +L+I++RIQKKSVII
Sbjct  398  APLGIANEMAVLRTVIALCVIALSHFPTKIIEDEAIIKQGVSATAELSIKYRIQKKSVII  457

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL S E+ +A
Sbjct  458  DVMKDLTRRVKLLSSMETPSA  478



>ref|XP_006580887.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=419

 Score =   288 bits (736),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCLNNDLFLLDYGFV+ SNPYDCIEL+YD ALLDAAS AAGV SPNFS+P+PWQ 
Sbjct  219  LLLCYGCLNNDLFLLDYGFVMHSNPYDCIELKYDGALLDAASTAAGVSSPNFSTPAPWQE  278

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE PDLKV++GG E VEGRL+AALR  LS ++E+++ + +  L+SL  E  
Sbjct  279  LILSQLNLAGETPDLKVSLGGQETVEGRLLAALRVILSTNVETMQKYDLSILQSLDAE--  336

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RT+ ALCVIALGHFPTKIM+DE+LLKQ  S +T+LAI++RIQKKSVII
Sbjct  337  APLGVANEIAVFRTLIALCVIALGHFPTKIMDDESLLKQGASGSTELAIQYRIQKKSVII  396

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVM++L+RR+KL+ SKE+ TA+ 
Sbjct  397  DVMKNLSRRLKLVSSKETTTAEG  419



>ref|XP_006307219.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 ref|XP_006307220.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40117.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40118.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
Length=532

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ +NPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQR
Sbjct  333  LLLNYGCLSNDFFLLDYGFVIEANPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQR  392

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LS+LNL GE P+LKVTIGGPE VEGRL+AA+R  L  ++  V  H +DTLKSLS    
Sbjct  393  QLLSKLNLAGEIPNLKVTIGGPEPVEGRLLAAIRILLCGELVEVEKHDLDTLKSLSF--T  450

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIAL HFPTKIMEDEA++KQ VSAT +L+I++RIQKKSVII
Sbjct  451  APLGIANEIAVFRTVIALCVIALSHFPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVII  510

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL S E+ TA
Sbjct  511  DVMKDLTRRVKLLSSMETPTA  531



>ref|XP_007160424.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
 gb|ESW32418.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
Length=465

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCLNND FLLDYGFV+ SNPYDCIEL+YD ALLDAAS AAGV SPNFS+P+PWQ+
Sbjct  265  LLLCYGCLNNDFFLLDYGFVMHSNPYDCIELKYDGALLDAASTAAGVSSPNFSAPAPWQQ  324

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE PDLKV++GG E VEGRL+AALR  LS++ME+V+ + + TL+SL VE  
Sbjct  325  LILSQLNLFGETPDLKVSLGGQETVEGRLVAALRIVLSSNMETVQKYDLSTLQSLDVE--  382

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG AN++A  RT+ ALCVIAL HFPTKIM+DE+LLKQ  S +T+LAI++RIQKK VII
Sbjct  383  APLGVANDIAVFRTLIALCVIALEHFPTKIMDDESLLKQGASGSTELAIQYRIQKKCVII  442

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVM++L+RRVKLL SKE+ATA+ 
Sbjct  443  DVMKNLSRRVKLLSSKETATAEG  465



>emb|CDY27575.1| BnaA09g28320D [Brassica napus]
Length=475

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFVV SNPYD IEL+YD  LLDAASMAAGV SP FSSP+PWQ 
Sbjct  276  LLLNYGCLSNDFFLLDYGFVVESNPYDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQH  335

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+ PDLKVTIGG E VEGRL+AA+R  LS+D+  V  H ++ LKSLS    
Sbjct  336  QLLSQLNLAGKMPDLKVTIGGQETVEGRLLAAIRILLSSDLVEVEKHDLEELKSLSF--T  393

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIAL HFPTKIMEDEA+LKQ VS T +L+I++RIQKKS+II
Sbjct  394  APLGVANEIATFRTVIALCVIALSHFPTKIMEDEAILKQGVSDTAELSIKYRIQKKSMII  453

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL ++E+ +A
Sbjct  454  DVMKDLTRRVKLLSAQETPSA  474



>ref|XP_009113825.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
 ref|XP_009113826.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
Length=474

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  LLDAASMAAGV SP FSSP+PWQ 
Sbjct  275  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQH  334

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+ PDLKVTIGG E VEGRL+AA+R  LS+D+  V  H ++ LKSLS    
Sbjct  335  QLLSQLNLAGKMPDLKVTIGGQETVEGRLLAAIRILLSSDLVEVEKHDLEVLKSLS--ST  392

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIAL HFPTKIMEDEA+LKQ VS T +L+I++RIQKKS+II
Sbjct  393  APLGVANEIATFRTVIALCVIALSHFPTKIMEDEAILKQGVSDTAELSIKYRIQKKSMII  452

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL ++E+ +A
Sbjct  453  DVMKDLTRRVKLLSAQETPSA  473



>gb|KHN21605.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=423

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCLNNDLFLLDYGFV+ SNPYDCIEL+YD ALLDAAS AAGV SPNFS+P+PWQ 
Sbjct  223  LLLCYGCLNNDLFLLDYGFVMHSNPYDCIELKYDGALLDAASTAAGVSSPNFSTPAPWQE  282

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE PDLKV++GG E VEGRL+AALR  LS ++E+++ + +  L+SL  E  
Sbjct  283  LILSQLNLAGETPDLKVSLGGQETVEGRLLAALRVILSTNVETMQKYDLSILQSLDAE--  340

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RT+ ALCVIALGHFPT+IM+DE+LLKQ  S +T+LAI++RIQKKSVII
Sbjct  341  APLGVANEIAVFRTLIALCVIALGHFPTQIMDDESLLKQGASGSTELAIQYRIQKKSVII  400

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVM++L+RR+KL+ SKE+ TA+ 
Sbjct  401  DVMKNLSRRLKLVSSKETTTAEG  423



>emb|CDP16308.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 163/188 (87%), Gaps = 2/188 (1%)
 Frame = -1

Query  768  FLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGEN  589
            FLLDYGFV+PSNPYDC+EL+YD ALLDAA MAAG+ SPNFSSP PWQ++ILSQLNL GE+
Sbjct  290  FLLDYGFVIPSNPYDCVELKYDSALLDAAGMAAGISSPNFSSPLPWQQQILSQLNLRGED  349

Query  588  PDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAAL  409
              LK+++GG ELV+GRL+AALR  LSND E+V+ H + TLKSLS E   PLG +NEVAAL
Sbjct  350  AQLKISLGGSELVDGRLLAALRVILSNDKEAVQKHDLTTLKSLSAE--APLGISNEVAAL  407

Query  408  RTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKL  229
            RT+ ALCVIALGHFPTK+MEDE+LLKQ+VSA+T LAI+FRIQKK++IID MR+LTRRVK 
Sbjct  408  RTIIALCVIALGHFPTKLMEDESLLKQSVSASTALAIQFRIQKKALIIDAMRNLTRRVKS  467

Query  228  LLSKESAT  205
            L SKES T
Sbjct  468  LSSKESVT  475



>emb|CDX84966.1| BnaC05g20890D [Brassica napus]
Length=471

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  LLDAASMAAGV SP FSSP+PWQ 
Sbjct  272  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQH  331

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+ P+LKVTIGG + VEGRL+AA+R  LS ++  V  H ++TLKSLS    
Sbjct  332  QLLSQLNLAGKMPNLKVTIGGQDTVEGRLLAAIRILLSGELVEVEKHDLETLKSLS--ST  389

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+AA RTV ALCVIAL HFPTKIMEDE +LKQ VS T +L+I++RIQKKS+II
Sbjct  390  APLGIANEIAAFRTVIALCVIALSHFPTKIMEDEGILKQGVSDTAELSIKYRIQKKSMII  449

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL ++E+ +A
Sbjct  450  DVMKDLTRRVKLLSAQETPSA  470



>ref|XP_006367610.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Solanum 
tuberosum]
Length=475

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 175/196 (89%), Gaps = 2/196 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL++DLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SP+FSSPSPWQ+
Sbjct  282  LLLNYGCLSSDLFLLDYGFVIPSNPYDCIELKYDAALLDAASMAAGVSSPSFSSPSPWQQ  341

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +ILS LNLDG N +LKVT+GG ELVEGRL+AALRA LSND E+V+ H ++TLKSL+VE  
Sbjct  342  QILSHLNLDGPNSNLKVTLGGGELVEGRLLAALRAVLSNDEEAVKQHDLETLKSLTVE--  399

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG + EV ALRTV ALCVIALGHFPTKIMEDE+LLKQNVS TT+LA++F IQKKS+I+
Sbjct  400  APLGISTEVLALRTVVALCVIALGHFPTKIMEDESLLKQNVSPTTELALQFIIQKKSLIV  459

Query  264  DVMRDLTRRVKLLLSK  217
            DVMRDL+++VK LL+K
Sbjct  460  DVMRDLSKKVKSLLAK  475



>ref|XP_003630935.1| SET domain-containing protein [Medicago truncatula]
 gb|AET05411.1| histone-lysine N-methyltransferase setd3-like protein [Medicago 
truncatula]
Length=482

 Score =   281 bits (720),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCL+NDLFLLDYGFV+ SNPYDCIEL+YD ALLDAASMAAGV SPNFS+P+PWQ 
Sbjct  282  LLLCYGCLSNDLFLLDYGFVIQSNPYDCIELKYDGALLDAASMAAGVSSPNFSTPAPWQE  341

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE PDLKV++GG E++EGRL+AALR  L++DM SV+ H ++TLKSL+ E  
Sbjct  342  LILSQLNLAGETPDLKVSLGGQEIIEGRLLAALRVLLASDMASVQKHDLNTLKSLNAE--  399

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG AN++A  RT+ ALCVIALGHFPTK+M+DE+LLKQ  S +T+LAI+FRIQKKSVII
Sbjct  400  APLGVANDLAVFRTLIALCVIALGHFPTKLMDDESLLKQGASGSTELAIQFRIQKKSVII  459

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVM++L+R+VKLL SKE+ TA+ 
Sbjct  460  DVMKNLSRKVKLLSSKETVTAEG  482



>ref|XP_009113827.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Brassica rapa]
Length=474

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFVV SNP+D IEL+YD  LLDAASMAAGV SP FSSP+PWQ 
Sbjct  275  LLLNYGCLSNDFFLLDYGFVVESNPFDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQH  334

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+  DLKVTIGG E VEGRL+AA+R  LS ++  V  H ++TLKSLS    
Sbjct  335  QLLSQLNLAGKLQDLKVTIGGQETVEGRLLAAIRILLSGELVEVEKHDLETLKSLS--ST  392

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  R V ALCVIAL HFPTKIMEDEA+LKQ VS T +L+I++RIQKKS+II
Sbjct  393  APLGVANEIATFRIVIALCVIALSHFPTKIMEDEAILKQGVSDTAELSIKYRIQKKSMII  452

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL ++E+ +A
Sbjct  453  DVMKDLTRRVKLLSAQETPSA  473



>gb|KDO60744.1| hypothetical protein CISIN_1g0129692mg, partial [Citrus sinensis]
Length=214

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+PSNPYD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ+
Sbjct  14   LLLNYGCLSNDFFLLDYGFVMPSNPYDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQ  73

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE   +KV++GGP+LVEGRL+AALR  L++D E+V+ H ++TL+SLS E  
Sbjct  74   RILSQLNLVGETAIVKVSLGGPDLVEGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--  131

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG  NEVA  RT+ ALC IAL HFPTKIMEDE+L KQ VSA+T LAI+FRIQKK++II
Sbjct  132  APLGITNEVAVFRTIIALCAIALEHFPTKIMEDESLRKQGVSASTVLAIQFRIQKKTLII  191

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            D+MR+L++RVKLL SKE+   Q
Sbjct  192  DIMRNLSKRVKLLSSKETTATQ  213



>ref|XP_004503402.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Cicer arietinum]
Length=490

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 175/203 (86%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCL+NDLFLLDYGFV+ SNPYDCIEL+YD ALLDAAS+AAGV SP FS+P+PWQ+
Sbjct  290  LLLCYGCLSNDLFLLDYGFVIHSNPYDCIELKYDGALLDAASIAAGVSSPKFSTPAPWQQ  349

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE PDLKV++GG E++EGRL+AALR  L++DME+V+ + ++TLKSL  E  
Sbjct  350  LILSQLNLAGEAPDLKVSVGGQEIIEGRLLAALRVLLTSDMETVQKYDLNTLKSLDAE--  407

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG AN++A  RT+ ALCVIALGHFPTK+M+DE+LLKQ  S +T+LAI+FRIQKKSVII
Sbjct  408  APLGVANDIAVFRTLIALCVIALGHFPTKLMDDESLLKQGASGSTELAIQFRIQKKSVII  467

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVM++L+RRVKLL SKE+ TA+S
Sbjct  468  DVMKNLSRRVKLLSSKETVTAES  490



>gb|AAK68776.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL66947.1| unknown protein [Arabidopsis thaliana]
Length=364

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQ 
Sbjct  165  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQH  224

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AALR  L  ++  V  H  DTLKSLS    
Sbjct  225  QLLSQLNLAGEMPNLKVTIGGPEPVEGRLLAALRILLCGELVEVEKHDSDTLKSLSA--V  282

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G ANE+A  RTV ALCVIAL HFPTKIMEDEA++KQ VSAT +L+I++RIQKKSVII
Sbjct  283  APFGIANEIAVFRTVIALCVIALSHFPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVII  342

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL SKE+ TA
Sbjct  343  DVMKDLTRRVKLLSSKETPTA  363



>ref|XP_006448172.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 ref|XP_006448173.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61412.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61413.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=362

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSNPYD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ+
Sbjct  162  LLLNYGCLSNDLFLLDYGFVMPSNPYDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQ  221

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +ILSQLNL GE   +KV++GGPELVEGRL+AALR  L++D E+V+ H ++TL+SLS E  
Sbjct  222  QILSQLNLVGETAIVKVSLGGPELVEGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--  279

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG  NEVA  RT+ ALC IAL HFPTKIMEDE+LL+Q VSA+T LAI+FRIQKK++II
Sbjct  280  APLGITNEVAVFRTIIALCAIALEHFPTKIMEDESLLEQGVSASTVLAIQFRIQKKTLII  339

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            D+MR+L+RRVKLL SKE+   Q
Sbjct  340  DIMRNLSRRVKLLSSKETTATQ  361



>gb|KDP38111.1| hypothetical protein JCGZ_04754 [Jatropha curcas]
Length=482

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  813  ERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSP  634
            E  + LNYGCLNNDL LLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFSS +P
Sbjct  277  EDHLLLNYGCLNNDLLLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVASPNFSSAAP  336

Query  633  WQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSV  454
            WQ++ILSQLNLD EN  LKVTIGG EL+EGRL+AALR  L+ D E+V+ H +DTLKSLS 
Sbjct  337  WQQQILSQLNLDRENSTLKVTIGGEELIEGRLLAALRVLLTTDKEAVQKHDLDTLKSLSA  396

Query  453  EPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKS  274
                PLG ANE+AA RT+ ALCVIAL HFPTKIM+DE+LLKQ VSA+T+LAI+FRIQKKS
Sbjct  397  --NAPLGIANEIAAFRTIIALCVIALEHFPTKIMDDESLLKQGVSASTELAIQFRIQKKS  454

Query  273  VIIDVMRDLTRRVKLLLSKESATAQS  196
            VIID MRDLTRRVK LLSK + TAQ+
Sbjct  455  VIIDTMRDLTRRVKSLLSKNTTTAQT  480



>ref|NP_564222.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF97974.1|AC000103_24 F21J9.27 [Arabidopsis thaliana]
 gb|AEE30553.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
Length=476

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQ 
Sbjct  277  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQH  336

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AALR  L  ++  V  H  DTLKSLS    
Sbjct  337  QLLSQLNLAGEMPNLKVTIGGPEPVEGRLLAALRILLCGELVEVEKHDSDTLKSLSA--V  394

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G ANE+A  RTV ALCVIAL HFPTKIMEDEA++KQ VSAT +L+I++RIQKKSVII
Sbjct  395  APFGIANEIAVFRTVIALCVIALSHFPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVII  454

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL SKE+ TA
Sbjct  455  DVMKDLTRRVKLLSSKETPTA  475



>gb|AAM65946.1| unknown [Arabidopsis thaliana]
Length=471

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQ 
Sbjct  272  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQH  331

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL GE P+LKVTIGGPE VEGRL+AALR  L  ++  V  H  DTLKSLS    
Sbjct  332  QLLSQLNLAGEMPNLKVTIGGPEPVEGRLLAALRILLCGELVEVEKHDSDTLKSLSA--V  389

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G ANE+A  RTV ALCVIAL HFPTKIMEDEA++KQ VSAT +L+I++RIQKKSVII
Sbjct  390  APFGIANEIAVFRTVIALCVIALSHFPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVII  449

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL SKE+ TA
Sbjct  450  DVMKDLTRRVKLLSSKETPTA  470



>gb|KFK44512.1| hypothetical protein AALP_AA1G266300 [Arabis alpina]
Length=475

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAGV SP FSSP+PWQ 
Sbjct  276  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQH  335

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            + LSQLNL GE P+LKVTIGG ELVEGRL+AALR  L  ++  V  H ++TLKSLS    
Sbjct  336  QFLSQLNLSGEMPNLKVTIGGSELVEGRLLAALRILLCGELVEVEKHDLNTLKSLSA--V  393

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE++  RTV ALCVIAL HFPTKIMEDEA++KQ VSAT +LA+++RIQKKSVII
Sbjct  394  APLGIANEISVFRTVIALCVIALSHFPTKIMEDEAIVKQGVSATAELAVQYRIQKKSVII  453

Query  264  DVMRDLTRRVKLLLSKESATA  202
            D MRDLTRR+KLL SKE+ TA
Sbjct  454  DAMRDLTRRIKLLCSKETPTA  474



>ref|XP_006448170.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61410.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=474

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSNPYD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ+
Sbjct  274  LLLNYGCLSNDLFLLDYGFVMPSNPYDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQ  333

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +ILSQLNL GE   +KV++GGPELVEGRL+AALR  L++D E+V+ H ++TL+SLS E  
Sbjct  334  QILSQLNLVGETAIVKVSLGGPELVEGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--  391

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG  NEVA  RT+ ALC IAL HFPTKIMEDE+LL+Q VSA+T LAI+FRIQKK++II
Sbjct  392  APLGITNEVAVFRTIIALCAIALEHFPTKIMEDESLLEQGVSASTVLAIQFRIQKKTLII  451

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            D+MR+L+RRVKLL SKE+   Q
Sbjct  452  DIMRNLSRRVKLLSSKETTATQ  473



>gb|EYU30121.1| hypothetical protein MIMGU_mgv1a005562mg [Erythranthe guttata]
Length=479

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 166/202 (82%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYG LNND FL+DYGFVVPSNPYDCIEL+YD  LL+AASMAAGV +PNFSSP PWQ+
Sbjct  280  LELNYGRLNNDFFLMDYGFVVPSNPYDCIELKYDSGLLEAASMAAGVSTPNFSSPLPWQQ  339

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +IL +LNL GEN DLKV IGG ELVE RL+AALR  LSND E+V  H++DTLKS++    
Sbjct  340  QILLRLNLHGENSDLKVRIGGSELVEDRLLAALRVLLSNDKEAVEKHNLDTLKSIA--SG  397

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
            PPLG +NE A  RT+ ALC+IAL HFPTKIMEDE++L++ VS+T +LA+R+RIQKKS+II
Sbjct  398  PPLGPSNEAAVFRTIIALCMIALSHFPTKIMEDESVLEKTVSSTAELAVRYRIQKKSLII  457

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            D MRD TRRVKLL  KE  +AQ
Sbjct  458  DAMRDFTRRVKLLSEKEPVSAQ  479



>ref|XP_011070578.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Sesamum 
indicum]
Length=482

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YDPALLDAASMAAGV SPNFSSPSPWQ+
Sbjct  283  LELNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDPALLDAASMAAGVSSPNFSSPSPWQQ  342

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             IL QLNLDGEN DLKV IGG ELVE RL+AALR  LSND E+V    + T+KS++ E  
Sbjct  343  RILLQLNLDGENSDLKVRIGGSELVEDRLLAALRVLLSNDREAVEKQDLATIKSINSE--  400

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLGT+NE A  RT+ ALCVIALGHFPTKIMEDE+ LK+ VS TT+LA+R+R+QKKSVII
Sbjct  401  APLGTSNEAATFRTMIALCVIALGHFPTKIMEDESTLKEKVSTTTELAVRYRVQKKSVII  460

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            D MRDL RRVKLL SKES T+Q
Sbjct  461  DAMRDLIRRVKLLSSKESITSQ  482



>ref|XP_006469244.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Citrus 
sinensis]
Length=474

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+PSNPYD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ+
Sbjct  274  LLLNYGCLSNDFFLLDYGFVMPSNPYDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQ  333

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE   +KV++GGPELVEGRL+AALR  L++D E+V+ H ++TL+SLS E  
Sbjct  334  RILSQLNLVGETAIVKVSLGGPELVEGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--  391

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG  NEVA  RT+ ALC IAL HFPTKIMEDE+LLKQ VSA+T L I+FRIQKK++II
Sbjct  392  APLGITNEVAVFRTIIALCAIALEHFPTKIMEDESLLKQGVSASTVLVIQFRIQKKTLII  451

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            D+MR+L+RRVKLL SKE+   Q
Sbjct  452  DIMRNLSRRVKLLSSKETTATQ  473



>ref|XP_003530864.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=472

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCLNNDLFLLDYGFV+ SNPYDCIEL+YD ALLDAAS AAGV SPNFS+P PWQ 
Sbjct  272  LLLCYGCLNNDLFLLDYGFVMHSNPYDCIELKYDGALLDAASTAAGVSSPNFSAPVPWQE  331

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE  DLKV++GG E VE RL+AALR  LS+++E+V+ + + TL+SL  E  
Sbjct  332  LILSQLNLAGETADLKVSLGGQETVEARLLAALRVLLSSNVETVQKYDLSTLQSLDAE--  389

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RT+ ALCVIALGHFPTKIM+DE+LLKQ  S +T+LAI++RIQKKSVII
Sbjct  390  APLGVANEIAVFRTLIALCVIALGHFPTKIMDDESLLKQGASGSTELAIQYRIQKKSVII  449

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            DVMR+++RR+KLL SKE+ATA+
Sbjct  450  DVMRNISRRLKLLSSKETATAE  471



>gb|KHN16537.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=470

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + L YGCLNNDLFLLDYGFV+ SNPYDCIEL+YD ALLDAAS AAGV SPNFS+P PWQ 
Sbjct  270  LLLCYGCLNNDLFLLDYGFVMHSNPYDCIELKYDGALLDAASTAAGVSSPNFSAPVPWQE  329

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             ILSQLNL GE  DLKV++GG E VE RL+AALR  LS+++E+V+ + + TL+SL  E  
Sbjct  330  LILSQLNLAGETADLKVSLGGQETVEARLLAALRVLLSSNVETVQKYDLSTLQSLDAE--  387

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RT+ ALCVIALGHFPTKIM+DE+LLKQ  S +T+LAI++RIQKKSVII
Sbjct  388  APLGVANEIAVFRTLIALCVIALGHFPTKIMDDESLLKQGASGSTELAIQYRIQKKSVII  447

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            DVMR+++RR+KLL SKE+ATA+
Sbjct  448  DVMRNISRRLKLLSSKETATAE  469



>ref|XP_006415823.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
 gb|ESQ34176.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
Length=474

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 166/201 (83%), Gaps = 2/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFV+ SNPYD IEL+YD  L+DAASMAAG+ SP FSS +PWQ+
Sbjct  275  LLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASMAAGISSPKFSSTAPWQQ  334

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQL+L GE P+LKVTIGGPE VEGRL+AA+R  L  ++  V  H +DTL+S+S    
Sbjct  335  QLLSQLSLAGEMPNLKVTIGGPEPVEGRLLAAIRILLCGELVEVEKHDLDTLQSISA--I  392

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALCVIAL HFPTKIMEDEA+LKQ VS T +L+I++RIQKKSVII
Sbjct  393  APLGIANEIAVFRTVIALCVIALSHFPTKIMEDEAILKQGVSDTAELSIKYRIQKKSVII  452

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM+DLTRRVKLL S+E++TA
Sbjct  453  DVMKDLTRRVKLLSSQETSTA  473



>gb|KCW85968.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=380

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALLDAAS+AAGV SPNFSSP+PWQ+
Sbjct  180  LLLNYGCLSNDLFLLDYGFVIPSNRYDTIELKYDGALLDAASLAAGVSSPNFSSPAPWQQ  239

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILSQLNL G+  DLKVT+GGP+LVEGRL+AALR  L ++ ESV+ H + TLKS+S E  
Sbjct  240  EILSQLNLYGDTADLKVTLGGPDLVEGRLLAALRVLLESENESVQKHDLSTLKSISAE--  297

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G A EVAA RT+ ALCVIAL HFPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+
Sbjct  298  APCGIATEVAAFRTIIALCVIALEHFPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIV  357

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDL+RR+K LLSKE+ +A+ 
Sbjct  358  DVMRDLSRRIKSLLSKETVSAKG  380



>ref|XP_010556222.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Tarenaya 
hassleriana]
Length=477

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL ND FLLDYGFV+ SNPYD +EL+YD AL+DAASMAAGV SPNFSSPSPWQ 
Sbjct  277  LMLNYGCLGNDFFLLDYGFVIESNPYDTVELKYDEALMDAASMAAGVSSPNFSSPSPWQS  336

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            + LS+LNL GE  +LKV IGGPELVEGRL+AALR  L  +ME+V  H ++ LKSLSVE  
Sbjct  337  QFLSRLNLAGEASNLKVAIGGPELVEGRLLAALRILLCCEMEAVEKHDINKLKSLSVE--  394

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  RTV ALC+IALGHFPTKIMEDEA+LKQ VSATT+LA R+RIQKKSVII
Sbjct  395  APLGIANELAVFRTVIALCMIALGHFPTKIMEDEAVLKQGVSATTELAARYRIQKKSVII  454

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDL+RRVK L SKE++ A S
Sbjct  455  DVMRDLSRRVKSLSSKETSQAAS  477



>ref|XP_004150615.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Cucumis 
sativus]
 ref|XP_004169009.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Cucumis 
sativus]
 gb|KGN51466.1| hypothetical protein Csa_5G561260 [Cucumis sativus]
Length=483

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 161/196 (82%), Gaps = 2/196 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFVVPSN YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQR
Sbjct  285  LTLNYGCLDNDLFLLDYGFVVPSNQYDYIELKYDEALLEAASIVAGISSENFSSPAPWQR  344

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             IL++LNL GE   LKV+IGG E+V+GRL+AALR  LS D E V+ H +  LKSLS E  
Sbjct  345  LILTKLNLHGEAALLKVSIGGSEIVDGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--  402

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAALRTV ALCVIALGHFPTKIM+DE LLK+  S T+ LAI+FR+QKKSVII
Sbjct  403  APLGIANEVAALRTVIALCVIALGHFPTKIMDDETLLKKCESETSKLAIQFRLQKKSVII  462

Query  264  DVMRDLTRRVKLLLSK  217
            DVM +LTRRVKLL SK
Sbjct  463  DVMSNLTRRVKLLSSK  478



>gb|KCW85966.1| hypothetical protein EUGRSUZ_B02669 [Eucalyptus grandis]
Length=290

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 2/202 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALLDAAS+AAGV S NFSSP+PWQ+
Sbjct  90   LLLNYGCLSNDLFLLDYGFVIPSNRYDTIELKYDGALLDAASLAAGVSSSNFSSPAPWQQ  149

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILSQLNL G+ PDLKVT+GGP+LVEGRL+AALR  L ++ ESV+ H + TLKS+S E  
Sbjct  150  EILSQLNLYGDTPDLKVTLGGPDLVEGRLLAALRVLLESESESVQKHDLSTLKSISAE--  207

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G A EVAA  T+ ALCVIA  HFPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+
Sbjct  208  APCGIATEVAAFHTIIALCVIASEHFPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIV  267

Query  264  DVMRDLTRRVKLLLSKESATAQ  199
            DV RDL+RR+K LLSKE+ +A+
Sbjct  268  DVTRDLSRRIKSLLSKETVSAK  289



>ref|XP_008467099.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Cucumis melo]
Length=423

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQ+
Sbjct  225  LTLNYGCLDNDLFLLDYGFVLPSNQYDYIELKYDEALLEAASIVAGISSENFSSPAPWQK  284

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             IL++LNL GE   LKV+IGG E+V+GRL+AALR  LS D E V+ H +  LKSLS E  
Sbjct  285  FILTKLNLHGEAALLKVSIGGSEVVDGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--  342

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAALRTV ALCVIALGHFPTKIMEDE LLK+  S T+ LAI+FR+QKKSVII
Sbjct  343  APLGIANEVAALRTVIALCVIALGHFPTKIMEDETLLKKCESETSKLAIQFRLQKKSVII  402

Query  264  DVMRDLTRRVKLLLSK  217
            D M +LTRRVKLL SK
Sbjct  403  DAMSNLTRRVKLLSSK  418



>ref|XP_010043959.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Eucalyptus 
grandis]
 gb|KCW85967.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=477

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALLDAAS+AAGV SPNFSSP+PWQ+
Sbjct  277  LLLNYGCLSNDLFLLDYGFVIPSNRYDTIELKYDGALLDAASLAAGVSSPNFSSPAPWQQ  336

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILSQLNL G+  DLKVT+GGP+LVEGRL+AALR  L ++ ESV+ H + TLKS+S E  
Sbjct  337  EILSQLNLYGDTADLKVTLGGPDLVEGRLLAALRVLLESENESVQKHDLSTLKSISAE--  394

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G A EVAA RT+ ALCVIAL HFPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+
Sbjct  395  APCGIATEVAAFRTIIALCVIALEHFPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIV  454

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMRDL+RR+K LLSKE+ +A+ 
Sbjct  455  DVMRDLSRRIKSLLSKETVSAKG  477



>ref|XP_008467097.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Cucumis melo]
Length=483

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQ+
Sbjct  285  LTLNYGCLDNDLFLLDYGFVLPSNQYDYIELKYDEALLEAASIVAGISSENFSSPAPWQK  344

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             IL++LNL GE   LKV+IGG E+V+GRL+AALR  LS D E V+ H +  LKSLS E  
Sbjct  345  FILTKLNLHGEAALLKVSIGGSEVVDGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--  402

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAALRTV ALCVIALGHFPTKIMEDE LLK+  S T+ LAI+FR+QKKSVII
Sbjct  403  APLGIANEVAALRTVIALCVIALGHFPTKIMEDETLLKKCESETSKLAIQFRLQKKSVII  462

Query  264  DVMRDLTRRVKLLLSK  217
            D M +LTRRVKLL SK
Sbjct  463  DAMSNLTRRVKLLSSK  478



>ref|XP_008467098.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Cucumis melo]
Length=481

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQ+
Sbjct  283  LTLNYGCLDNDLFLLDYGFVLPSNQYDYIELKYDEALLEAASIVAGISSENFSSPAPWQK  342

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             IL++LNL GE   LKV+IGG E+V+GRL+AALR  LS D E V+ H +  LKSLS E  
Sbjct  343  FILTKLNLHGEAALLKVSIGGSEVVDGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--  400

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANEVAALRTV ALCVIALGHFPTKIMEDE LLK+  S T+ LAI+FR+QKKSVII
Sbjct  401  APLGIANEVAALRTVIALCVIALGHFPTKIMEDETLLKKCESETSKLAIQFRLQKKSVII  460

Query  264  DVMRDLTRRVKLLLSK  217
            D M +LTRRVKLL SK
Sbjct  461  DAMSNLTRRVKLLSSK  476



>ref|XP_010046478.1| PREDICTED: uncharacterized protein LOC104435421 [Eucalyptus grandis]
Length=400

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSN YD IEL+YD ALLDAAS+AAGV S NFSSP+PWQ+
Sbjct  200  LLLNYGCLSNDLFLLDYGFVIPSNRYDTIELKYDGALLDAASLAAGVSSSNFSSPAPWQQ  259

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILSQLNL G+ PDLKVT+GGP+LVEGRL+AALR  L ++ ESV+ H + TLKS+S E  
Sbjct  260  EILSQLNLYGDTPDLKVTLGGPDLVEGRLLAALRVLLESESESVQKHDLSTLKSISAE--  317

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             P G A EVAA  T+ ALCVIA  HFPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+
Sbjct  318  APCGIATEVAAFHTIIALCVIASEHFPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIV  377

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DV RDL+RR+K LLSKE+ +A+ 
Sbjct  378  DVTRDLSRRIKSLLSKETVSAKG  400



>ref|XP_010906939.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Elaeis guineensis]
Length=492

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 166/201 (83%), Gaps = 3/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSNP+D +EL+YD  LLDAASMAAGV SP+FSSP+ WQ+
Sbjct  295  VMLNYGCLSNDLFLLDYGFVIPSNPFDYVELKYDGTLLDAASMAAGVSSPSFSSPNYWQK  354

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILSQLNL G     KV++GGP+LV+GRL+AALR  LSND E+V+ H ++ L SLS E  
Sbjct  355  EILSQLNLQGVQALPKVSLGGPQLVDGRLLAALRVLLSNDKETVQGHDLNALMSLSEE--  412

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG   EVAALRTV AL VIAL HFPTKIMEDE++LK+ +S++ +LAI+FR+QKK +II
Sbjct  413  APLGVPIEVAALRTVIALSVIALEHFPTKIMEDESILKKKLSSSKELAIQFRMQKKLMII  472

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMR LT+RVK +LS+E +TA
Sbjct  473  DVMRKLTKRVK-MLSEEKSTA  492



>ref|XP_008809406.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Phoenix 
dactylifera]
Length=491

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 164/201 (82%), Gaps = 3/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSNP+D +EL+YD  LLDAASMAAGV +P+F SP  WQ 
Sbjct  294  VMLNYGCLSNDLFLLDYGFVIPSNPFDYVELKYDGTLLDAASMAAGVSTPSFLSPKHWQE  353

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILSQLNL G+   LKV++GGPELV+GRL+AALR  LSND E+ + H ++TL SLS E  
Sbjct  354  EILSQLNLQGDQALLKVSLGGPELVDGRLLAALRVLLSNDEETAQRHDLNTLMSLSEE--  411

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG   EVAALRTV AL VIAL HFPTKIMEDE++LK NVS++ +LAI+FR+QKK +I 
Sbjct  412  APLGVPIEVAALRTVIALSVIALEHFPTKIMEDESILKGNVSSSKELAIQFRMQKKLMIK  471

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVMR LT+RVK +LS+E +TA
Sbjct  472  DVMRKLTQRVK-MLSEEKSTA  491



>ref|XP_006647850.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Oryza 
brachyantha]
Length=486

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             + LNYGC +ND FLLDYGFV+ SNPYD +EL YD  LLDAASMAAGV SPNFS+P+ WQ
Sbjct  288  AVTLNYGCYHNDFFLLDYGFVITSNPYDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQ  347

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            R+ILSQLNL GE   LKV+IGGP++V+GRL+AALR  ++ D E+V  H +  L  +S++ 
Sbjct  348  RDILSQLNLYGEGAILKVSIGGPDIVDGRLLAALRVIIAADPEAVSGHDLKIL--MSLKE  405

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            + PLG A E + LRT+ ALC  AL HF TKIMEDEA+LK     TT+LA++FR+QKK ++
Sbjct  406  KAPLGPAVEASVLRTLLALCTFALQHFHTKIMEDEAILKGEPPLTTELAVQFRLQKKLLL  465

Query  267  IDVMRDLTRRVKLL  226
            +DV+++L+RR+K+L
Sbjct  466  LDVIQNLSRRIKML  479



>gb|EEC73951.1| hypothetical protein OsI_08832 [Oryza sativa Indica Group]
Length=486

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 152/194 (78%), Gaps = 2/194 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             + LNYGC  ND FLLDYGFV+ SN YD +EL YD  LLDAASMAAGV SPNFS+P+ WQ
Sbjct  288  AVTLNYGCYPNDFFLLDYGFVITSNSYDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQ  347

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            ++ILSQLNL GE   LKV+IGGPE+V+GRL+AALR  ++ D ++V  H + TL  +S++ 
Sbjct  348  QDILSQLNLYGEGAILKVSIGGPEIVDGRLLAALRVIIAADPDAVSGHDLKTL--MSLKE  405

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            + PLG A E +ALRTV ALC  AL HF TKIMEDEA+LK+    TT+LA++FR+QKK ++
Sbjct  406  KAPLGPAVEASALRTVLALCTFALQHFHTKIMEDEAILKREPPLTTELAVQFRLQKKLLL  465

Query  267  IDVMRDLTRRVKLL  226
            +DV+++L+RR+K+L
Sbjct  466  LDVIQNLSRRIKML  479



>ref|NP_001048036.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAD16153.1| SET domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF09950.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAH00588.1| unnamed protein product [Oryza sativa Japonica Group]
Length=486

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             + LNYGC  ND FLLDYGFV+ SN YD +EL YD  LLDAASMAAGV SPNFS+P+ WQ
Sbjct  288  AVTLNYGCYPNDFFLLDYGFVITSNSYDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQ  347

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            ++ILSQLNL GE   LKV+IGGPE+V+GRL+AALR  ++ D ++V  H + TL  +S++ 
Sbjct  348  QDILSQLNLYGEGAILKVSIGGPEIVDGRLLAALRVIIAADPDAVSGHDLKTL--MSLKE  405

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            + PLG A E +ALRTV ALC  AL HF TKIMEDEA+LK     TT+LA++FR+QKK ++
Sbjct  406  KAPLGPAVEASALRTVLALCTFALQHFHTKIMEDEAILKGEPPLTTELAVQFRLQKKLLL  465

Query  267  IDVMRDLTRRVKLL  226
            +DV+++L+RR+K+L
Sbjct  466  LDVIQNLSRRIKML  479



>ref|XP_010681928.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYG ++NDLFLLDYGFV+ +NPYD IEL+Y  ALLDAAS+  GV SP F+SP+ WQ 
Sbjct  292  VELNYGNMSNDLFLLDYGFVITANPYDSIELQYQAALLDAASVIVGVSSPYFTSPASWQL  351

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EILS L LD E   +KVT+GGP+LV+G L+AA R   ++D +SV  H + TL+ LS E  
Sbjct  352  EILSALKLDSEGSSIKVTLGGPDLVDGLLLAASRVLHASDAKSVSKHELSTLQLLSAE--  409

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG +NE+AAL+T+  LC++ L +FPT+IMEDEALLK+ VS+ ++LAI+FR++KKS+I+
Sbjct  410  APLGISNELAALKTMIGLCLVILQNFPTQIMEDEALLKEGVSSFSELAIKFRLEKKSLIV  469

Query  264  DVMRDLTRRVKLLLSKES  211
            +VMR+L+ RVKLL ++ES
Sbjct  470  NVMRELSERVKLLQARES  487



>gb|ACF87938.1| unknown [Zea mays]
Length=352

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -1

Query  810  RCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPW  631
              I LNYGC  ND FLLDYGFV+  NPYD +EL YD ALLDAASMAAGV SPNFS+P+ W
Sbjct  153  EAITLNYGCYPNDFFLLDYGFVITQNPYDQVELSYDGALLDAASMAAGVSSPNFSAPAKW  212

Query  630  QREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVE  451
            Q++ILSQLNL GE   LKV++GGP++V+GRL+AALR  L++D E+V  H ++TL SL V 
Sbjct  213  QQDILSQLNLHGEGAVLKVSLGGPDVVDGRLLAALRVLLADDPEAVHKHDLNTLMSLDV-  271

Query  450  PQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSV  271
             Q PLG   E +ALRTV ALC IAL HF TKIM+D+A+L       T LA++FR+QKK  
Sbjct  272  -QVPLGPTVEASALRTVLALCAIALQHFHTKIMDDQAILGGGPPLITQLAVQFRLQKKFT  330

Query  270  IIDVMRDLTRRVKLLLSKES  211
            I+DVM++++RR+K+L  ++S
Sbjct  331  IVDVMQNISRRIKMLSPQKS  350



>ref|XP_002454330.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
 gb|EES07306.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
Length=490

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 157/202 (78%), Gaps = 3/202 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             I LNYGC  ND FLLDYGFV+  NPYD +EL YD  LLDAASMAAGV SPNFS+P+ WQ
Sbjct  292  SITLNYGCHPNDFFLLDYGFVITPNPYDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQ  351

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            ++ILSQLNL GE   LKV++GGP++V+GRL+AALR  L++D E++  H + TL SL V  
Sbjct  352  QDILSQLNLHGEGAILKVSLGGPDIVDGRLLAALRVLLADDPEALHKHDLKTLMSLDV--  409

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            Q PLG A E +ALRTV ALC IAL HF TKIM+DEA+L+     TT+LA++FR+QKK +I
Sbjct  410  QAPLGPAIEASALRTVLALCAIALQHFHTKIMDDEAILRGGPPLTTELAVQFRLQKKFMI  469

Query  267  IDVMRDLTRRVKLLLSKESATA  202
            +DVM++++RR+K +LS + +TA
Sbjct  470  VDVMQNVSRRIK-MLSPQKSTA  490



>ref|XP_004953834.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Setaria 
italica]
Length=485

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             I LNYGC  ND FLLDYGFV+  NPYD +EL YD AL DAASMAAGV SPNFS+P+ WQ
Sbjct  287  AITLNYGCHPNDFFLLDYGFVIAPNPYDLVELSYDGALFDAASMAAGVSSPNFSAPAKWQ  346

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            ++ILSQLNL GE   LKV++GGP++V+GRL+AALR  L+ D E+V  H + T+  +S++ 
Sbjct  347  QDILSQLNLHGEGAILKVSLGGPDIVDGRLLAALRVLLAADPEAVHKHDLKTM--MSLDA  404

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            Q PLG   E +ALRTV ALC IAL HF TKIMEDEA+LK     TT+LA++FR+QKK +I
Sbjct  405  QAPLGPTVEASALRTVLALCAIALQHFHTKIMEDEAILKGEPPLTTELAVQFRLQKKFLI  464

Query  267  IDVMRDLTRRVKLLLSKESATA  202
            +DVM++++R++K +LS + +TA
Sbjct  465  VDVMQNISRKIK-MLSPQKSTA  485



>emb|CDY66565.1| BnaAnng22450D [Brassica napus]
Length=366

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+ND FLLDYGFVV SNPYD IEL YD  LLDAAS+A G  S  FSSP+PWQ 
Sbjct  168  LLLNYGCLSNDSFLLDYGFVVESNPYDTIELNYDEGLLDAASLAVGFASGKFSSPAPWQH  227

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+ P+LKVT+GG E V+GRL+AA+R  LS ++  V  H ++ LKSLS    
Sbjct  228  QLLSQLNLAGKMPNLKVTLGGQETVDGRLLAAIRILLSGELVEVEKHDLEALKSLS--SV  285

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  +TV   CV+A     +++ + EA+LKQ VS T +L I++RIQKKSV  
Sbjct  286  APLGIANEIATFQTVMVFCVLA-NVVLSRLEDHEAILKQGVSDTAELIIKYRIQKKSVFS  344

Query  264  DVMRDLTRRVKLLLSKESATA  202
             V+ DL RRVKLL ++E+  A
Sbjct  345  GVIEDLRRRVKLLSAQETPNA  365



>ref|NP_001151430.1| SET domain containing protein [Zea mays]
 gb|ACG42857.1| SET domain containing protein [Zea mays]
 gb|AFW63825.1| SET domain containing protein [Zea mays]
Length=491

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             I LNYGC  ND FLLDYGFV+  NPYD +EL YD ALLDAASMAAGV SPNFS+P+ WQ
Sbjct  293  AITLNYGCYPNDFFLLDYGFVITQNPYDQVELSYDGALLDAASMAAGVSSPNFSAPAKWQ  352

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            ++ILSQLNL GE   LKV++GGP++V+GRL+AALR  L++D E+V  H ++TL SL V  
Sbjct  353  QDILSQLNLHGEGAVLKVSLGGPDVVDGRLLAALRVLLADDPEAVHKHDLNTLMSLDV--  410

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            Q PLG   E +ALRTV ALC IAL HF TKIM+D+A+L       T LA++FR+QKK  I
Sbjct  411  QVPLGPTVEASALRTVLALCAIALQHFHTKIMDDQAILGGGPPLITQLAVQFRLQKKFTI  470

Query  267  IDVMRDLTRRVKLLLSKES  211
            +DVM++++RR+K+L  ++S
Sbjct  471  VDVMQNISRRIKMLSPQKS  489



>ref|XP_003570495.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brachypodium 
distachyon]
Length=485

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGC  ND +LLDYGFVV SNPYD +EL YD ALLDAASMAAGV SPNFS+P+ WQ+
Sbjct  288  VTLNYGCYPNDFYLLDYGFVVTSNPYDQVELSYDGALLDAASMAAGVSSPNFSTPAKWQQ  347

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            + LS+LNL GE   LKV++GGP++V+GRL+AALR  L+   E+V+ H + TL SL+   +
Sbjct  348  DFLSKLNLHGEGAILKVSLGGPDIVDGRLLAALRVLLAAGPETVQEHDLKTLTSLN--KK  405

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG A E +ALRTV ALC IAL HF TKIMEDEA+LK     TT+LA++FR+QKK +++
Sbjct  406  APLGPAVESSALRTVLALCAIALQHFHTKIMEDEAVLKGEPPLTTELAVQFRLQKKLMLV  465

Query  264  DVMRDLTRRVKLLLSKESATA  202
            DVM++L+RR+K LLS E +TA
Sbjct  466  DVMQNLSRRIK-LLSPEKSTA  485



>dbj|BAK03360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             + LNYGC  ND +LLDYGFVV SNPYD +EL YD  LLDAASMAAGV +PNFS+P+ WQ
Sbjct  287  AVTLNYGCYPNDFYLLDYGFVVTSNPYDQVELSYDGNLLDAASMAAGVSNPNFSTPAKWQ  346

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            +EILSQLNL GE   LKV++GGP++V+GRL+AALR  L+ D E+V  H + TL SLS   
Sbjct  347  QEILSQLNLHGEGAILKVSLGGPDIVDGRLLAALRVLLAADPEAVGKHDLKTLMSLSA--  404

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            + PLG   E +A RTV ALC IAL HF TKIM+D+A+LK     TT+LA++FR+QKK ++
Sbjct  405  KAPLGPTVEASAFRTVLALCAIALQHFHTKIMDDQAILKGEPPLTTELAVQFRLQKKLML  464

Query  267  IDVMRDLTRRVKLLLSKESATA  202
            +D+M++L+RR+K  LS E +TA
Sbjct  465  VDIMQNLSRRIK-TLSPEKSTA  485



>gb|EMT12546.1| hypothetical protein F775_52053 [Aegilops tauschii]
Length=500

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             + LNYGC  ND +LLDYGFVV SNPYD +EL YD  LLDAASMAAGV +PNFS+P+ WQ
Sbjct  302  AVTLNYGCYPNDFYLLDYGFVVTSNPYDQVELSYDGNLLDAASMAAGVSNPNFSTPAKWQ  361

Query  627  REILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEP  448
            ++ILSQLNL GE   LKV++GGP++V+G L+AALR  L+ D ++V  H ++TL SL    
Sbjct  362  QDILSQLNLHGEGAVLKVSLGGPDVVDGHLLAALRVLLAADPDTVGKHDLETLMSLGT--  419

Query  447  QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVI  268
            + PLG   E +ALRTV ALC IAL HF TKIM+D+A+LK     TT+LA++FR+QKK ++
Sbjct  420  KAPLGPTVEASALRTVLALCAIALQHFHTKIMDDQAVLKGEPPLTTELAVQFRLQKKLML  479

Query  267  IDVMRDLTRRVKLLLSKESATA  202
            +D+M++L+RR+K  LS E +TA
Sbjct  480  VDIMQNLSRRIK-SLSPEKSTA  500



>ref|XP_006828432.1| hypothetical protein AMTR_s00060p00101960 [Amborella trichopoda]
 gb|ERM95848.1| hypothetical protein AMTR_s00060p00101960 [Amborella trichopoda]
Length=480

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 147/195 (75%), Gaps = 4/195 (2%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+P NPYD +EL+YD  LLDAAS+AAG+ S N SSPSPWQ+
Sbjct  281  VLLNYGCLSNDLFLLDYGFVLPKNPYDFVELKYDGGLLDAASLAAGIFSANISSPSPWQQ  340

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +IL++L L+G   D KV +GGPE+V+GRL+AALR  L+++ E V+  +   L+S S +  
Sbjct  341  QILTELKLEGTGADHKVRLGGPEVVDGRLLAALRVLLADNAEDVKQINQTALQSFSSD--  398

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSV  271
            PPLG + E++ALRTV  LC I+L HFPT I EDE  LK  + +    + A+RFR++KK++
Sbjct  399  PPLGVSIEISALRTVLGLCAISLQHFPTMIAEDEKALKNGEKIFPAMESALRFRMRKKTL  458

Query  270  IIDVMRDLTRRVKLL  226
            IID MRD+TRR+  L
Sbjct  459  IIDTMRDITRRLNSL  473



>gb|ADE75732.1| unknown [Picea sitchensis]
Length=320

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 140/191 (73%), Gaps = 3/191 (2%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            I L+YG L NDLFL+DYGFVV  N +D +EL+YD ALLDAA+  AGV S  F+SP+ WQ+
Sbjct  117  ILLDYGPLTNDLFLIDYGFVVSKNQHDYVELKYDRALLDAAAAIAGVRSDAFASPARWQQ  176

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            EIL QL + G+    KVT+GG +LV+G L+AALR   + D+ES+  H +  L+SL++E  
Sbjct  177  EILCQLKVQGDQAVEKVTLGGVDLVDGHLLAALRVLFAEDLESIEKHDLINLQSLAME--  234

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALL-KQNVSATTDLAIRFRIQKKSVI  268
             PLG ANE   LRT+ ALC I+LGHFPTKIMEDE LL K+  S    LA+ +RI+KK ++
Sbjct  235  APLGAANESNVLRTIIALCAISLGHFPTKIMEDEMLLRKEGNSEAMKLAVEYRIKKKEML  294

Query  267  IDVMRDLTRRV  235
            IDVMRDLTRR+
Sbjct  295  IDVMRDLTRRL  305



>ref|XP_009113823.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=468

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 140/201 (70%), Gaps = 9/201 (4%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL      LDYGFVV SNPYD IEL YD  LLDAAS+A G  S  FSSP+PWQ 
Sbjct  276  LLLNYGCL------LDYGFVVESNPYDTIELNYDEGLLDAASLAVGFASGKFSSPAPWQH  329

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            ++LSQLNL G+ P+LKVT+GG E V+GRL+AA+R  LS ++  V  H ++ LKSLS    
Sbjct  330  QLLSQLNLAGKMPNLKVTLGGQETVDGRLLAAIRILLSGELVEVEKHDLEALKSLS--SV  387

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG ANE+A  +TV   CV+A     +++ + EA+LKQ VS T +L I++RIQKKSV  
Sbjct  388  APLGIANEIATFQTVMVFCVLA-NVVLSQLEDHEAILKQGVSDTAELIIKYRIQKKSVFS  446

Query  264  DVMRDLTRRVKLLLSKESATA  202
             V+ DL RRVKLL ++E+  A
Sbjct  447  GVIEDLRRRVKLLSAQETPNA  467



>ref|XP_009420293.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 162/203 (80%), Gaps = 3/203 (1%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYG L+ND FLLDYGFV+PSNP+D +EL+YD ALLDAAS+AAGV S +F SPS WQ+
Sbjct  291  VLLNYGSLSNDFFLLDYGFVIPSNPHDHVELKYDEALLDAASLAAGVSSSSFLSPSDWQQ  350

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
            +ILS+LNL G+   LKVT+GGP LV+GRL+AALR  LS++ E+V+ H +DTL SLS E  
Sbjct  351  DILSRLNLRGDEALLKVTLGGPGLVDGRLLAALRVLLSSNKETVQRHDLDTLMSLSEE--  408

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVII  265
             PLG + EVAALRTV +LCV+AL  FPTKIM+DE++ K  +S +T+LA+RFR+QKK  II
Sbjct  409  APLGMSTEVAALRTVISLCVVALESFPTKIMQDESIFKTAISYSTELAVRFRMQKKLTII  468

Query  264  DVMRDLTRRVKLLLSKESATAQS  196
            DVMR LT++VK  +SK   TAQ+
Sbjct  469  DVMRKLTQKVK-KISKMELTAQN  490



>gb|EPS70598.1| hypothetical protein M569_04159, partial [Genlisea aurea]
Length=458

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 134/197 (68%), Gaps = 13/197 (7%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVE--SPNFSSPSPW  631
            + LNYG LNNDLFLLDYGF+VPSNPYDC+E++YD  LL AA+  A  +    +FS  S W
Sbjct  269  LELNYGRLNNDLFLLDYGFIVPSNPYDCVEVKYDIDLLQAAATYATTDDRGIHFSHAS-W  327

Query  630  QREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDM---ESVRNHSMDTLKSL  460
            + + LS LNL GE  DLKV IGG E+VE RL+AALR  LS+D    ++  + ++D LKSL
Sbjct  328  KNKYLSLLNLAGEKSDLKVRIGGSEVVEDRLLAALRILLSHDYDDHDTAESFNLDALKSL  387

Query  459  SVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDE-ALLKQNVSATTDLAIRFRIQ  283
            +        +  +  A R + ALCVIAL  FPTKI EDE  LL+  +S TT+LA+R+R+Q
Sbjct  388  TY------ASPVDADAFRVLIALCVIALHGFPTKITEDEKTLLEGKLSQTTELAVRYRLQ  441

Query  282  KKSVIIDVMRDLTRRVK  232
            KK +I+  +RDL  R+K
Sbjct  442  KKGIIVSAIRDLNTRLK  458



>dbj|BAD26590.1| SET-domain transcriptional regulator [Citrullus lanatus]
Length=143

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = -1

Query  618  LSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPP  439
            +++LNL GE   LKV+IGG E V GRL+A LR  LS D E+V+ H +  LKSLS E   P
Sbjct  7    ITKLNLXGEAALLKVSIGGXEXVAGRLLAXLRVLLSVDEETVQKHDLSVLKSLSAEA--P  64

Query  438  LGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDV  259
             G ANEVAALRTV ALCVIALGHFPTKIMEDE LLK+  + T+ LAI+FR+QKKSVIIDV
Sbjct  65   RGVANEVAALRTVIALCVIALGHFPTKIMEDETLLKKCENETSKLAIQFRLQKKSVIIDV  124

Query  258  MRDLTRRVKLLLSK  217
            M  LTRRVKLL SK
Sbjct  125  MSXLTRRVKLLSSK  138



>ref|XP_002964620.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
 gb|EFJ34953.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
Length=464

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 122/195 (63%), Gaps = 6/195 (3%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVE---SPNFSSPS  637
             I LNYG L+NDL LLDYGFV+P NP+D IELRYD +L++ A M AG+    SP FSSP+
Sbjct  261  AITLNYGPLSNDLLLLDYGFVIPDNPHDRIELRYDGSLMENARMIAGLSRTGSPPFSSPA  320

Query  636  PWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLS  457
             WQ + L QL L       KVT+GGPE V+GRL+AALR   +   E +    + +L++  
Sbjct  321  SWQVDRLKQLGLADSGESQKVTLGGPEEVDGRLLAALRILHAESQEPLERRELVSLQAWG  380

Query  456  VEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK-QNVSATTDLAIRFRIQK  280
            VE    + + NE   LRT+  L  I    F T I EDEA L  ++++ T+ +A++FR+ K
Sbjct  381  VESM--VSSDNEERVLRTLCGLAAIVFNQFKTTIEEDEAKLSDKSLAETSRIAVQFRLTK  438

Query  279  KSVIIDVMRDLTRRV  235
            K +++ V+  L +R+
Sbjct  439  KRLVVRVLESLKKRL  453



>ref|XP_002989522.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
 gb|EFJ09398.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
Length=464

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 122/195 (63%), Gaps = 6/195 (3%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVE---SPNFSSPS  637
             I LNYG L+NDL LLDYGFV+P NP+D IELRYD +L++ A M AG+    SP FSSP+
Sbjct  261  AITLNYGPLSNDLLLLDYGFVIPDNPHDRIELRYDGSLMENARMIAGLSRTGSPPFSSPA  320

Query  636  PWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLS  457
             WQ + L QL L       KVT+GGPE V+GRL+AALR   +   E +    + +L++  
Sbjct  321  SWQVDRLKQLGLADSGESQKVTLGGPEEVDGRLLAALRILHAESQEPLERRELVSLQAWG  380

Query  456  VEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK-QNVSATTDLAIRFRIQK  280
            VE    + + NE   LRT+  L  I    F T I EDEA L  ++++ T+ +A++FR+ K
Sbjct  381  VESM--VSSDNEERVLRTLCGLGAIVFNQFKTTIEEDEAKLSDKSLAETSRIAVQFRLTK  438

Query  279  KSVIIDVMRDLTRRV  235
            K +++ V+  L +R+
Sbjct  439  KRLVVRVLESLKKRL  453



>gb|EMS47111.1| hypothetical protein TRIUR3_10865 [Triticum urartu]
Length=264

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 128/203 (63%), Gaps = 30/203 (15%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
             + LNYGC  ND +LLDYGFVV SNPYD +EL YD  L +                    
Sbjct  86   AVTLNYGCYPNDFYLLDYGFVVTSNPYDQVELSYDVFLYE--------------------  125

Query  627  REILSQLNLDGENPDL----KVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSL  460
                S+ ++   +PDL    +V++GGP++V+GRL+AALR  L+ D E+V  H + TL SL
Sbjct  126  ----SEPDIFCYDPDLVTAFQVSLGGPDIVDGRLLAALRVLLAADPETVGKHDLKTLMSL  181

Query  459  SVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQK  280
              E   PLG   E +ALRTV ALC IAL HF TKIM+D+A+LK     TT LA++FR+QK
Sbjct  182  GTEA--PLGPTVEASALRTVLALCAIALQHFHTKIMDDQAVLKGEPPLTTQLAVQFRLQK  239

Query  279  KSVIIDVMRDLTRRVKLLLSKES  211
            K +++D+M++L+RR+K L  ++S
Sbjct  240  KLMLVDIMQNLSRRIKTLAPEKS  262



>ref|XP_001759585.1| predicted protein [Physcomitrella patens]
 gb|EDQ75497.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 122/190 (64%), Gaps = 3/190 (2%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYG L+ND+ LLDYGFV+P NP D +ELRYD  LL  A + A V   +F  P+  Q 
Sbjct  150  VVLNYGPLSNDILLLDYGFVMPKNPNDRVELRYDDQLLHMACLVAKVNIDSFKDPTTSQL  209

Query  624  EILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQ  445
             +L++LNL G +    VT+GG ELVEGRL+AA+R   + D   + +  ++ L++ +    
Sbjct  210  ALLTRLNLHGPSSSQMVTLGGTELVEGRLLAAVRVMHAQDPMELLDVDLEALQTWNQS--  267

Query  444  PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEA-LLKQNVSATTDLAIRFRIQKKSVI  268
            PPLG  NE   +RT+  L ++AL  FPT+I ED++ L+K ++S    LAI+FR+ KK ++
Sbjct  268  PPLGVLNERKTIRTLIGLGMLALASFPTEIEEDQSELVKGDISENHRLAIQFRMLKKRLL  327

Query  267  IDVMRDLTRR  238
            +D ++ L  R
Sbjct  328  LDTIKGLKAR  337



>gb|EEE57758.1| hypothetical protein OsJ_08284 [Oryza sativa Japonica Group]
Length=437

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  690  DAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLS  511
            +AAS         F     WQ++ILSQLNL GE   LKV+IGGPE+V+GRL+AALR  ++
Sbjct  278  NAASWQQEFLRLTFQLQPSWQQDILSQLNLYGEGAILKVSIGGPEIVDGRLLAALRVIIA  337

Query  510  NDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK  331
             D ++V  H + TL  +S++ + PLG A E +ALRTV ALC  AL HF TKIMEDEA+LK
Sbjct  338  ADPDAVSGHDLKTL--MSLKEKAPLGPAVEASALRTVLALCTFALQHFHTKIMEDEAILK  395

Query  330  QNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  226
                 TT+LA++FR+QKK +++DV+++L+RR+K+L
Sbjct  396  GEPPLTTELAVQFRLQKKLLLLDVIQNLSRRIKML  430



>ref|XP_008221467.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
 ref|XP_008245923.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
Length=356

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQ  628
            C+ LNYGCLNNDLFLLDYGFV+PSNPYDCIEL+YD ALLDAASMAAGV SPNFS PSPWQ
Sbjct  280  CLVLNYGCLNNDLFLLDYGFVIPSNPYDCIELKYDGALLDAASMAAGVSSPNFSVPSPWQ  339

Query  627  REILSQLNLDGENPDLK  577
            +EIL QL LDGE P LK
Sbjct  340  KEILCQLKLDGEAPLLK  356



>gb|ACN35906.1| unknown [Zea mays]
Length=164

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -1

Query  639  SPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSL  460
             P   +ILSQLNL GE   LKV++GGP++V+GRL+AALR  L++D E+V  H ++TL SL
Sbjct  22   QPSGNKILSQLNLHGEGAVLKVSLGGPDVVDGRLLAALRVLLADDPEAVHKHDLNTLMSL  81

Query  459  SVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQK  280
             V  Q PLG   E +ALRTV ALC IAL HF TKIM+D+A+L       T LA++FR+QK
Sbjct  82   DV--QVPLGPTVEASALRTVLALCAIALQHFHTKIMDDQAILGGGPPLITQLAVQFRLQK  139

Query  279  KSVIIDVMRDLTRRVKLLLSKES  211
            K  I+DVM++++RR+K+L  ++S
Sbjct  140  KFTIVDVMQNISRRIKMLSPQKS  162



>ref|XP_006448171.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61411.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=373

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + LNYGCL+NDLFLLDYGFV+PSNPYD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ+
Sbjct  274  LLLNYGCLSNDLFLLDYGFVMPSNPYDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQ  333

Query  624  EILSQLNLDGENPDLKVTI  568
            +ILSQLNL GE   +K+ +
Sbjct  334  QILSQLNLVGETAIVKLKL  352



>ref|XP_001703025.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96670.1| predicted protein [Chlamydomonas reinhardtii]
Length=471

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 110/205 (54%), Gaps = 30/205 (15%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVE----SPNFSSPS  637
            + L+YG L+ND   +DYGF+V  NPYD ++LR+D  LL A ++ A V     +P   +P 
Sbjct  223  LLLSYGQLSNDFLFMDYGFIVEDNPYDSVQLRFDVNLLQAGALVANVSDALGAPLDLAPR  282

Query  636  PWQREILSQLNLDG--ENPDLKVTIGGP--ELVEGRLMAALRAFLSNDMESVRNHSMDTL  469
             WQ ++L++L L G   N +L +  GGP  EL++GRL+AA R  ++     V    ++ L
Sbjct  283  TWQLQLLAELGLVGPAANTELNIGGGGPGAELLDGRLLAAARIMVARADGEVSGRGVERL  342

Query  468  KSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQN------------  325
             ++      PLG  NE+AALRTV  +   AL +F T + +D+ LL               
Sbjct  343  CAVDR----PLGRDNELAALRTVGGVLAFALSNFATTLDQDKTLLAGQPVAVPQAGGVGE  398

Query  324  ------VSATTDLAIRFRIQKKSVI  268
                   S    LA+RFR++KK ++
Sbjct  399  RELPPLASEDEALAVRFRLEKKKIL  423



>ref|XP_002955706.1| hypothetical protein VOLCADRAFT_106928 [Volvox carteri f. nagariensis]
 gb|EFJ43131.1| hypothetical protein VOLCADRAFT_106928 [Volvox carteri f. nagariensis]
Length=542

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 107/206 (52%), Gaps = 27/206 (13%)
 Frame = -1

Query  816  TERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVES----PNF  649
            T   + L+YG LNND   +DYGF+VP NPYD ++LR+D  L+ A  + A V      P  
Sbjct  294  TGEPLLLSYGKLNNDFLFMDYGFIVPDNPYDTVQLRFDIGLMQAGCLVANVTDAEGPPRD  353

Query  648  SSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNH-SMDT  472
               +PW++E+L++L L G    L++ +GGP+L++ RL+AA R  ++     V      + 
Sbjct  354  LVITPWRQELLTELGLAGAAATLELNLGGPDLLDPRLLAAARVMVARQAGEVAGRGGAER  413

Query  471  LKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTD-----  307
            L ++      PL   NE AALR V  +  +AL  F   + +D ALL   V  +T+     
Sbjct  414  LCAIDC----PLSRENETAALRVVGGVIAVALSTFRRTLDQDLALLAGQVPPSTEADGNQ  469

Query  306  -------------LAIRFRIQKKSVI  268
                         LA+RF ++KK ++
Sbjct  470  RQDLAPLETADEMLAVRFCVEKKRIL  495



>ref|XP_005644202.1| SET domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19658.1| SET domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 118/228 (52%), Gaps = 26/228 (11%)
 Frame = -1

Query  834  CCRTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAAS-MAAGVES  658
              R    E  + L+YG L+N   LLDYGF+VP NP+D + +RYDP + +A   +A G  +
Sbjct  259  ASRDIRAEEDLLLSYGKLDNTFLLLDYGFMVPGNPHDTVLIRYDPIMFEAGHLLAQGQGA  318

Query  657  PNFSSP----SPWQREILSQLNLDGENPDLKVTIGGP-ELVEGRLMAALRAFLSNDMESV  493
            P  ++P    + +Q+++L+++NL G   DL++  G   +    RL+A  R F +     V
Sbjct  319  PPDNAPDLGSATFQQQLLTEMNLLGPKADLELAFGRSLQRCSPRLLAVARLFTAASAAEV  378

Query  492  RNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQN--VS  319
            R  S D L +       PL   NEV ALR V  +  + L  FPT + +D   L+    V+
Sbjct  379  RGRSADDLGAWDQ----PLSLINEVKALRMVAGVAAMLLTRFPTTLEQDRRALEGGPAVA  434

Query  318  ATTDL--------------AIRFRIQKKSVIIDVMRDLTRRVKLLLSK  217
            A   L              A++ R +KK+V+ +V++D+  R++ L S+
Sbjct  435  AEGGLPEGGPHQLAPDVRAAVQLRAEKKAVLSEVLQDIGHRIRGLASQ  482



>ref|XP_001421544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99837.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=488

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 109/209 (52%), Gaps = 7/209 (3%)
 Frame = -1

Query  828  RTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESP--  655
            R   +   I L+YG L+ND  LLDYGF+V  NP+DC++LR+D  L++ A    G+ +   
Sbjct  283  RALTSGEPIELSYGNLSNDELLLDYGFIVKDNPFDCVKLRWDLKLIELAREIGGLAAAPI  342

Query  654  -NFSSPSPWQREILSQLNLDGENPDLKVTI-GGPELVEGRLMAALRAFLSNDMESVRNHS  481
               +  +PWQ   L ++ L G++P++++++ G  ++++ + +A LR   S         +
Sbjct  343  DTVAKVAPWQATALERIGLVGDDPNVELSVFGAGQVMDKKALAGLRVLYSKSSAEASRAA  402

Query  480  MDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLA  301
                  +  +    +    E+ ALRT  +L  +ALG+F T + +DE L     S    LA
Sbjct  403  DAPFGEIDAD---VVSKDTEIKALRTCMSLLALALGNFSTTLEKDEELHDAATSPQVRLA  459

Query  300  IRFRIQKKSVIIDVMRDLTRRVKLLLSKE  214
            I FR++KK V+   M  L   ++ L   E
Sbjct  460  IAFRMEKKKVLAKSMARLNESIERLQRDE  488



>ref|XP_002506068.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO67326.1| set domain protein [Micromonas sp. RCC299]
Length=513

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 117/214 (55%), Gaps = 20/214 (9%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPS-NPYDCIELRYDPALLDAASMAAGVESPNFSSPS-PW  631
            + LNYG L+ND FLLDYGFV    N +D   LR+D + L+AA   AG+    F++ + PW
Sbjct  300  VTLNYGNLSNDHFLLDYGFVPQGINKHDTASLRWDVSYLEAAREVAGLAQVPFAAGTEPW  359

Query  630  QREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNH-SMDTLKSLSV  454
            Q  +LS+L LD ++P++ VT    + V+ RL+A +R   ++  E   +  S + L+ L  
Sbjct  360  QSAMLSELGLD-DDPEVLVTRDERQPVDARLLAGIRVLYASGPEDFSSGGSGEALQPLRH  418

Query  453  EP--QPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQ------NVSATTD---  307
                +  L    E  ALRT  A   +ALG+FPT + EDE  L++       +S   D   
Sbjct  419  GALLESTLDRTKEAYALRTAQAALALALGNFPTTLKEDETKLEELTAELAELSGVGDALE  478

Query  306  -----LAIRFRIQKKSVIIDVMRDLTRRVKLLLS  220
                 LA++FR  KK VI   M+ +  R++++L+
Sbjct  479  KENLALAVKFRKGKKEVISRAMKAIDERLRVVLA  512



>ref|XP_003083454.1| N-methyltransferase (ISS) [Ostreococcus tauri]
Length=492

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 102/210 (49%), Gaps = 28/210 (13%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAG-----------VES  658
            I L YG L+ND   LDYGF+V  N +D ++LR+D  L++ A    G           V+ 
Sbjct  277  IELCYGELSNDELFLDYGFIVEDNAFDTVKLRWDLKLIELAREIGGLATAPIGAAAAVDD  336

Query  657  PNFSSPS--------PWQREILSQLNLD---GENPDLKVTIGGPELVEGRLMAALRAFLS  511
             + SS S        P+Q++ L ++ L    G N +L +   G ++++ + +A LR   S
Sbjct  337  EHGSSTSIDDVVLLAPFQKQALERIGLSADGGGNVELNIRASG-DVMDKKALAGLRVLYS  395

Query  510  NDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK  331
                     +      +       + T  E+ ALRT  AL  +ALG+FPT + ED   L+
Sbjct  396  KTAAEASRAADAPYGEIGAR---VVSTDVEIKALRTSMALAALALGNFPTTLAEDRESLR  452

Query  330  QNVSAT--TDLAIRFRIQKKSVIIDVMRDL  247
                A+    LA+R+R++KK ++I  M  L
Sbjct  453  DGSVASPQARLAVRYRVEKKKILIACMARL  482



>emb|CEG00242.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=527

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 104/215 (48%), Gaps = 28/215 (13%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAG-----------VES  658
            I L YG L+ND   LDYGF+V  N +D ++LR+D  L++ A    G           V+ 
Sbjct  312  IELCYGELSNDELFLDYGFIVEDNAFDTVKLRWDLKLIELAREIGGLATAPIGAAAAVDD  371

Query  657  PNFSSPS--------PWQREILSQLNLD---GENPDLKVTIGGPELVEGRLMAALRAFLS  511
             + SS S        P+Q++ L ++ L    G N +L +   G ++++ + +A LR   S
Sbjct  372  EHGSSTSIDDVVLLAPFQKQALERIGLSADGGGNVELNIRASG-DVMDKKALAGLRVLYS  430

Query  510  NDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK  331
                     +      +       + T  E+ ALRT  AL  +ALG+FPT + ED   L+
Sbjct  431  KTAAEASRAADAPYGEIGAR---VVSTDVEIKALRTSMALAALALGNFPTTLAEDRESLR  487

Query  330  QNVSAT--TDLAIRFRIQKKSVIIDVMRDLTRRVK  232
                A+    LA+R+R++KK ++I  M  L   ++
Sbjct  488  DGSVASPQARLAVRYRVEKKKILIACMARLNASIE  522



>ref|XP_004513627.1| PREDICTED: uncharacterized protein LOC101503917 [Cicer arietinum]
Length=228

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFS  646
            + L YGCL+NDLFLL YGF++ SNPYDCIE +YD ALLDAAS+AA V SP F+
Sbjct  175  LLLCYGCLSNDLFLLGYGFMIHSNPYDCIEFKYDGALLDAASIAARVSSPKFN  227



>ref|XP_005843772.1| hypothetical protein CHLNCDRAFT_139898 [Chlorella variabilis]
 gb|EFN51670.1| hypothetical protein CHLNCDRAFT_139898 [Chlorella variabilis]
Length=543

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 72/250 (29%), Positives = 114/250 (46%), Gaps = 68/250 (27%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFS-------  646
            + ++YG L+ND  L+DYGF+VP NP+D ++LR+D  L++AA   AGV     +       
Sbjct  259  VLISYGALSNDFLLMDYGFIVPGNPHDTVQLRFDRGLIEAAKAVAGVGCTGGALDDGGAE  318

Query  645  -SPSP-WQREILSQLNLDGENPDLKVTI-------------------------GGPELVE  547
              P P WQ++ L+ L L G   + +VTI                          GP  V+
Sbjct  319  LPPLPAWQQQALASLQLAGPGANTEVTIRRQAARGGGNGSGSGSRNGGGEAAAEGP--VD  376

Query  546  GRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLG-------TANEVAALRTVTALC  388
             RL+A +R   +    ++        K+ SVE    LG        A E+AALR +T LC
Sbjct  377  PRLLAGVRVLCAPSAAALGG------KAASVE---RLGRWDAPLAPAAELAALRALTGLC  427

Query  387  VIALGHF----------------PTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVM  256
             IAL  F                P    E     ++ +     LA+RFR++KK ++++ +
Sbjct  428  AIALSQFRGSLEEDAALLAAAAAPAGGQEAAQQAQRQLGEDEQLAVRFRMEKKQLLLEAL  487

Query  255  RDLTRRVKLL  226
              ++ R++ L
Sbjct  488  GTVSHRIQQL  497



>ref|XP_011399030.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
 gb|KFM26134.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
Length=370

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 87/198 (44%), Gaps = 65/198 (33%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYG----FVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPS  637
            + LNYG L+ND   LDYG    F+VP NP+D ++L                         
Sbjct  231  VSLNYGPLSNDDLFLDYGTVDGFIVPGNPHDDVQL-------------------------  265

Query  636  PWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLS  457
                    Q +L                    L+ A RA L  ++E +      TL++L 
Sbjct  266  --------QFDLS-------------------LIEAARA-LPAELEGL------TLRALG  291

Query  456  VEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMED-EALLKQNVSATTDLAIRFRIQK  280
             +   PL   +E  ALRT+T LC I+L HFPT   ED E L K  +S    LA++FR++K
Sbjct  292  -DWASPLSLVSEAKALRTLTGLCAISLSHFPTTAEEDAEVLRKGGMSGPMALAVQFRLEK  350

Query  279  KSVIIDVMRDLTRRVKLL  226
            K ++   ++    R++ L
Sbjct  351  KRILDAGIKACAARIREL  368



>emb|CBJ32910.1| conserved unknown protein [Ectocarpus siliculosus]
Length=247

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 88/199 (44%), Gaps = 25/199 (13%)
 Frame = -1

Query  828  RTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNF  649
            R +     + ++YG  +ND  L  YGFV   NP D   +     L+D  S   G +S   
Sbjct  44   RGWTAGEQVLISYGPRSNDHLLRRYGFVEQDNPNDVYRI---TGLIDKLSDVLGKDSVRV  100

Query  648  SSPSPWQREILSQLNLDGENPDLK----VTIGGPELV----EGRLMAALR-AFLSNDMES  496
                   RE   +L   G+N + +    VT+G   L+    EGR+M   R A + +D   
Sbjct  101  ------LRESGGKLGTTGDNAEGRPVESVTVGRSGLLGEKEEGRVMPVFRLAVVKDDQLP  154

Query  495  VRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK---QN  325
                +  +LK  S E  P    ANE AA   +  LC+     F T + EDEA L     +
Sbjct  155  EGKAAGISLKDFSNEISP----ANEAAARDALRKLCIKEREGFATTLAEDEAYLSSLGNS  210

Query  324  VSATTDLAIRFRIQKKSVI  268
            + A   +A  FR++KK V+
Sbjct  211  LGAQKRVAFSFRMEKKRVL  229



>emb|CBJ25550.1| set domain protein [Ectocarpus siliculosus]
Length=694

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 72/160 (45%), Gaps = 14/160 (9%)
 Frame = -1

Query  780  NNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSP------SPWQREI  619
            +N+  L +YGFV  +   +    R++  +L AA + AG+    F S        PWQ+  
Sbjct  360  SNERRLCNYGFVDINRRRERNHFRFEKKILRAARIHAGILDEQFGSKFEQDGLEPWQQRA  419

Query  618  LSQLNLDGENPDLKVTIGGPEL-----VEGRLMAALRAFLSNDMESVRNHSMDTLKSLSV  454
            L +L LDG   DL V +GG        V+GRL+AALR   +    S R     T+  LS 
Sbjct  420  LIELKLDGPEQDLTVYLGGDSTSGRLPVDGRLLAALRVMFTR---SRREMEGKTVSELSR  476

Query  453  EPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALL  334
                 L    E   L TV  L  +    +P+   +DE +L
Sbjct  477  YKTGKLSDYVERRVLATVLGLVSVYGQRWPSTQEQDEEIL  516



>ref|XP_001417016.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95309.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=390

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 79/201 (39%), Gaps = 31/201 (15%)
 Frame = -1

Query  828  RTYPTERCIXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDA----ASMAAGVE  661
            R Y T   + ++YG LNND  +  YGFV   N  D          L A       A G +
Sbjct  208  REYKTGEEVFISYGVLNNDELITRYGFVDSDNVADVYRFEGFLPFLQANHEPMKRALGAD  267

Query  660  SPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV-----EGRLMAALRAFLSNDMES  496
            S   ++             L   +P+L   +     +     E +L+ ALRA L+   E 
Sbjct  268  SKRLAT-------------LKRTHPELDEALWNANFISDGTAEDKLLWALRAVLATPEEF  314

Query  495  VRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSA  316
             + + +D  K          G A E  A   + A     L  +PT + ED   LK + S 
Sbjct  315  AKANGVDGFK--------LGGGAPEKRAADAIQAAVSARLAEYPTTLEEDAEQLK-SASG  365

Query  315  TTDLAIRFRIQKKSVIIDVMR  253
                AI FRI+KK ++ D  R
Sbjct  366  NMATAIAFRIRKKRILSDASR  386



>ref|XP_003062743.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53562.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 114/322 (35%), Gaps = 122/322 (38%)
 Frame = -1

Query  807  CIXLNYGCLNNDLFLLDYGFV-----------------------VPSNPYDCIELRYDPA  697
             + L YG LNND FLLDYGFV                       +  NP+D   LR+D  
Sbjct  297  AVTLCYGALNNDAFLLDYGFVPRGGVLGEGEDGTSTVANFRDDAIDLNPHDSAGLRWDLG  356

Query  696  LLDAASMAAGVESPNFSSPS----------------------PWQREILSQLNLD-----  598
            LL+AA   AG+ +  F   +                      PWQR  L++L L+     
Sbjct  357  LLEAAREVAGLSATPFGVSTGATVRGRGGGATADDGAGDPFAPWQRRALAELRLERGPVG  416

Query  597  GEN------PDLKVTI-GGPEL-VEGRLMAALRAFLSNDMESVRNHSMD-----------  475
            GE+      PD ++ +   P   ++ R++A +R   ++  E +                 
Sbjct  417  GEDGTSTVAPDQEILVRADPRSPIDHRMLAGVRVLYASKPEDLLGRGGGRGGQGEEDGTS  476

Query  474  --------------------TLKSLSVEPQPPLGTANEVAALRTV--------TALC---  388
                                T + L    + PL    E  ALR V        TA C   
Sbjct  477  TVATNTNTSTNANAQRATPLTQEELGDLWRSPLDRTREAYALRRVLLHTGPHTTATCQAA  536

Query  387  -VIALGHFPTKIMEDEALLK-------QNVSATTDL--------------AIRFRIQKKS  274
              +ALG+F T + ED   L        Q+  A                  AI FR+ KK 
Sbjct  537  LALALGNFQTTLREDAVELAKLRGERDQSAGAAPGQLGQLGSGERNDAICAIEFRMGKKE  596

Query  273  VIIDVMRDLTRRVKLLLSKESA  208
            VI   M  +  R++ +L+  +A
Sbjct  597  VIKRGMEAIDARLRAVLAAPAA  618



>ref|XP_005716618.1| unnamed protein product [Chondrus crispus]
 emb|CDF36799.1| unnamed protein product [Chondrus crispus]
Length=333

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 94/218 (43%), Gaps = 41/218 (19%)
 Frame = -1

Query  804  IXLNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQR  625
            + ++YG L ND   L YGFV   NPYD  E+     L++  +    V   N       + 
Sbjct  107  VLVSYGELTNDDLYLLYGFVQAGNPYDVFEVE---DLVEWVAEHHSVREWNLFDA---KL  160

Query  624  EILSQLNL--DGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLK----S  463
             +L ++ L  +G    L V+   P+LV     AALR  L++  E  R  +M   +     
Sbjct  161  RLLERIGLCYEGRKFHLSVSQIDPDLV-----AALRILLADVNEFRRARAMIEFEEPRDE  215

Query  462  LSVE------PQ---PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATT  310
            LSV       PQ    PL  +NE      + + C   L  FPT I  DE ++  + +++ 
Sbjct  216  LSVGGFKREVPQGWFEPLTASNERTVWHRIASKCSRTLEEFPTSIEFDEEMIILHAASSV  275

Query  309  DL------AIRFRIQKKSVIIDVMRDLTRRVKLLLSKE  214
                    ++ FR++KK ++         R   LL+KE
Sbjct  276  PSDPVHANSLLFRVEKKRIL---------RAAALLAKE  304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1792753749675