BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015H06

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796749.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    137   1e-33   Nicotiana sylvestris
ref|XP_009796748.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    137   2e-33   Nicotiana sylvestris
ref|XP_009611338.1|  PREDICTED: F-box/LRR-repeat protein 13 isofo...    135   6e-33   Nicotiana tomentosiformis
ref|XP_009611340.1|  PREDICTED: F-box/LRR-repeat protein 13 isofo...    135   9e-33   Nicotiana tomentosiformis
emb|CDO98185.1|  unnamed protein product                                129   7e-31   Coffea canephora [robusta coffee]
ref|XP_007023314.1|  Leucine-rich repeat family protein isoform 1       127   3e-30   
ref|XP_004235905.1|  PREDICTED: putative adenylate cyclase regula...    127   3e-30   Solanum lycopersicum
ref|XP_006341392.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    127   5e-30   Solanum tuberosum [potatoes]
ref|XP_011073379.1|  PREDICTED: F-box/LRR-repeat protein 14             126   1e-29   Sesamum indicum [beniseed]
ref|XP_004135866.1|  PREDICTED: F-box/LRR-repeat protein 14-like        124   8e-29   Cucumis sativus [cucumbers]
ref|XP_008461146.1|  PREDICTED: F-box/LRR-repeat protein 14             123   1e-28   Cucumis melo [Oriental melon]
ref|XP_010654848.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    120   7e-28   Vitis vinifera
ref|XP_002517700.1|  F-box/LRR-repeat protein, putative                 120   8e-28   
gb|KDO52284.1|  hypothetical protein CISIN_1g009672mg                   119   9e-28   Citrus sinensis [apfelsine]
ref|XP_002270172.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    120   9e-28   Vitis vinifera
gb|KHG20419.1|  Leucine-rich repeat-containing 18                       116   1e-27   Gossypium arboreum [tree cotton]
gb|KDO52279.1|  hypothetical protein CISIN_1g009672mg                   119   1e-27   Citrus sinensis [apfelsine]
gb|KDO52278.1|  hypothetical protein CISIN_1g009672mg                   119   1e-27   Citrus sinensis [apfelsine]
gb|KDO52280.1|  hypothetical protein CISIN_1g009672mg                   119   2e-27   Citrus sinensis [apfelsine]
gb|KDO52276.1|  hypothetical protein CISIN_1g009672mg                   119   2e-27   Citrus sinensis [apfelsine]
gb|KDO52275.1|  hypothetical protein CISIN_1g009672mg                   119   2e-27   Citrus sinensis [apfelsine]
gb|KDP37033.1|  hypothetical protein JCGZ_06089                         119   3e-27   Jatropha curcas
ref|XP_006427460.1|  hypothetical protein CICLE_v10025249mg             119   4e-27   Citrus clementina [clementine]
ref|XP_006492112.1|  PREDICTED: LRR receptor-like serine/threonin...    119   5e-27   Citrus sinensis [apfelsine]
gb|KJB70662.1|  hypothetical protein B456_011G085800                    116   1e-26   Gossypium raimondii
gb|KJB70659.1|  hypothetical protein B456_011G085800                    116   4e-26   Gossypium raimondii
gb|KJB70657.1|  hypothetical protein B456_011G085800                    116   5e-26   Gossypium raimondii
gb|KEH28672.1|  F-box/LRR-like protein                                  114   5e-26   Medicago truncatula
gb|KJB70660.1|  hypothetical protein B456_011G085800                    115   6e-26   Gossypium raimondii
gb|AES86545.2|  F-box/LRR-like protein                                  114   6e-26   Medicago truncatula
ref|XP_008228736.1|  PREDICTED: F-box/LRR-repeat protein 14             115   8e-26   Prunus mume [ume]
ref|XP_011020241.1|  PREDICTED: F-box/LRR-repeat protein 14             115   1e-25   Populus euphratica
ref|XP_006416883.1|  hypothetical protein EUTSA_v10007169mg             115   1e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010097169.1|  hypothetical protein L484_025715                   114   2e-25   Morus notabilis
ref|XP_004506963.1|  PREDICTED: internalin-A-like isoform X2            114   2e-25   
ref|XP_010532117.1|  PREDICTED: F-box/LRR-repeat protein 16 isofo...    114   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_010532116.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    114   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_004506962.1|  PREDICTED: internalin-A-like isoform X1            114   3e-25   Cicer arietinum [garbanzo]
ref|XP_010532114.1|  PREDICTED: F-box/LRR-repeat protein 16 isofo...    114   3e-25   Tarenaya hassleriana [spider flower]
gb|KHN38005.1|  F-box/LRR-repeat protein 14                             114   3e-25   Glycine soja [wild soybean]
ref|XP_010532115.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...    114   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_010532111.1|  PREDICTED: F-box/LRR-repeat protein 16 isofo...    114   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_010532113.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...    114   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_003604348.1|  F-box/LRR-repeat protein                           113   4e-25   
ref|XP_003528299.1|  PREDICTED: leucine-rich repeats and immunogl...    113   5e-25   Glycine max [soybeans]
ref|XP_003599715.1|  F-box/LRR-repeat protein                           113   5e-25   
gb|KHN01311.1|  F-box/LRR-repeat protein 14                             113   5e-25   Glycine soja [wild soybean]
ref|XP_008372697.1|  PREDICTED: toll-like receptor 13                   113   6e-25   
ref|XP_009338496.1|  PREDICTED: F-box/LRR-repeat protein 13-like        113   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009348313.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    113   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009348314.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    113   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_009148961.1|  PREDICTED: F-box/LRR-repeat protein 14             112   7e-25   Brassica rapa
emb|CAN74892.1|  hypothetical protein VITISV_002002                     110   7e-25   Vitis vinifera
ref|XP_006583114.1|  PREDICTED: leucine-rich repeats and immunogl...    113   9e-25   
emb|CDY36583.1|  BnaA06g10360D                                          112   1e-24   Brassica napus [oilseed rape]
emb|CDY33388.1|  BnaC05g11950D                                          112   1e-24   Brassica napus [oilseed rape]
ref|XP_002262830.2|  PREDICTED: F-box/LRR-repeat protein 14             112   1e-24   Vitis vinifera
ref|XP_010497352.1|  PREDICTED: F-box/LRR-repeat protein 2-like i...    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010476663.1|  PREDICTED: F-box/LRR-repeat protein 2-like i...    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010497346.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010459109.1|  PREDICTED: F-box/LRR-repeat protein 14-like        112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010476662.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    112   1e-24   Camelina sativa [gold-of-pleasure]
gb|ACB87911.1|  F-box-containing protein 1                              111   2e-24   Malus domestica [apple tree]
ref|XP_008361107.1|  PREDICTED: F-box/LRR-repeat protein 13-like        111   2e-24   
gb|EPS62263.1|  hypothetical protein M569_12528                         107   2e-24   Genlisea aurea
ref|XP_006305845.1|  hypothetical protein CARUB_v10010899mg             111   2e-24   Capsella rubella
ref|XP_010537926.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_002308980.2|  leucine-rich repeat family protein                 110   4e-24   Populus trichocarpa [western balsam poplar]
ref|XP_007204208.1|  hypothetical protein PRUPE_ppa003392mg             110   6e-24   Prunus persica
ref|XP_003542662.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    110   6e-24   
ref|XP_008242881.1|  PREDICTED: F-box/LRR-repeat protein 13-like        110   6e-24   Prunus mume [ume]
gb|ACJ85662.1|  unknown                                                 108   7e-24   Medicago truncatula
ref|XP_010250286.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    109   9e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010250285.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    109   1e-23   Nelumbo nucifera [Indian lotus]
gb|KDP30209.1|  hypothetical protein JCGZ_16991                         109   1e-23   Jatropha curcas
gb|KHN47120.1|  F-box/LRR-repeat protein 14                             110   1e-23   Glycine soja [wild soybean]
ref|XP_007135773.1|  hypothetical protein PHAVU_010G157600g             109   1e-23   Phaseolus vulgaris [French bean]
ref|XP_009338390.1|  PREDICTED: F-box/LRR-repeat protein 16-like        109   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_009358539.1|  PREDICTED: F-box/LRR-repeat protein 16-like        109   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_010244895.1|  PREDICTED: F-box/LRR-repeat protein 13-like        109   1e-23   Nelumbo nucifera [Indian lotus]
gb|KJB23678.1|  hypothetical protein B456_004G109300                    108   1e-23   Gossypium raimondii
ref|XP_004303269.1|  PREDICTED: F-box/LRR-repeat protein 13             108   2e-23   Fragaria vesca subsp. vesca
gb|KHG11502.1|  F-box/LRR-repeat 14                                     108   2e-23   Gossypium arboreum [tree cotton]
ref|XP_007013624.1|  Binding protein, putative                          108   2e-23   
gb|KJB23677.1|  hypothetical protein B456_004G109300                    108   3e-23   Gossypium raimondii
gb|KHN15024.1|  F-box/LRR-repeat protein 14                             108   3e-23   Glycine soja [wild soybean]
ref|XP_006600722.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    108   3e-23   Glycine max [soybeans]
ref|XP_003549716.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    108   3e-23   Glycine max [soybeans]
gb|AAK62436.1|AF386991_1  Unknown protein                               105   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384922.1|  PREDICTED: F-box/LRR-repeat protein 14-like        107   4e-23   Malus domestica [apple tree]
ref|XP_006595170.1|  PREDICTED: EIN3-binding F-box protein 1-like...    107   4e-23   Glycine max [soybeans]
gb|AFK38491.1|  unknown                                                 107   5e-23   Medicago truncatula
ref|XP_003543689.1|  PREDICTED: EIN3-binding F-box protein 1-like...    107   6e-23   Glycine max [soybeans]
ref|XP_003609481.1|  F-box/LRR-repeat protein                           107   8e-23   Medicago truncatula
gb|KHN44196.1|  F-box/LRR-repeat protein 14                             107   9e-23   Glycine soja [wild soybean]
ref|XP_007155092.1|  hypothetical protein PHAVU_003G172400g             106   1e-22   Phaseolus vulgaris [French bean]
ref|XP_002890123.1|  leucine-rich repeat family protein                 105   2e-22   
ref|XP_009363926.1|  PREDICTED: F-box/LRR-repeat protein 14-like        105   2e-22   
gb|AAK28636.1|AF360339_1  unknown protein                               105   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563980.2|  leucine-rich repeat-containing protein                105   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAF82144.1|AC034256_8  Contains similarity to F-box protein FB...    105   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21683.1|  hypothetical protein MIMGU_mgv1a003547mg                105   4e-22   Erythranthe guttata [common monkey flower]
gb|KCW53861.1|  hypothetical protein EUGRSUZ_J03087                     105   6e-22   Eucalyptus grandis [rose gum]
ref|XP_010033984.1|  PREDICTED: F-box/LRR-repeat protein 14             104   6e-22   Eucalyptus grandis [rose gum]
gb|KCW53858.1|  hypothetical protein EUGRSUZ_J03087                     104   7e-22   Eucalyptus grandis [rose gum]
gb|KCW53859.1|  hypothetical protein EUGRSUZ_J03087                     104   8e-22   Eucalyptus grandis [rose gum]
gb|KCW53860.1|  hypothetical protein EUGRSUZ_J03087                     104   8e-22   Eucalyptus grandis [rose gum]
gb|KCW53857.1|  hypothetical protein EUGRSUZ_J03087                     104   8e-22   Eucalyptus grandis [rose gum]
ref|XP_010687833.1|  PREDICTED: F-box/LRR-repeat protein 14             103   9e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009403193.1|  PREDICTED: F-box/LRR-repeat protein 14             103   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401378.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    103   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401377.1|  PREDICTED: leucine-rich repeat-containing G-...    103   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652480.1|  PREDICTED: F-box/LRR-repeat protein 14-like        102   2e-21   Oryza brachyantha
dbj|BAJ98524.1|  predicted protein                                      102   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAH67587.1|  OSIGBa0112M24.4                                        102   3e-21   Oryza sativa [red rice]
ref|XP_008801889.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    102   4e-21   Phoenix dactylifera
gb|AFK48637.1|  unknown                                               95.1    4e-21   Lotus japonicus
ref|XP_004508414.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    101   6e-21   Cicer arietinum [garbanzo]
ref|XP_010906010.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    100   8e-21   
ref|XP_010323274.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    101   8e-21   Solanum lycopersicum
ref|XP_010323273.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    101   8e-21   Solanum lycopersicum
ref|XP_010906009.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    101   8e-21   Elaeis guineensis
ref|XP_006852826.1|  hypothetical protein AMTR_s00033p00180120          101   9e-21   Amborella trichopoda
ref|XP_004242726.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-20   Solanum lycopersicum
ref|XP_006359507.1|  PREDICTED: F-box/LRR-repeat protein 14-like        100   1e-20   Solanum tuberosum [potatoes]
emb|CAE02935.3|  OSJNBa0014K14.7                                      99.8    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053240.1|  Os04g0503500                                     99.8    3e-20   
ref|XP_011457338.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...  99.4    4e-20   Fragaria vesca subsp. vesca
ref|XP_004287248.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...  99.4    4e-20   Fragaria vesca subsp. vesca
ref|XP_003580088.1|  PREDICTED: leucine-rich repeat-containing G-...  98.6    7e-20   Brachypodium distachyon [annual false brome]
ref|XP_006647506.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  98.2    1e-19   Oryza brachyantha
gb|EMS49495.1|  hypothetical protein TRIUR3_13085                     97.4    1e-19   Triticum urartu
ref|XP_003575347.1|  PREDICTED: F-box/LRR-repeat protein 14-like      98.2    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_002532313.1|  protein binding protein, putative                97.4    2e-19   
gb|EAY86666.1|  hypothetical protein OsI_08050                        96.7    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_008813122.1|  PREDICTED: F-box/LRR-repeat protein 14-like      96.3    4e-19   Phoenix dactylifera
gb|AAN62335.1|AF506028_2  CTV.1                                       92.4    4e-19   Citrus trifoliata [hardy orange]
ref|XP_010110472.1|  hypothetical protein L484_005452                 96.3    5e-19   
ref|NP_001047418.1|  Os02g0613200                                     96.3    5e-19   
gb|EPS69100.1|  hypothetical protein M569_05667                       95.9    6e-19   Genlisea aurea
gb|ADM75223.1|  leucine rich repeat-like protein                      90.1    9e-19   Picea sitchensis
ref|XP_004953091.1|  PREDICTED: putative adenylate cyclase regula...  94.4    2e-18   Setaria italica
gb|ADM75240.1|  leucine rich repeat-like protein                      89.0    2e-18   Picea sitchensis
gb|ADM75221.1|  leucine rich repeat-like protein                      89.0    2e-18   Picea sitchensis
ref|XP_004978117.1|  PREDICTED: F-box/LRR-repeat protein 13-like      94.0    3e-18   
ref|XP_002448130.1|  hypothetical protein SORBIDRAFT_06g021780        93.6    4e-18   Sorghum bicolor [broomcorn]
tpg|DAA37066.1|  TPA: hypothetical protein ZEAMMB73_067914            87.8    4e-18   
ref|NP_001147302.1|  regulatory subunit                               90.5    4e-17   Zea mays [maize]
ref|NP_001141453.1|  uncharacterized protein LOC100273563             89.7    8e-17   Zea mays [maize]
gb|ACG43200.1|  regulatory subunit                                    89.0    1e-16   Zea mays [maize]
gb|EMT00676.1|  hypothetical protein F775_32177                       88.2    3e-16   
gb|KDO52277.1|  hypothetical protein CISIN_1g009672mg                 87.4    3e-16   Citrus sinensis [apfelsine]
ref|XP_009762906.1|  PREDICTED: toll-like receptor 13 isoform X3      87.0    5e-16   Nicotiana sylvestris
ref|XP_009762905.1|  PREDICTED: toll-like receptor 13 isoform X2      87.0    5e-16   Nicotiana sylvestris
ref|XP_009762904.1|  PREDICTED: toll-like receptor 13 isoform X1      87.0    5e-16   Nicotiana sylvestris
emb|CDP10490.1|  unnamed protein product                              86.7    7e-16   Coffea canephora [robusta coffee]
ref|XP_002980094.1|  hypothetical protein SELMODRAFT_419616           84.3    5e-15   Selaginella moellendorffii
ref|XP_010313811.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  81.6    3e-14   Solanum lycopersicum
ref|XP_010313815.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  81.6    3e-14   Solanum lycopersicum
ref|XP_009621391.1|  PREDICTED: EIN3-binding F-box protein 1-like...  80.9    7e-14   Nicotiana tomentosiformis
ref|XP_009621390.1|  PREDICTED: EIN3-binding F-box protein 1-like...  80.9    7e-14   Nicotiana tomentosiformis
ref|XP_009595107.1|  PREDICTED: F-box/LRR-repeat protein 14-like      79.3    2e-13   Nicotiana tomentosiformis
ref|XP_009796216.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  77.0    7e-13   Nicotiana sylvestris
ref|XP_009796214.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  77.4    8e-13   Nicotiana sylvestris
ref|XP_009796213.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  77.0    1e-12   Nicotiana sylvestris
ref|XP_001758973.1|  predicted protein                                75.9    2e-12   
gb|KDO52281.1|  hypothetical protein CISIN_1g009672mg                 75.5    3e-12   Citrus sinensis [apfelsine]
ref|XP_001780819.1|  predicted protein                                73.9    1e-11   
gb|ACJ85778.1|  unknown                                               64.3    4e-10   Medicago truncatula
gb|KDO52282.1|  hypothetical protein CISIN_1g009672mg                 65.5    6e-09   Citrus sinensis [apfelsine]
gb|AIE39571.1|  F-box/LRR repeat protein                              57.0    2e-07   Humulus lupulus [common hop]
ref|XP_006427462.1|  hypothetical protein CICLE_v10025249mg           58.9    1e-06   Citrus clementina [clementine]
ref|XP_007215815.1|  hypothetical protein PRUPE_ppa004098mg           54.7    3e-05   Prunus persica



>ref|XP_009796749.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Nicotiana 
sylvestris]
Length=561

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL+HFKNLRSLEICGGGLTDAGVKNIKDLT+L LLNLSQNSHLTDKSLEAISGLT 
Sbjct  445  SGTSYLRHFKNLRSLEICGGGLTDAGVKNIKDLTSLTLLNLSQNSHLTDKSLEAISGLTQ  504

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGLQHLK LK LKSLTLESCKVTANDIKKLQST+LPNLVNYRPE
Sbjct  505  LVSLNVSNSRITSAGLQHLKQLKNLKSLTLESCKVTANDIKKLQSTELPNLVNYRPE  561



>ref|XP_009796748.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Nicotiana 
sylvestris]
Length=577

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL+HFKNLRSLEICGGGLTDAGVKNIKDLT+L LLNLSQNSHLTDKSLEAISGLT 
Sbjct  461  SGTSYLRHFKNLRSLEICGGGLTDAGVKNIKDLTSLTLLNLSQNSHLTDKSLEAISGLTQ  520

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGLQHLK LK LKSLTLESCKVTANDIKKLQST+LPNLVNYRPE
Sbjct  521  LVSLNVSNSRITSAGLQHLKQLKNLKSLTLESCKVTANDIKKLQSTELPNLVNYRPE  577



>ref|XP_009611338.1| PREDICTED: F-box/LRR-repeat protein 13 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611339.1| PREDICTED: F-box/LRR-repeat protein 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=590

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL+HFKNLRSLEICGGGLTD GVKNIKDLT+L LLNLSQNSHLTDKSLEAISGLT 
Sbjct  474  SGTSYLRHFKNLRSLEICGGGLTDVGVKNIKDLTSLTLLNLSQNSHLTDKSLEAISGLTQ  533

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGLQHLK LK LKSLTLESCKVTANDIKKLQST+LPNLVNYRPE
Sbjct  534  LVSLNVSNSRITSAGLQHLKQLKNLKSLTLESCKVTANDIKKLQSTELPNLVNYRPE  590



>ref|XP_009611340.1| PREDICTED: F-box/LRR-repeat protein 13 isoform X2 [Nicotiana 
tomentosiformis]
Length=577

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL+HFKNLRSLEICGGGLTD GVKNIKDLT+L LLNLSQNSHLTDKSLEAISGLT 
Sbjct  461  SGTSYLRHFKNLRSLEICGGGLTDVGVKNIKDLTSLTLLNLSQNSHLTDKSLEAISGLTQ  520

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGLQHLK LK LKSLTLESCKVTANDIKKLQST+LPNLVNYRPE
Sbjct  521  LVSLNVSNSRITSAGLQHLKQLKNLKSLTLESCKVTANDIKKLQSTELPNLVNYRPE  577



>emb|CDO98185.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYLK F+NLRSLEICGGGLTDAGVKNIKDLT+L LLNLSQNSHLTDKSLEAISGLT 
Sbjct  462  SGTNYLKCFRNLRSLEICGGGLTDAGVKNIKDLTSLALLNLSQNSHLTDKSLEAISGLTQ  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGLQHLKPLK LKSLTLESCKVTAND+KKLQ+T LPNLVN+RPE
Sbjct  522  LVSLNVSNSRVTSAGLQHLKPLKNLKSLTLESCKVTANDLKKLQATHLPNLVNFRPE  578



>ref|XP_007023314.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY25936.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao]
Length=574

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYL++FKNLRSLEICGGGLTDAGVKNIKDL++L+LLNLSQN +LTDK+LE ISGLT 
Sbjct  458  SGTNYLRNFKNLRSLEICGGGLTDAGVKNIKDLSSLSLLNLSQNCNLTDKTLEMISGLTG  517

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDI+KLQS DLPNLVN+RPE
Sbjct  518  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIRKLQSADLPNLVNFRPE  574



>ref|XP_004235905.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
 ref|XP_010318712.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
 ref|XP_010318713.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
 ref|XP_010318714.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
Length=577

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL++FKNLRSLEICGGGLTDAGVKNIKDLT+L LLNLSQNSHLTDKSLE ISGLT 
Sbjct  461  SGTSYLRYFKNLRSLEICGGGLTDAGVKNIKDLTSLTLLNLSQNSHLTDKSLEVISGLTQ  520

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+T+ GLQHLK LK LKSLTLESCKVTANDI+KLQST+LPNLVNYRPE
Sbjct  521  LVSLNVSNSRVTNMGLQHLKQLKNLKSLTLESCKVTANDIRKLQSTELPNLVNYRPE  577



>ref|XP_006341392.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006341393.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006341394.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X3 [Solanum 
tuberosum]
Length=577

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL++FKNLRSLEICGGGLTDAGVKNIKDLT+L LLNLSQNSHLTDKSLEAISGLT 
Sbjct  461  SGTSYLRYFKNLRSLEICGGGLTDAGVKNIKDLTSLTLLNLSQNSHLTDKSLEAISGLTQ  520

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TS GLQHLK LK LKSLTLESCKVTANDI+KLQST+L NLVNYRPE
Sbjct  521  LVSLNVSNSRVTSTGLQHLKQLKNLKSLTLESCKVTANDIRKLQSTELSNLVNYRPE  577



>ref|XP_011073379.1| PREDICTED: F-box/LRR-repeat protein 14 [Sesamum indicum]
Length=578

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYL+ FKNLRSLEICGGGLTDAGVKNIKDLT+L LLNLSQN+HLTD+SLE ISGL  
Sbjct  462  SGTNYLRSFKNLRSLEICGGGLTDAGVKNIKDLTSLTLLNLSQNNHLTDRSLEWISGLIQ  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGLQHLK LK LKSLTLESCKVTANDIKKLQS+DLPNLV++RPE
Sbjct  522  LVSLNVSNSRVTSAGLQHLKSLKNLKSLTLESCKVTANDIKKLQSSDLPNLVSFRPE  578



>ref|XP_004135866.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus]
 ref|XP_004163550.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus]
 gb|KGN45244.1| hypothetical protein Csa_7G432250 [Cucumis sativus]
Length=578

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYL++FKNL+SLEICGGGLTDAGVKNIKDL++L +LNLSQN +LTDKSLE ISGLT 
Sbjct  462  SGTNYLRNFKNLQSLEICGGGLTDAGVKNIKDLSSLMVLNLSQNGNLTDKSLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNSRITSAGL+HLK LK LK LTLE+C+V+A+DIKKLQSTDLPNLV++RPE
Sbjct  522  LVSLNISNSRITSAGLRHLKTLKNLKQLTLEACRVSASDIKKLQSTDLPNLVSFRPE  578



>ref|XP_008461146.1| PREDICTED: F-box/LRR-repeat protein 14 [Cucumis melo]
 ref|XP_008461147.1| PREDICTED: F-box/LRR-repeat protein 14 [Cucumis melo]
 ref|XP_008461148.1| PREDICTED: F-box/LRR-repeat protein 14 [Cucumis melo]
Length=578

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYL++FKNL+SLEICGGGLTDAGVKNIKDL++L +LNLSQN +LTDKSLE ISGLT 
Sbjct  462  SGTNYLRNFKNLQSLEICGGGLTDAGVKNIKDLSSLMVLNLSQNGNLTDKSLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNSRITSAGL+HLK LK LK LTLE+C+V+A+DIKKLQSTDLPNLV++RPE
Sbjct  522  LVSLNISNSRITSAGLRHLKTLKNLKQLTLEACRVSASDIKKLQSTDLPNLVSFRPE  578



>ref|XP_010654848.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Vitis vinifera]
Length=551

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL++FKNL+SLEICGGGLTDAGVKNIKDLT L +LNLSQN +LTDKSLE ISGLT+
Sbjct  435  SGTSYLRNFKNLQSLEICGGGLTDAGVKNIKDLTCLTVLNLSQNCNLTDKSLELISGLTA  494

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSL+VSNSRIT+AGLQHLK LK LKSLTL+SCKVT NDIKKLQS DLPNLV++RPE
Sbjct  495  LVSLSVSNSRITNAGLQHLKQLKNLKSLTLDSCKVTVNDIKKLQSKDLPNLVSFRPE  551



>ref|XP_002517700.1| F-box/LRR-repeat protein, putative [Ricinus communis]
 gb|EEF44864.1| F-box/LRR-repeat protein, putative [Ricinus communis]
Length=529

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL++FKNL+SLEICGGGLTDAG++NIKDL++L+LLNLSQN +LTDKSLE ISGLT 
Sbjct  413  SGTHYLRNFKNLQSLEICGGGLTDAGIRNIKDLSSLSLLNLSQNCNLTDKSLELISGLTG  472

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGLQHLKPLK LKSLTLESCKVTA DIKKLQSTDLP LV++RPE
Sbjct  473  LVSLNVSNSRITSAGLQHLKPLKNLKSLTLESCKVTATDIKKLQSTDLPQLVSFRPE  529



>gb|KDO52284.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=406

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  290  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  349

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  350  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  406



>ref|XP_002270172.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Vitis vinifera]
 ref|XP_010654847.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Vitis vinifera]
 emb|CBI36423.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL++FKNL+SLEICGGGLTDAGVKNIKDLT L +LNLSQN +LTDKSLE ISGLT+
Sbjct  462  SGTSYLRNFKNLQSLEICGGGLTDAGVKNIKDLTCLTVLNLSQNCNLTDKSLELISGLTA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSL+VSNSRIT+AGLQHLK LK LKSLTL+SCKVT NDIKKLQS DLPNLV++RPE
Sbjct  522  LVSLSVSNSRITNAGLQHLKQLKNLKSLTLDSCKVTVNDIKKLQSKDLPNLVSFRPE  578



>gb|KHG20419.1| Leucine-rich repeat-containing 18 [Gossypium arboreum]
Length=240

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT++L++ +NLRSLEICGGGLTDAGVKNIKDL++L+LLNLSQN +LTDK+LE ISGLT 
Sbjct  124  SGTSHLRNLRNLRSLEICGGGLTDAGVKNIKDLSSLSLLNLSQNCNLTDKTLEMISGLTG  183

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSR+TSAGL+HLKPLK L+SLTLE+CKVTANDI++LQS  LPNLVN+RPE
Sbjct  184  LISLNVSNSRVTSAGLRHLKPLKNLRSLTLEACKVTANDIRRLQSAGLPNLVNFRPE  240



>gb|KDO52279.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=479

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  363  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  422

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  423  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  479



>gb|KDO52278.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=479

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  363  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  422

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  423  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  479



>gb|KDO52280.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=497

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  381  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  440

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  441  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  497



>gb|KDO52276.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=503

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  387  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  446

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  447  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  503



>gb|KDO52275.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=529

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  413  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  472

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  473  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  529



>gb|KDP37033.1| hypothetical protein JCGZ_06089 [Jatropha curcas]
Length=578

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYL++FKNL+SLEICGGGLTDAG++NIKDL++L+LLNLSQN +LTDKSLE ISGLT 
Sbjct  462  SGTNYLRNFKNLQSLEICGGGLTDAGIRNIKDLSSLSLLNLSQNCNLTDKSLEMISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNSRITSAGLQHLKPLK LKSLTLESCKVTA+DIK+LQS++LP LV++RPE
Sbjct  522  LVSLNMSNSRITSAGLQHLKPLKNLKSLTLESCKVTASDIKRLQSSELPQLVSFRPE  578



>ref|XP_006427460.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 ref|XP_006427461.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 gb|ESR40700.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 gb|ESR40701.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
Length=578

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  462  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  522  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  578



>ref|XP_006492112.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X1 [Citrus sinensis]
 ref|XP_006492113.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X2 [Citrus sinensis]
 ref|XP_006492114.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X3 [Citrus sinensis]
 ref|XP_006492115.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X4 [Citrus sinensis]
Length=578

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  462  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLKLLNLSQNCNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  522  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  578



>gb|KJB70662.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=455

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT++L++ KNLRSLEICGGGLTDAGVKNIKDL++L+LLNLSQN +LTDK+LE ISGLT 
Sbjct  339  SGTSHLRNLKNLRSLEICGGGLTDAGVKNIKDLSSLSLLNLSQNCNLTDKTLEMISGLTG  398

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSR+TSAGL+HLKPLK L+SLTLE+CKVTANDI++LQS  LPNLVN+RPE
Sbjct  399  LISLNVSNSRVTSAGLRHLKPLKNLRSLTLEACKVTANDIRRLQSAGLPNLVNFRPE  455



>gb|KJB70659.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=554

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT++L++ KNLRSLEICGGGLTDAGVKNIKDL++L+LLNLSQN +LTDK+LE ISGLT 
Sbjct  438  SGTSHLRNLKNLRSLEICGGGLTDAGVKNIKDLSSLSLLNLSQNCNLTDKTLEMISGLTG  497

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSR+TSAGL+HLKPLK L+SLTLE+CKVTANDI++LQS  LPNLVN+RPE
Sbjct  498  LISLNVSNSRVTSAGLRHLKPLKNLRSLTLEACKVTANDIRRLQSAGLPNLVNFRPE  554



>gb|KJB70657.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
 gb|KJB70658.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
 gb|KJB70661.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=578

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT++L++ KNLRSLEICGGGLTDAGVKNIKDL++L+LLNLSQN +LTDK+LE ISGLT 
Sbjct  462  SGTSHLRNLKNLRSLEICGGGLTDAGVKNIKDLSSLSLLNLSQNCNLTDKTLEMISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSR+TSAGL+HLKPLK L+SLTLE+CKVTANDI++LQS  LPNLVN+RPE
Sbjct  522  LISLNVSNSRVTSAGLRHLKPLKNLRSLTLEACKVTANDIRRLQSAGLPNLVNFRPE  578



>gb|KEH28672.1| F-box/LRR-like protein [Medicago truncatula]
Length=332

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEIC GGLTDAGVKNIK+L++L  LNLSQNS+LTDK++E I+GLT+L
Sbjct  217  GTNYLKKFKNLRSLEICSGGLTDAGVKNIKELSSLMCLNLSQNSNLTDKTVELIAGLTAL  276

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLN+SN+RITSAGLQHLK LK L+SLTLESCKVTANDIKK +   LPNLV++RPE
Sbjct  277  VSLNLSNTRITSAGLQHLKTLKNLRSLTLESCKVTANDIKKFKLIHLPNLVSFRPE  332



>gb|KJB70660.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=583

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT++L++ KNLRSLEICGGGLTDAGVKNIKDL++L+LLNLSQN +LTDK+LE ISGLT 
Sbjct  467  SGTSHLRNLKNLRSLEICGGGLTDAGVKNIKDLSSLSLLNLSQNCNLTDKTLEMISGLTG  526

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSR+TSAGL+HLKPLK L+SLTLE+CKVTANDI++LQS  LPNLVN+RPE
Sbjct  527  LISLNVSNSRVTSAGLRHLKPLKNLRSLTLEACKVTANDIRRLQSAGLPNLVNFRPE  583



>gb|AES86545.2| F-box/LRR-like protein [Medicago truncatula]
Length=380

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEIC GGLTDAGVKNIK+L++L  LNLSQNS+LTDK++E I+GLT+L
Sbjct  265  GTNYLKKFKNLRSLEICSGGLTDAGVKNIKELSSLMCLNLSQNSNLTDKTVELIAGLTAL  324

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLN+SN+RITSAGLQHLK LK L+SLTLESCKVTANDIKK +   LPNLV++RPE
Sbjct  325  VSLNLSNTRITSAGLQHLKTLKNLRSLTLESCKVTANDIKKFKLIHLPNLVSFRPE  380



>ref|XP_008228736.1| PREDICTED: F-box/LRR-repeat protein 14 [Prunus mume]
Length=577

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL+ FKNLRSLEICGGGLTDAG+KNIK+L++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  461  SGTHYLRSFKNLRSLEICGGGLTDAGIKNIKNLSSLTLLNLSQNCNLTDKALELISGLTG  520

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSRIT++GL+HLK LK LKSLTLESCKVTAN+I+KLQ TDLPNLV++RPE
Sbjct  521  LISLNVSNSRITNSGLRHLKTLKNLKSLTLESCKVTANEIRKLQLTDLPNLVSFRPE  577



>ref|XP_011020241.1| PREDICTED: F-box/LRR-repeat protein 14 [Populus euphratica]
 ref|XP_011020242.1| PREDICTED: F-box/LRR-repeat protein 14 [Populus euphratica]
Length=588

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN LKHFKNL+SLEICGGGLTDAGVKNIKDL  L +LNLSQN++LTDK+LE ISGLT 
Sbjct  472  SGTNCLKHFKNLKSLEICGGGLTDAGVKNIKDLVHLTVLNLSQNTNLTDKTLELISGLTE  531

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GL++LKPLK L++L+LESCKVTA++IKKLQST+LPNL ++RPE
Sbjct  532  LVSLNVSNSLITNEGLRYLKPLKNLRALSLESCKVTASEIKKLQSTELPNLASFRPE  588



>ref|XP_006416883.1| hypothetical protein EUTSA_v10007169mg [Eutrema salsugineum]
 gb|ESQ35236.1| hypothetical protein EUTSA_v10007169mg [Eutrema salsugineum]
Length=586

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  470  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLPSLTLLNLSQNSNLTDKTLELISGLTG  529

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCKV+ANDI+KLQ+TDLPNLVN+RPE
Sbjct  530  LVSLNVSNSRVSNSGLRHLKPLKNLRSLTLESCKVSANDIRKLQATDLPNLVNFRPE  586



>ref|XP_010097169.1| hypothetical protein L484_025715 [Morus notabilis]
 gb|EXB67236.1| hypothetical protein L484_025715 [Morus notabilis]
Length=580

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTNYL++FKNLRSLEICGGGLTD+GVKNI+DL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  464  SGTNYLRNFKNLRSLEICGGGLTDSGVKNIRDLSSLTLLNLSQNCNLTDKTLEMISGLTG  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRI+S+GL+HL+ LK LKSLTLESCKV+ANDIK LQS  LPNLV+ RPE
Sbjct  524  LVSLNVSNSRISSSGLRHLRTLKNLKSLTLESCKVSANDIKNLQSNHLPNLVSVRPE  580



>ref|XP_004506963.1| PREDICTED: internalin-A-like isoform X2 [Cicer arietinum]
Length=573

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEIC GGLTDAGVKNIK+L++L  LNLSQNSHLTDK+LE I+GLT L
Sbjct  458  GTNYLKKFKNLRSLEICSGGLTDAGVKNIKELSSLMCLNLSQNSHLTDKTLELIAGLTGL  517

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            +SLN+S SRIT+AGLQHLK LK L+SLTLESCKVT+NDIKK +S  LPNLV++RPE
Sbjct  518  ISLNLSKSRITTAGLQHLKTLKNLRSLTLESCKVTSNDIKKFRSIHLPNLVSFRPE  573



>ref|XP_010532117.1| PREDICTED: F-box/LRR-repeat protein 16 isoform X6 [Tarenaya hassleriana]
Length=555

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGL  
Sbjct  439  SGTNHLRSLKKLQSLEICGGGLTDAGVKNIKDLISLTLLNLSQNSNLTDKTLELISGLKG  498

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITS+GL+HLKPLK L+SLTLESCKVTA+DI+KLQ+TDLPNL+N+RPE
Sbjct  499  LVSLNVSNSRITSSGLRHLKPLKNLRSLTLESCKVTAHDIRKLQATDLPNLLNFRPE  555



>ref|XP_010532116.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X5 [Tarenaya hassleriana]
Length=559

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGL  
Sbjct  443  SGTNHLRSLKKLQSLEICGGGLTDAGVKNIKDLISLTLLNLSQNSNLTDKTLELISGLKG  502

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITS+GL+HLKPLK L+SLTLESCKVTA+DI+KLQ+TDLPNL+N+RPE
Sbjct  503  LVSLNVSNSRITSSGLRHLKPLKNLRSLTLESCKVTAHDIRKLQATDLPNLLNFRPE  559



>ref|XP_004506962.1| PREDICTED: internalin-A-like isoform X1 [Cicer arietinum]
Length=588

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEIC GGLTDAGVKNIK+L++L  LNLSQNSHLTDK+LE I+GLT L
Sbjct  473  GTNYLKKFKNLRSLEICSGGLTDAGVKNIKELSSLMCLNLSQNSHLTDKTLELIAGLTGL  532

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            +SLN+S SRIT+AGLQHLK LK L+SLTLESCKVT+NDIKK +S  LPNLV++RPE
Sbjct  533  ISLNLSKSRITTAGLQHLKTLKNLRSLTLESCKVTSNDIKKFRSIHLPNLVSFRPE  588



>ref|XP_010532114.1| PREDICTED: F-box/LRR-repeat protein 16 isoform X3 [Tarenaya hassleriana]
Length=580

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGL  
Sbjct  464  SGTNHLRSLKKLQSLEICGGGLTDAGVKNIKDLISLTLLNLSQNSNLTDKTLELISGLKG  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITS+GL+HLKPLK L+SLTLESCKVTA+DI+KLQ+TDLPNL+N+RPE
Sbjct  524  LVSLNVSNSRITSSGLRHLKPLKNLRSLTLESCKVTAHDIRKLQATDLPNLLNFRPE  580



>gb|KHN38005.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=674

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEICGGGLTD GVKNIK+L++L  LNLSQNS+LTDK+LE ISGLT L
Sbjct  559  GTNYLKKFKNLRSLEICGGGLTDTGVKNIKELSSLVCLNLSQNSNLTDKTLELISGLTGL  618

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            VSLNVSNSRIT+AGLQHLK LK L+SLTLESCKVTANDIKKL+S  LPNLV++RP
Sbjct  619  VSLNVSNSRITNAGLQHLKTLKNLRSLTLESCKVTANDIKKLKSMYLPNLVSFRP  673



>ref|XP_010532115.1| PREDICTED: F-box/LRR-repeat protein 2 isoform X4 [Tarenaya hassleriana]
Length=578

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGL  
Sbjct  462  SGTNHLRSLKKLQSLEICGGGLTDAGVKNIKDLISLTLLNLSQNSNLTDKTLELISGLKG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITS+GL+HLKPLK L+SLTLESCKVTA+DI+KLQ+TDLPNL+N+RPE
Sbjct  522  LVSLNVSNSRITSSGLRHLKPLKNLRSLTLESCKVTAHDIRKLQATDLPNLLNFRPE  578



>ref|XP_010532111.1| PREDICTED: F-box/LRR-repeat protein 16 isoform X1 [Tarenaya hassleriana]
Length=584

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGL  
Sbjct  468  SGTNHLRSLKKLQSLEICGGGLTDAGVKNIKDLISLTLLNLSQNSNLTDKTLELISGLKG  527

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITS+GL+HLKPLK L+SLTLESCKVTA+DI+KLQ+TDLPNL+N+RPE
Sbjct  528  LVSLNVSNSRITSSGLRHLKPLKNLRSLTLESCKVTAHDIRKLQATDLPNLLNFRPE  584



>ref|XP_010532113.1| PREDICTED: F-box/LRR-repeat protein 2 isoform X2 [Tarenaya hassleriana]
Length=582

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K L+SLEICGGGLTDAGVKNIKDL +L LLNLSQNS+LTDK+LE ISGL  
Sbjct  466  SGTNHLRSLKKLQSLEICGGGLTDAGVKNIKDLISLTLLNLSQNSNLTDKTLELISGLKG  525

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITS+GL+HLKPLK L+SLTLESCKVTA+DI+KLQ+TDLPNL+N+RPE
Sbjct  526  LVSLNVSNSRITSSGLRHLKPLKNLRSLTLESCKVTAHDIRKLQATDLPNLLNFRPE  582



>ref|XP_003604348.1| F-box/LRR-repeat protein [Medicago truncatula]
Length=573

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEIC GGLTDAGVKNIK+L++L  LNLSQNS+LTDK++E I+GLT+L
Sbjct  458  GTNYLKKFKNLRSLEICSGGLTDAGVKNIKELSSLMCLNLSQNSNLTDKTVELIAGLTAL  517

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLN+SN+RITSAGLQHLK LK L+SLTLESCKVTANDIKK +   LPNLV++RPE
Sbjct  518  VSLNLSNTRITSAGLQHLKTLKNLRSLTLESCKVTANDIKKFKLIHLPNLVSFRPE  573



>ref|XP_003528299.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoformX1 [Glycine max]
 ref|XP_006583115.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X3 [Glycine max]
 ref|XP_006583116.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X4 [Glycine max]
 ref|XP_006583117.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X5 [Glycine max]
Length=577

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEICGG LTDAGVKNIK+L++L  LNLSQNS+LTDK+LE ISGLT L
Sbjct  462  GTNYLKKFKNLRSLEICGGVLTDAGVKNIKELSSLVCLNLSQNSNLTDKTLELISGLTGL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            VSLNVSNSRIT+AGLQHLK LK L+SLTLESCKVTANDIKKL+S  LPNLV++RP
Sbjct  522  VSLNVSNSRITNAGLQHLKTLKNLRSLTLESCKVTANDIKKLKSIYLPNLVSFRP  576



>ref|XP_003599715.1| F-box/LRR-repeat protein [Medicago truncatula]
Length=585

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEIC GGLTDAGVKNIK+L++L  LNLSQNS+LTDK++E I+GLT+L
Sbjct  470  GTNYLKKFKNLRSLEICSGGLTDAGVKNIKELSSLMCLNLSQNSNLTDKTVELIAGLTAL  529

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLN+SN+RITSAGLQHLK LK L+SLTLESCKVTANDIKK +   LPNLV++RPE
Sbjct  530  VSLNLSNTRITSAGLQHLKTLKNLRSLTLESCKVTANDIKKFKLIHLPNLVSFRPE  585



>gb|KHN01311.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=577

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEICGG LTDAGVKNIK+L++L  LNLSQNS+LTDK+LE ISGLT L
Sbjct  462  GTNYLKKFKNLRSLEICGGVLTDAGVKNIKELSSLVCLNLSQNSNLTDKTLELISGLTGL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            VSLNVSNSRIT+AGLQHLK LK L+SLTLESCKVTANDIKKL+S  LPNLV++RP
Sbjct  522  VSLNVSNSRITNAGLQHLKTLKNLRSLTLESCKVTANDIKKLKSIYLPNLVSFRP  576



>ref|XP_008372697.1| PREDICTED: toll-like receptor 13 [Malus domestica]
Length=578

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FK+L+SLEICGGGLTD G+KNIKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  460  SGTTYLRSFKDLKSLEICGGGLTDVGIKNIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  519

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            L+SLNVSNSRIT++GL+HLK LK LKSLTLESCKVTAN+I+KLQ TDLPNLVN+RP
Sbjct  520  LISLNVSNSRITNSGLKHLKMLKNLKSLTLESCKVTANEIRKLQMTDLPNLVNFRP  575



>ref|XP_009338496.1| PREDICTED: F-box/LRR-repeat protein 13-like [Pyrus x bretschneideri]
Length=580

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FK+L+SLEICGGGLTD G+KNIKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  462  SGTTYLRSFKDLKSLEICGGGLTDVGIKNIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            L+SLNVSNSRIT++GL+HLK LK LKSLTLESCKVTAN+I+KLQ TDLPNLVN+RP
Sbjct  522  LISLNVSNSRITNSGLKHLKMLKNLKSLTLESCKVTANEIRKLQMTDLPNLVNFRP  577



>ref|XP_009348313.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009348318.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Pyrus 
x bretschneideri]
Length=583

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FK+L+SLEICGGGLTD G+KNIKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  465  SGTTYLRSFKDLKSLEICGGGLTDVGIKNIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            L+SLNVSNSRIT++GL+HLK LK LKSLTLESCKVTAN+I+KLQ TDLPNLVN+RP
Sbjct  525  LISLNVSNSRITNSGLKHLKMLKNLKSLTLESCKVTANEIRKLQMTDLPNLVNFRP  580



>ref|XP_009348314.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009348319.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Pyrus 
x bretschneideri]
Length=580

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FK+L+SLEICGGGLTD G+KNIKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  462  SGTTYLRSFKDLKSLEICGGGLTDVGIKNIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            L+SLNVSNSRIT++GL+HLK LK LKSLTLESCKVTAN+I+KLQ TDLPNLVN+RP
Sbjct  522  LISLNVSNSRITNSGLKHLKMLKNLKSLTLESCKVTANEIRKLQMTDLPNLVNFRP  577



>ref|XP_009148961.1| PREDICTED: F-box/LRR-repeat protein 14 [Brassica rapa]
Length=578

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT+
Sbjct  462  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCKV+ANDI+KLQ+TDLPNLV +RPE
Sbjct  522  LVSLNVSNSRVSNSGLRHLKPLKNLRSLTLESCKVSANDIRKLQATDLPNLVTFRPE  578



>emb|CAN74892.1| hypothetical protein VITISV_002002 [Vitis vinifera]
Length=300

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+YL++FKNL+SLEICGGGLTDAGVKNIKDLT L +LNLSQN +LTDKSLE ISGLT+
Sbjct  180  SGTSYLRNFKNLQSLEICGGGLTDAGVKNIKDLTCLTVLNLSQNCNLTDKSLELISGLTA  239

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNL  405
            LVSL+VSNSRIT+AGLQHLK LK LKSLTL+SCKVT NDIKKLQS DLPNL
Sbjct  240  LVSLSVSNSRITNAGLQHLKQLKNLKSLTLDSCKVTVNDIKKLQSKDLPNL  290



>ref|XP_006583114.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X2 [Glycine max]
Length=658

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEICGG LTDAGVKNIK+L++L  LNLSQNS+LTDK+LE ISGLT L
Sbjct  543  GTNYLKKFKNLRSLEICGGVLTDAGVKNIKELSSLVCLNLSQNSNLTDKTLELISGLTGL  602

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            VSLNVSNSRIT+AGLQHLK LK L+SLTLESCKVTANDIKKL+S  LPNLV++RP
Sbjct  603  VSLNVSNSRITNAGLQHLKTLKNLRSLTLESCKVTANDIKKLKSIYLPNLVSFRP  657



>emb|CDY36583.1| BnaA06g10360D [Brassica napus]
Length=578

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  462  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCKV+ANDI+KLQ+TDLPNLV +RPE
Sbjct  522  LVSLNVSNSRVSNSGLRHLKPLKNLRSLTLESCKVSANDIRKLQATDLPNLVTFRPE  578



>emb|CDY33388.1| BnaC05g11950D [Brassica napus]
Length=585

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  469  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  528

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCKV+ANDI+KLQ+TDLPNLV +RPE
Sbjct  529  LVSLNVSNSRVSNSGLRHLKPLKNLRSLTLESCKVSANDIRKLQATDLPNLVTFRPE  585



>ref|XP_002262830.2| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera]
 ref|XP_010656527.1| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera]
 emb|CBI25566.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN L+HFKNL++LEICGGGLTDAGVKNIK L +L LLNLSQN +LTDK+LE ISGLT+
Sbjct  462  AGTNCLRHFKNLQTLEICGGGLTDAGVKNIKGLASLTLLNLSQNCNLTDKTLEMISGLTA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT+ GLQHLKPLK L SL+LESCKVTA++I+KLQST LPNLV++RPE
Sbjct  522  LVSLNVSNSRITNNGLQHLKPLKNLLSLSLESCKVTASEIRKLQSTALPNLVSFRPE  578



>ref|XP_010497352.1| PREDICTED: F-box/LRR-repeat protein 2-like isoform X2 [Camelina 
sativa]
Length=561

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  445  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLEFISGLTG  504

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLP+LVN+RPE
Sbjct  505  LVSLNVSNSRVSTSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPHLVNFRPE  561



>ref|XP_010476663.1| PREDICTED: F-box/LRR-repeat protein 2-like isoform X2 [Camelina 
sativa]
Length=561

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  445  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLEFISGLTG  504

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLP+LVN+RPE
Sbjct  505  LVSLNVSNSRVSTSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPHLVNFRPE  561



>ref|XP_010497346.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Camelina 
sativa]
Length=585

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  469  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLEFISGLTG  528

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLP+LVN+RPE
Sbjct  529  LVSLNVSNSRVSTSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPHLVNFRPE  585



>ref|XP_010459109.1| PREDICTED: F-box/LRR-repeat protein 14-like [Camelina sativa]
Length=586

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  470  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLEFISGLTG  529

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLP+LVN+RPE
Sbjct  530  LVSLNVSNSRVSTSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPHLVNFRPE  586



>ref|XP_010476662.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Camelina 
sativa]
Length=585

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  469  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDKTLEFISGLTG  528

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLP+LVN+RPE
Sbjct  529  LVSLNVSNSRVSTSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPHLVNFRPE  585



>gb|ACB87911.1| F-box-containing protein 1 [Malus domestica]
Length=580

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N+LK+FKNL+SLEICGGGLTDAGVKNIKDL  L  LN+SQN +LT+KSLE ISGLT+
Sbjct  464  SGANHLKYFKNLQSLEICGGGLTDAGVKNIKDLVCLTWLNISQNCNLTNKSLELISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT+ GLQHLKPLK L+SLTLESCKVTA++I+KLQS  LPNLV++RPE
Sbjct  524  LVSLNVSNSRITNEGLQHLKPLKNLRSLTLESCKVTASEIRKLQSDALPNLVSFRPE  580



>ref|XP_008361107.1| PREDICTED: F-box/LRR-repeat protein 13-like [Malus domestica]
 ref|XP_008361108.1| PREDICTED: F-box/LRR-repeat protein 13-like [Malus domestica]
 ref|XP_008361109.1| PREDICTED: F-box/LRR-repeat protein 13-like [Malus domestica]
Length=580

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N+LK+FKNL+SLEICGGGLTDAGVKNIKDL  L  LN+SQN +LT+KSLE ISGLT+
Sbjct  464  SGANHLKYFKNLQSLEICGGGLTDAGVKNIKDLVCLTWLNISQNCNLTNKSLELISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT+ GLQHLKPLK L+SLTLESCKVTA++I+KLQS  LPNLV++RPE
Sbjct  524  LVSLNVSNSRITNEGLQHLKPLKNLRSLTLESCKVTASEIRKLQSDALPNLVSFRPE  580



>gb|EPS62263.1| hypothetical protein M569_12528, partial [Genlisea aurea]
Length=229

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L+  K+L+SLEICGGGLTDAGVKNIKDL +L LLNLSQN+HLTDKSLE ISGL  
Sbjct  113  SGTNHLRCLKSLQSLEICGGGLTDAGVKNIKDLKSLTLLNLSQNNHLTDKSLEFISGLMQ  172

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNSR+T AGL HLK LK LKSLTLESCKVT NDIKKL ST L NLV++RPE
Sbjct  173  LVSLNMSNSRVTGAGLVHLKSLKNLKSLTLESCKVTPNDIKKLHSTYLRNLVSFRPE  229



>ref|XP_006305845.1| hypothetical protein CARUB_v10010899mg [Capsella rubella]
 gb|EOA38743.1| hypothetical protein CARUB_v10010899mg [Capsella rubella]
Length=585

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTDAGVKNIKDL++L LLNLSQNS+LTD++LE ISGLT 
Sbjct  469  SGTNHLRNLKKLQSLEICGGGLTDAGVKNIKDLSSLTLLNLSQNSNLTDRTLELISGLTG  528

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLP+LVN+RPE
Sbjct  529  LVSLNVSNSRVSTSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPHLVNFRPE  585



>ref|XP_010537926.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=578

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT ++++ K L SLEICGGGLTDAGVKNIKDLT+L  LNLSQNS+LTDK+LE ISGL  
Sbjct  462  SGTIHIRNLKKLESLEICGGGLTDAGVKNIKDLTSLMFLNLSQNSNLTDKTLELISGLKG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L+SLNVSNSRITS+GL+HLKPLKKL+SLTLESCKVTA DI+KLQSTDLPNLVN+RPE
Sbjct  522  LMSLNVSNSRITSSGLRHLKPLKKLRSLTLESCKVTAFDIRKLQSTDLPNLVNFRPE  578



>ref|XP_002308980.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE92503.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=588

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN LK+FKNL+SLEICGGGLTDAGVKNIKDL  L +LNLSQN++LTDK+LE ISGLT 
Sbjct  472  SGTNCLKYFKNLKSLEICGGGLTDAGVKNIKDLVHLTVLNLSQNTNLTDKTLELISGLTE  531

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GL++LKPLK L++LTLESCKVTA++IKKLQST+LPNL + RPE
Sbjct  532  LVSLNVSNSLITNEGLRYLKPLKNLRALTLESCKVTASEIKKLQSTELPNLASVRPE  588



>ref|XP_007204208.1| hypothetical protein PRUPE_ppa003392mg [Prunus persica]
 gb|EMJ05407.1| hypothetical protein PRUPE_ppa003392mg [Prunus persica]
Length=578

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N LK+FKNL+SLEICGGGLTDAGVKNIKDL  L  LNLSQN  LTDKSLE ISGLT+
Sbjct  462  SGANCLKYFKNLQSLEICGGGLTDAGVKNIKDLVGLTWLNLSQNCKLTDKSLELISGLTA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNSRIT+ GLQ+LKPLK L+SLTLESCKVTA++I+KLQS  LPNLV++RP
Sbjct  522  LVSLNVSNSRITNEGLQYLKPLKNLRSLTLESCKVTASEIRKLQSAALPNLVSFRP  577



>ref|XP_003542662.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Glycine 
max]
 ref|XP_006594261.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Glycine 
max]
Length=578

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT +L+ FKNL+SLEICGGGLTDAGVKNI+++ +L  LNLSQN +LTDK+LE ISG+T+L
Sbjct  463  GTTFLRSFKNLQSLEICGGGLTDAGVKNIREIVSLTQLNLSQNCNLTDKTLELISGMTAL  522

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+ GL+HLKPLK L++LTLESCKVTA+ IKKLQSTDLPNL+++RPE
Sbjct  523  RSLNVSNSRITNEGLRHLKPLKNLRTLTLESCKVTASGIKKLQSTDLPNLISFRPE  578



>ref|XP_008242881.1| PREDICTED: F-box/LRR-repeat protein 13-like [Prunus mume]
 ref|XP_008242882.1| PREDICTED: F-box/LRR-repeat protein 13-like [Prunus mume]
Length=579

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N LK+FKNL+SLEICGGGLTDAGVKNIKDL  L  LNLSQN  LTDKSLE ISGLT+
Sbjct  463  SGANCLKYFKNLQSLEICGGGLTDAGVKNIKDLVGLTWLNLSQNCKLTDKSLELISGLTA  522

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNSRIT+ GLQ+LKPLK L+SLTLESCKVTA++I+KLQS  LPNLV++RP
Sbjct  523  LVSLNVSNSRITNEGLQYLKPLKNLRSLTLESCKVTASEIRKLQSAALPNLVSFRP  578



>gb|ACJ85662.1| unknown [Medicago truncatula]
Length=331

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FKNL+SLEICGG LTDAGVKNI+++ +L  LNLSQN  LTDK+LE ISG+T+
Sbjct  215  SGTTYLRSFKNLQSLEICGGLLTDAGVKNIREIVSLTQLNLSQNCKLTDKTLELISGMTA  274

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L SLNVSNSR+T+ GL++LKPLK L++L+LESCKV A DIKKL STDLPNL+++RPE
Sbjct  275  LRSLNVSNSRVTNEGLRYLKPLKNLRTLSLESCKVNAADIKKLHSTDLPNLISFRPE  331



>ref|XP_010250286.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Nelumbo 
nucifera]
Length=554

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN L++FKNLRSLEICGGGLTD GVKNIKDLT+L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  439  GTNCLRYFKNLRSLEICGGGLTDVGVKNIKDLTSLALLNLSQNCNLTDKTLELISGLTAL  498

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHL+PLK L+SL+LESCKVTA+++KKLQ+  LPNL++ RPE
Sbjct  499  VSLNVSNSRITNAGLQHLRPLKNLRSLSLESCKVTASEMKKLQTIFLPNLISVRPE  554



>ref|XP_010250285.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Nelumbo 
nucifera]
Length=578

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN L++FKNLRSLEICGGGLTD GVKNIKDLT+L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  463  GTNCLRYFKNLRSLEICGGGLTDVGVKNIKDLTSLALLNLSQNCNLTDKTLELISGLTAL  522

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHL+PLK L+SL+LESCKVTA+++KKLQ+  LPNL++ RPE
Sbjct  523  VSLNVSNSRITNAGLQHLRPLKNLRSLSLESCKVTASEMKKLQTIFLPNLISVRPE  578



>gb|KDP30209.1| hypothetical protein JCGZ_16991 [Jatropha curcas]
Length=577

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG NYL++FKNL+SLEICGGGLTDAGVKNIK+L  L +LNLSQNS+LTDK+LE ISGLT 
Sbjct  460  SGANYLQYFKNLQSLEICGGGLTDAGVKNIKELAHLTVLNLSQNSNLTDKTLELISGLTG  519

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GL++LKPLK L+SL+LESCKVTA++IKKLQ T LPNLV++RPE
Sbjct  520  LVSLNVSNSLITNEGLRYLKPLKNLRSLSLESCKVTASEIKKLQLTALPNLVSFRPE  576



>gb|KHN47120.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=675

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT +L+ FKNL+SLEICGGGLTDAGVKNI+++ +L  LNLSQN +LTDK+LE ISG+T+L
Sbjct  560  GTTFLRSFKNLQSLEICGGGLTDAGVKNIREIVSLTQLNLSQNCNLTDKTLELISGMTAL  619

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+ GL+HLKPLK L++LTLESCKVTA+ IKKLQSTDLPNL+++RPE
Sbjct  620  RSLNVSNSRITNEGLRHLKPLKNLRTLTLESCKVTASGIKKLQSTDLPNLISFRPE  675



>ref|XP_007135773.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
 ref|XP_007135774.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
 gb|ESW07767.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
 gb|ESW07768.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
Length=577

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLRSLEICGG LTDAGVKNIK+L++L  LNLSQNS+LTDK+LE ISGLT L
Sbjct  462  GTNYLKKFKNLRSLEICGGALTDAGVKNIKELSSLVCLNLSQNSNLTDKTLELISGLTGL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            V+LNVSNSR+T+AGLQHLK LK L+SLTLESCKVTAND+KKL+S  L NLV++RP
Sbjct  522  VTLNVSNSRVTNAGLQHLKALKNLRSLTLESCKVTANDMKKLKSIYLTNLVSFRP  576



>ref|XP_009338390.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009338392.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009338393.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
Length=580

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N+LK+FKNL+SLEICGGGLTDAGVKNIKDL  L  LN+SQN +LT+KSLE ISGLT+
Sbjct  464  SGANHLKYFKNLQSLEICGGGLTDAGVKNIKDLVCLTWLNISQNCNLTNKSLELISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT+ GLQHLKPLK L+SLTLESCKVTA++I+KLQ   LPNLV++RPE
Sbjct  524  LVSLNVSNSRITNEGLQHLKPLKNLRSLTLESCKVTASEIRKLQFDALPNLVSFRPE  580



>ref|XP_009358539.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009358540.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009358541.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
Length=580

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N+LK+FKNL+SLEICGGGLTDAGVKNIKDL  L  LN+SQN +LT+KSLE ISGLT+
Sbjct  464  SGANHLKYFKNLQSLEICGGGLTDAGVKNIKDLVCLTWLNISQNCNLTNKSLELISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT+ GLQHLKPLK L+SLTLESCKVTA++I+KLQ   LPNLV++RPE
Sbjct  524  LVSLNVSNSRITNEGLQHLKPLKNLRSLTLESCKVTASEIRKLQFDALPNLVSFRPE  580



>ref|XP_010244895.1| PREDICTED: F-box/LRR-repeat protein 13-like [Nelumbo nucifera]
Length=578

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN L++FKNLRSLEICGGGLTDAGVKNIKDLT L LLNLSQN +LTDK+L+ ISGLT+L
Sbjct  463  GTNCLRYFKNLRSLEICGGGLTDAGVKNIKDLTLLTLLNLSQNCNLTDKTLQLISGLTAL  522

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSR+T+AGLQHL+PLK L+SL+LESCKVT ++IKKLQST LP+LV+ RPE
Sbjct  523  VSLNVSNSRVTNAGLQHLRPLKNLRSLSLESCKVTPSEIKKLQSTFLPDLVSVRPE  578



>gb|KJB23678.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
Length=518

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTNYL+ FKNL+SLEICGGGLTDAGVKNIKDL +L LLNLSQN +LT+KSLE ISGL +
Sbjct  402  TGTNYLRCFKNLQSLEICGGGLTDAGVKNIKDLPSLTLLNLSQNCNLTNKSLELISGLNA  461

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GL +LKPLK L+SL+LESCKVTA +IKKLQST LPNLV++RPE
Sbjct  462  LVSLNVSNSNITNDGLPYLKPLKNLRSLSLESCKVTAAEIKKLQSTALPNLVSFRPE  518



>ref|XP_004303269.1| PREDICTED: F-box/LRR-repeat protein 13 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN L+  KNLRSLEICGG LTDAGVKNIKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  462  SGTNDLRSLKNLRSLEICGGRLTDAGVKNIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT++GL+HLK LK LKSLTLE CKVT NDI+KLQ TDLPNLV++RPE
Sbjct  522  LVSLNVSNSRITNSGLRHLKLLKNLKSLTLEGCKVTVNDIRKLQMTDLPNLVSFRPE  578



>gb|KHG11502.1| F-box/LRR-repeat 14 [Gossypium arboreum]
Length=554

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTNYL+ FKNL+SLEICGGGLTDAGVKNIKDL +L LLNLSQN +LT+KSLE ISGL +
Sbjct  438  TGTNYLRCFKNLQSLEICGGGLTDAGVKNIKDLPSLTLLNLSQNCNLTNKSLELISGLNA  497

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GL +LKPLK L+SL+LESCKVTA +IKKLQST LPNLV++RPE
Sbjct  498  LVSLNVSNSNITNDGLPYLKPLKNLRSLSLESCKVTAAEIKKLQSTALPNLVSFRPE  554



>ref|XP_007013624.1| Binding protein, putative [Theobroma cacao]
 gb|EOY31243.1| Binding protein, putative [Theobroma cacao]
Length=578

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYL+  +NL+SLEICGGGLTDAGVKNIKDL +L +LNLSQN  LT+KSLE ISGLT+L
Sbjct  463  GTNYLRCLRNLQSLEICGGGLTDAGVKNIKDLASLTILNLSQNCSLTNKSLELISGLTAL  522

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNS IT+ GL +LKPLK L+SL+LESCKVTA++IKKLQST LPNL+++RPE
Sbjct  523  VSLNVSNSHITNDGLPYLKPLKNLRSLSLESCKVTASEIKKLQSTALPNLISFRPE  578



>gb|KJB23677.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
 gb|KJB23680.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
Length=578

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTNYL+ FKNL+SLEICGGGLTDAGVKNIKDL +L LLNLSQN +LT+KSLE ISGL +
Sbjct  462  TGTNYLRCFKNLQSLEICGGGLTDAGVKNIKDLPSLTLLNLSQNCNLTNKSLELISGLNA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GL +LKPLK L+SL+LESCKVTA +IKKLQST LPNLV++RPE
Sbjct  522  LVSLNVSNSNITNDGLPYLKPLKNLRSLSLESCKVTAAEIKKLQSTALPNLVSFRPE  578



>gb|KHN15024.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=584

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT +L+ FK L+SLEICGGGLTDAGVKNI+++ +L  LNLSQN +LTDK+LE ISG+T+L
Sbjct  469  GTTFLRSFKILQSLEICGGGLTDAGVKNIREIVSLTQLNLSQNCNLTDKTLELISGMTAL  528

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+ GL++LKPLK L++LTLESCKVTA++IKKLQSTDLPNL+++RPE
Sbjct  529  RSLNVSNSRITNEGLRYLKPLKNLRTLTLESCKVTASEIKKLQSTDLPNLISFRPE  584



>ref|XP_006600722.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Glycine 
max]
 ref|XP_006600723.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X3 [Glycine 
max]
Length=581

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT +L+ FK L+SLEICGGGLTDAGVKNI+++ +L  LNLSQN +LTDK+LE ISG+T+L
Sbjct  466  GTTFLRSFKILQSLEICGGGLTDAGVKNIREIVSLTQLNLSQNCNLTDKTLELISGMTAL  525

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+ GL++LKPLK L++LTLESCKVTA++IKKLQSTDLPNL+++RPE
Sbjct  526  RSLNVSNSRITNEGLRYLKPLKNLRTLTLESCKVTASEIKKLQSTDLPNLISFRPE  581



>ref|XP_003549716.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Glycine 
max]
Length=580

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT +L+ FK L+SLEICGGGLTDAGVKNI+++ +L  LNLSQN +LTDK+LE ISG+T+L
Sbjct  465  GTTFLRSFKILQSLEICGGGLTDAGVKNIREIVSLTQLNLSQNCNLTDKTLELISGMTAL  524

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+ GL++LKPLK L++LTLESCKVTA++IKKLQSTDLPNL+++RPE
Sbjct  525  RSLNVSNSRITNEGLRYLKPLKNLRTLTLESCKVTASEIKKLQSTDLPNLISFRPE  580



>gb|AAK62436.1|AF386991_1 Unknown protein [Arabidopsis thaliana]
 gb|AAM10069.1| unknown protein [Arabidopsis thaliana]
Length=332

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTD GVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  216  SGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  275

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++S+GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct  276  LVSLNVSNSRVSSSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPNLVNFRPE  332



>ref|XP_008384922.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
 ref|XP_008384930.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
 ref|XP_008384936.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
 ref|XP_008384944.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
Length=580

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT+ LK+FKNL+SLEICGGGLTDAGVKNIKDLT L  LN+SQN +LTD SLE ISGLT+
Sbjct  464  SGTSCLKYFKNLQSLEICGGGLTDAGVKNIKDLTRLTRLNISQNCNLTDNSLELISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN SNSRIT+ GLQHLKPLK L++L LESCKVTA++I KLQS  LPNLV++RPE
Sbjct  524  LVSLNASNSRITNDGLQHLKPLKNLRALNLESCKVTASEIMKLQSDALPNLVSFRPE  580



>ref|XP_006595170.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Glycine 
max]
Length=517

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLR LEICGG LTD GVKNIK+L++L  LNLSQN +LTD +LE ISGLT L
Sbjct  402  GTNYLKCFKNLRLLEICGGELTDDGVKNIKELSSLKSLNLSQNCNLTDTTLELISGLTDL  461

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            +SLNVSNS IT+AGLQHLK LK L+SL+LESCKVTAN IKKLQSTDLPNLV++RP+
Sbjct  462  ISLNVSNSGITNAGLQHLKTLKNLRSLSLESCKVTANGIKKLQSTDLPNLVSFRPQ  517



>gb|AFK38491.1| unknown [Medicago truncatula]
Length=577

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLR LEIC GGLTDAGVKNIK+L++L  LNLSQNS+LTDK++E I+GLT+L
Sbjct  462  GTNYLKKFKNLRPLEICSGGLTDAGVKNIKELSSLMCLNLSQNSNLTDKTVELIAGLTAL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLN+SN+RIT AGLQHLK LK L+ LTLESCKVT NDIKK +   LPNLV++RPE
Sbjct  522  VSLNLSNTRITFAGLQHLKTLKNLRFLTLESCKVTVNDIKKFKLIHLPNLVSFRPE  577



>ref|XP_003543689.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Glycine 
max]
Length=565

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLR LEICGG LTD GVKNIK+L++L  LNLSQN +LTD +LE ISGLT L
Sbjct  450  GTNYLKCFKNLRLLEICGGELTDDGVKNIKELSSLKSLNLSQNCNLTDTTLELISGLTDL  509

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            +SLNVSNS IT+AGLQHLK LK L+SL+LESCKVTAN IKKLQSTDLPNLV++RP+
Sbjct  510  ISLNVSNSGITNAGLQHLKTLKNLRSLSLESCKVTANGIKKLQSTDLPNLVSFRPQ  565



>ref|XP_003609481.1| F-box/LRR-repeat protein [Medicago truncatula]
 gb|AES91678.1| F-box/LRR-like protein [Medicago truncatula]
Length=576

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FKNL+SLEICGG LTDAGVKNI+++ +L  LNLSQN  LTDK+LE ISG+T+
Sbjct  460  SGTTYLRSFKNLQSLEICGGLLTDAGVKNIREIVSLTQLNLSQNCKLTDKTLELISGMTA  519

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            L SLNVSNSR+T+ GL++LKPLK L++L+LESCKV A DIKKL STDLPNL+++RPE
Sbjct  520  LRSLNVSNSRVTNEGLRYLKPLKNLRTLSLESCKVNAADIKKLHSTDLPNLISFRPE  576



>gb|KHN44196.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=592

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTNYLK FKNLR LEICGG LTD GVKNIK+L++L  LNLSQN +LTD +LE ISGLT L
Sbjct  477  GTNYLKCFKNLRLLEICGGELTDDGVKNIKELSSLKSLNLSQNCNLTDTTLELISGLTDL  536

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            +SLNVSNS IT+AGLQHLK LK L+SL+LESCKVTAN IKKLQSTDLPNLV++RP+
Sbjct  537  ISLNVSNSGITNAGLQHLKTLKNLRSLSLESCKVTANGIKKLQSTDLPNLVSFRPQ  592



>ref|XP_007155092.1| hypothetical protein PHAVU_003G172400g [Phaseolus vulgaris]
 gb|ESW27086.1| hypothetical protein PHAVU_003G172400g [Phaseolus vulgaris]
Length=571

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT YL+ FKNL+SLEICGG LTD GVKNI+++ +L  LNLSQN +LTDK+LE ISG+T+L
Sbjct  456  GTAYLRSFKNLQSLEICGGRLTDDGVKNIREIVSLTQLNLSQNCNLTDKTLELISGMTAL  515

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+ GL++LKPLK L++LTLESCKVTA++IKKLQSTDLPNL+++RPE
Sbjct  516  RSLNVSNSRITNEGLRYLKPLKNLRTLTLESCKVTASEIKKLQSTDLPNLISFRPE  571



>ref|XP_002890123.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66382.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=578

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTD GVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  462  SGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++S+GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct  522  LVSLNVSNSRVSSSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPNLVNFRPE  578



>ref|XP_009363926.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363927.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363930.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363931.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363932.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
Length=579

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG + LK+FKNL+SLEICGGGLTDAGVKNIKDLT L  LNLSQN +LTD SLE ISGLT+
Sbjct  463  SGASCLKYFKNLQSLEICGGGLTDAGVKNIKDLTRLTWLNLSQNCNLTDNSLELISGLTA  522

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRI++ GL+HLKPLK L++L LESCKVTA++I+KLQS  LPNLV++RPE
Sbjct  523  LVSLNVSNSRISNNGLRHLKPLKNLRALNLESCKVTASEIRKLQSDALPNLVSFRPE  579



>gb|AAK28636.1|AF360339_1 unknown protein [Arabidopsis thaliana]
Length=585

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTD GVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  469  SGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  528

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++S+GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct  529  LVSLNVSNSRVSSSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPNLVNFRPE  585



>ref|NP_563980.2| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AAN13089.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29355.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=585

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTD GVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  469  SGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  528

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++S+GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct  529  LVSLNVSNSRVSSSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPNLVNFRPE  585



>gb|AAF82144.1|AC034256_8 Contains similarity to F-box protein FBL2 from Homo sapiens gb|AF176518 
and contains multiple Leucine Rich PF|00560 repeats. 
ESTs gb|Z34572, gb|Z34571, gb|AI100681, gb|AI100675, gb|AA395320, 
gb|AI100674, gb|AA651378, gb|AA007067, gb|T46145, 
gb|T22090, gb|AI995016, gb|H36884, gb|AI995066, gb|H37061, gb|T43537 
come from this gene [Arabidopsis thaliana]
Length=568

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN+L++ K L+SLEICGGGLTD GVKNIKDL++L LLNLSQNS+LTDK+LE ISGLT 
Sbjct  452  SGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDKTLELISGLTG  511

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++S+GL+HLKPLK L+SLTLESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct  512  LVSLNVSNSRVSSSGLRHLKPLKNLRSLTLESCKLSANDIRKLQATDLPNLVNFRPE  568



>gb|EYU21683.1| hypothetical protein MIMGU_mgv1a003547mg [Erythranthe guttata]
Length=579

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN L+ FK L SLEICGGGLTD GVKNIKDLT+L LLNLSQN+HLTDKSLE ISGLT 
Sbjct  463  SGTNCLRSFKKLLSLEICGGGLTDEGVKNIKDLTSLTLLNLSQNNHLTDKSLELISGLTQ  522

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+T+ GLQHLK LK LKSLTLESCK+ A+D+KK QST LPNLV++RPE
Sbjct  523  LVSLNVSNSRVTNNGLQHLKSLKNLKSLTLESCKLNADDMKKFQSTHLPNLVSFRPE  579



>gb|KCW53861.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=629

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L++ K L+SLEICGGGLTDAG+KNIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  513  SGTAHLRNLKKLQSLEICGGGLTDAGMKNIKDLSSLTSLNLSQNCNLTDKTLELVSGLTG  572

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGL+HLK LK L+SLTL+SCKVT  DIKKLQSTDLP+LV  RPE
Sbjct  573  LVSLNVSNSRVTSAGLRHLKTLKNLRSLTLDSCKVTGGDIKKLQSTDLPDLVIVRPE  629



>ref|XP_010033984.1| PREDICTED: F-box/LRR-repeat protein 14 [Eucalyptus grandis]
 gb|KCW53869.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=579

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L++ K L+SLEICGGGLTDAG+KNIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  463  SGTAHLRNLKKLQSLEICGGGLTDAGMKNIKDLSSLTSLNLSQNCNLTDKTLELVSGLTG  522

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGL+HLK LK L+SLTL+SCKVT  DIKKLQSTDLP+LV  RPE
Sbjct  523  LVSLNVSNSRVTSAGLRHLKTLKNLRSLTLDSCKVTGGDIKKLQSTDLPDLVIVRPE  579



>gb|KCW53858.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=646

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L++ K L+SLEICGGGLTDAG+KNIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  530  SGTAHLRNLKKLQSLEICGGGLTDAGMKNIKDLSSLTSLNLSQNCNLTDKTLELVSGLTG  589

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGL+HLK LK L+SLTL+SCKVT  DIKKLQSTDLP+LV  RPE
Sbjct  590  LVSLNVSNSRVTSAGLRHLKTLKNLRSLTLDSCKVTGGDIKKLQSTDLPDLVIVRPE  646



>gb|KCW53859.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=622

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L++ K L+SLEICGGGLTDAG+KNIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  506  SGTAHLRNLKKLQSLEICGGGLTDAGMKNIKDLSSLTSLNLSQNCNLTDKTLELVSGLTG  565

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGL+HLK LK L+SLTL+SCKVT  DIKKLQSTDLP+LV  RPE
Sbjct  566  LVSLNVSNSRVTSAGLRHLKTLKNLRSLTLDSCKVTGGDIKKLQSTDLPDLVIVRPE  622



>gb|KCW53860.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=645

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L++ K L+SLEICGGGLTDAG+KNIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  529  SGTAHLRNLKKLQSLEICGGGLTDAGMKNIKDLSSLTSLNLSQNCNLTDKTLELVSGLTG  588

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGL+HLK LK L+SLTL+SCKVT  DIKKLQSTDLP+LV  RPE
Sbjct  589  LVSLNVSNSRVTSAGLRHLKTLKNLRSLTLDSCKVTGGDIKKLQSTDLPDLVIVRPE  645



>gb|KCW53857.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=694

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L++ K L+SLEICGGGLTDAG+KNIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  578  SGTAHLRNLKKLQSLEICGGGLTDAGMKNIKDLSSLTSLNLSQNCNLTDKTLELVSGLTG  637

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+TSAGL+HLK LK L+SLTL+SCKVT  DIKKLQSTDLP+LV  RPE
Sbjct  638  LVSLNVSNSRVTSAGLRHLKTLKNLRSLTLDSCKVTGGDIKKLQSTDLPDLVIVRPE  694



>ref|XP_010687833.1| PREDICTED: F-box/LRR-repeat protein 14 [Beta vulgaris subsp. 
vulgaris]
Length=579

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+  KNL+SLEICGGGLTDAGVKNIKDLT+L LLNLSQN +LTD++LE +SGLT 
Sbjct  463  SGTQYLRCLKNLQSLEICGGGLTDAGVKNIKDLTSLTLLNLSQNCNLTDRTLELLSGLTG  522

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRIT+ GLQ LKPLK L+SLTLESCKVTA +I+KLQ++ LPNL+++RPE
Sbjct  523  LVSLNVSNSRITNDGLQQLKPLKNLRSLTLESCKVTAPEIRKLQTSVLPNLISFRPE  579



>ref|XP_009403193.1| PREDICTED: F-box/LRR-repeat protein 14 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403194.1| PREDICTED: F-box/LRR-repeat protein 14 [Musa acuminata subsp. 
malaccensis]
Length=576

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  ++FKNL+SLE+CGG +TDAGVKNIKDL +L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  461  GTNCFRYFKNLQSLEVCGGSITDAGVKNIKDLKSLTLLNLSQNCNLTDKTLELISGLTAL  520

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
             SLNVSNSRIT+AGLQHLKPLK L+SLTLESCKVTA +IKKLQ   LPNL++ RPE
Sbjct  521  ASLNVSNSRITNAGLQHLKPLKNLRSLTLESCKVTATEIKKLQLAALPNLISVRPE  576



>ref|XP_009401378.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401379.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401381.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401382.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401383.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401384.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=576

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  +HFKNL+SLE+CGG +TDAGVKNIKDL +L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  461  GTNCFQHFKNLQSLEVCGGSITDAGVKNIKDLKSLTLLNLSQNCNLTDKTLELISGLTAL  520

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHLKPLK L+SLTLESCKVTA +IKKL+   LPNL++ RPE
Sbjct  521  VSLNVSNSRITNAGLQHLKPLKNLRSLTLESCKVTATEIKKLRLAALPNLLSVRPE  576



>ref|XP_009401377.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=627

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  +HFKNL+SLE+CGG +TDAGVKNIKDL +L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  512  GTNCFQHFKNLQSLEVCGGSITDAGVKNIKDLKSLTLLNLSQNCNLTDKTLELISGLTAL  571

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHLKPLK L+SLTLESCKVTA +IKKL+   LPNL++ RPE
Sbjct  572  VSLNVSNSRITNAGLQHLKPLKNLRSLTLESCKVTATEIKKLRLAALPNLLSVRPE  627



>ref|XP_006652480.1| PREDICTED: F-box/LRR-repeat protein 14-like [Oryza brachyantha]
Length=581

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN LK+FKNL+SLE+CGG +TDAGVKNIKDL AL LLNLSQN  LTDKSLE ISGLT+
Sbjct  465  AGTNCLKYFKNLQSLEVCGGYITDAGVKNIKDLKALTLLNLSQNGSLTDKSLELISGLTA  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL+ L+SL+LESCKVTA +IKKLQ   LPNLV+ RPE
Sbjct  525  LVSLNVSNSRVSNSGLHHLKPLQNLRSLSLESCKVTAIEIKKLQLAALPNLVSVRPE  581



>dbj|BAJ98524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=583

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT++L++FKNL SLE+CGG +TDAGVKNIKDL AL LLNLSQN+ LTDK+LE ISGLT+L
Sbjct  468  GTSFLRYFKNLESLEVCGGSITDAGVKNIKDLKALTLLNLSQNAKLTDKTLELISGLTAL  527

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSR+++AG +HLK L+ L+SLTL+SC+VT N++KKL++T LPNL++ RPE
Sbjct  528  VSLNVSNSRVSNAGFRHLKALQNLRSLTLDSCRVTVNEMKKLRATALPNLISVRPE  583



>emb|CAH67587.1| OSIGBa0112M24.4 [Oryza sativa Indica Group]
 gb|EEC77586.1| hypothetical protein OsI_16540 [Oryza sativa Indica Group]
Length=581

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN LK+FKNL+SLE+CGG +TDAGVKNIKDL AL LLNLSQN +LTDKSLE ISGLT+
Sbjct  465  AGTNCLKYFKNLQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGNLTDKSLELISGLTA  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL+ L+SL+LESCKVTA +IKKLQ   LPNLV+ RPE
Sbjct  525  LVSLNVSNSRVSNSGLHHLKPLQNLRSLSLESCKVTAIEIKKLQLAALPNLVSVRPE  581



>ref|XP_008801889.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Phoenix dactylifera]
 ref|XP_008801890.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Phoenix dactylifera]
Length=577

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  + FKNL+SLE+CGG +TDAGVKNIKDLT+L  LNLSQN +LTDK+LE ISGLT+L
Sbjct  462  GTNCFRCFKNLQSLELCGGSITDAGVKNIKDLTSLTFLNLSQNCNLTDKTLELISGLTAL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHLKPLK L+SL+LESCKVTA +IKKLQ   LPNLV+ RPE
Sbjct  522  VSLNVSNSRITNAGLQHLKPLKNLRSLSLESCKVTATEIKKLQLAALPNLVSVRPE  577



>gb|AFK48637.1| unknown [Lotus japonicus]
Length=95

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +1

Query  439  MSFAVTLHDSSVSDFSFLSGFRCCNPALVMREFDTLRDTSDVSPEIASKLLSVR*LFCER  618
            MS AVTL DS+  +  FLS F+CC+P  V+RE +T  +   VSPEI+S ++SVR  FC++
Sbjct  1    MSLAVTLQDSNDRNLKFLSVFKCCSPVFVIRELETFNEIKPVSPEISSNVVSVRLQFCDK  60

Query  619  FSKLRAVRSLMFFTPASVKPPPQISRDRRFLKCFK  723
            F  +R   SL+F  P+S   PP IS D RFLK  K
Sbjct  61   FKHVREESSLIFLAPSSANSPPHISSDLRFLKFLK  95



>ref|XP_004508414.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Cicer 
arietinum]
Length=581

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL+ FKNL+SLEICGG LTDAG+KNI+++ +L  LNLSQN  LTDK+LE ISG+T+
Sbjct  462  SGTAYLRSFKNLQSLEICGGLLTDAGMKNIREIVSLTQLNLSQNCKLTDKTLELISGMTA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            L SLNVSNSR+T+ GL+ LKPLK L +L+LESCKVTA +IKKL S DLPNL+++RP
Sbjct  522  LRSLNVSNSRVTNEGLRFLKPLKNLCTLSLESCKVTAAEIKKLHSADLPNLISFRP  577



>ref|XP_010906010.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Elaeis guineensis]
Length=528

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  + FKNL+SLE+CGG +TDAGVKNIKDLT+L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  413  GTNCFRCFKNLQSLELCGGSITDAGVKNIKDLTSLTLLNLSQNCNLTDKTLELISGLTAL  472

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHLKPLK L+SL+LESCKVTA +IKKLQ   LPNL++ RPE
Sbjct  473  VSLNVSNSRITNAGLQHLKPLKNLRSLSLESCKVTATEIKKLQLAALPNLISVRPE  528



>ref|XP_010323274.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X3 [Solanum 
lycopersicum]
Length=542

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNL+SL++CGG LTDAGVKNIKDLT+L LLNLSQN  L+D +LE +SGLTS
Sbjct  425  SGTKYLSYFKNLQSLDLCGGRLTDAGVKNIKDLTSLMLLNLSQNLKLSDIALELLSGLTS  484

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNSRITS GLQHLKPLK L+SL LE C VTA++IKKLQ+T LPNLV YRP
Sbjct  485  LVSLNVSNSRITSDGLQHLKPLKNLRSLYLEYCGVTASEIKKLQATTLPNLVRYRP  540



>ref|XP_010323273.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Solanum 
lycopersicum]
Length=567

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNL+SL++CGG LTDAGVKNIKDLT+L LLNLSQN  L+D +LE +SGLTS
Sbjct  450  SGTKYLSYFKNLQSLDLCGGRLTDAGVKNIKDLTSLMLLNLSQNLKLSDIALELLSGLTS  509

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNSRITS GLQHLKPLK L+SL LE C VTA++IKKLQ+T LPNLV YRP
Sbjct  510  LVSLNVSNSRITSDGLQHLKPLKNLRSLYLEYCGVTASEIKKLQATTLPNLVRYRP  565



>ref|XP_010906009.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Elaeis guineensis]
Length=577

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  + FKNL+SLE+CGG +TDAGVKNIKDLT+L LLNLSQN +LTDK+LE ISGLT+L
Sbjct  462  GTNCFRCFKNLQSLELCGGSITDAGVKNIKDLTSLTLLNLSQNCNLTDKTLELISGLTAL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHLKPLK L+SL+LESCKVTA +IKKLQ   LPNL++ RPE
Sbjct  522  VSLNVSNSRITNAGLQHLKPLKNLRSLSLESCKVTATEIKKLQLAALPNLISVRPE  577



>ref|XP_006852826.1| hypothetical protein AMTR_s00033p00180120 [Amborella trichopoda]
 gb|ERN14293.1| hypothetical protein AMTR_s00033p00180120 [Amborella trichopoda]
Length=578

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT+ L++FKNL SLE+CGG +TD  +KNIKDLT+L LLNLSQN +LTDK+LE+ISGLT+L
Sbjct  463  GTSCLRYFKNLESLELCGGLITDDALKNIKDLTSLRLLNLSQNCNLTDKALESISGLTAL  522

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSR+T+AGL HLKPLK LKSL+LE+CKVTA+++KKLQ T LPNLVNYRPE
Sbjct  523  VSLNVSNSRVTNAGLHHLKPLKNLKSLSLEACKVTASELKKLQMTALPNLVNYRPE  578



>ref|XP_004242726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g26540 isoform X1 [Solanum lycopersicum]
Length=591

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNL+SL++CGG LTDAGVKNIKDLT+L LLNLSQN  L+D +LE +SGLTS
Sbjct  474  SGTKYLSYFKNLQSLDLCGGRLTDAGVKNIKDLTSLMLLNLSQNLKLSDIALELLSGLTS  533

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNSRITS GLQHLKPLK L+SL LE C VTA++IKKLQ+T LPNLV YRP
Sbjct  534  LVSLNVSNSRITSDGLQHLKPLKNLRSLYLEYCGVTASEIKKLQATTLPNLVRYRP  589



>ref|XP_006359507.1| PREDICTED: F-box/LRR-repeat protein 14-like [Solanum tuberosum]
Length=578

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNL+SL++CGG LTDAGVKNIKDLT+L LLNLSQN  L+D +LE +SGLTS
Sbjct  461  SGTKYLSYFKNLQSLDLCGGRLTDAGVKNIKDLTSLTLLNLSQNLKLSDTALEFLSGLTS  520

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNSRITS GLQHLKPLK L SL LE C VTA++IKKLQ+T LPNLV YRP
Sbjct  521  LVSLNVSNSRITSDGLQHLKPLKNLHSLYLEYCGVTASEIKKLQATTLPNLVRYRP  576



>emb|CAE02935.3| OSJNBa0014K14.7 [Oryza sativa Japonica Group]
Length=557

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN LK+FKNL+SLE+CGG +TDAGVKNIKDL AL LLNLSQN +LTDKSLE IS LT+
Sbjct  441  AGTNCLKYFKNLQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGNLTDKSLELISRLTA  500

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL+ L+SL+LESCKVTA +IKKLQ   LPNLV+ RPE
Sbjct  501  LVSLNVSNSRVSNSGLHHLKPLQNLRSLSLESCKVTAIEIKKLQLAALPNLVSVRPE  557



>ref|NP_001053240.1| Os04g0503500 [Oryza sativa Japonica Group]
 dbj|BAF15154.1| Os04g0503500 [Oryza sativa Japonica Group]
 dbj|BAG95192.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94111.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61282.1| hypothetical protein OsJ_15365 [Oryza sativa Japonica Group]
Length=581

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN LK+FKNL+SLE+CGG +TDAGVKNIKDL AL LLNLSQN +LTDKSLE IS LT+
Sbjct  465  AGTNCLKYFKNLQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGNLTDKSLELISRLTA  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL+ L+SL+LESCKVTA +IKKLQ   LPNLV+ RPE
Sbjct  525  LVSLNVSNSRVSNSGLHHLKPLQNLRSLSLESCKVTAIEIKKLQLAALPNLVSVRPE  581



>ref|XP_011457338.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457369.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=584

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N LKHFKNL+SLEICGG LTDAGVKN+KDL  L  LNLSQN  LTDKSLE ISGLT+
Sbjct  468  SGANTLKHFKNLQSLEICGGELTDAGVKNLKDLVCLRWLNLSQNRSLTDKSLEVISGLTA  527

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNS IT  GL +LKPLK L+SLTLES  VTA++I+ LQS  LPNLV++RPE
Sbjct  528  LVSLNISNSCITDEGLHYLKPLKNLRSLTLESSMVTASEIRNLQSIALPNLVSFRPE  584



>ref|XP_004287248.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=583

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N LKHFKNL+SLEICGG LTDAGVKN+KDL  L  LNLSQN  LTDKSLE ISGLT+
Sbjct  467  SGANTLKHFKNLQSLEICGGELTDAGVKNLKDLVCLRWLNLSQNRSLTDKSLEVISGLTA  526

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNS IT  GL +LKPLK L+SLTLES  VTA++I+ LQS  LPNLV++RPE
Sbjct  527  LVSLNISNSCITDEGLHYLKPLKNLRSLTLESSMVTASEIRNLQSIALPNLVSFRPE  583



>ref|XP_003580088.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
 ref|XP_010240087.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
 ref|XP_010240088.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
 ref|XP_010240089.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
Length=580

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGTN L++FK L+SLE+CGG +TDAGVKNIKDL AL LLNLSQN +LTD++LE ISGLT+
Sbjct  464  SGTNCLRYFKELQSLELCGGLITDAGVKNIKDLKALTLLNLSQNGNLTDRTLELISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SN+R+++AGL HLK L+ L+SL+L+SCKVTA++IKK+Q   LPNL++ RPE
Sbjct  524  LVSLNLSNTRVSNAGLHHLKLLQNLRSLSLDSCKVTASEIKKIQLASLPNLISVRPE  580



>ref|XP_006647506.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647507.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Oryza 
brachyantha]
Length=582

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            G +  + FKNL+SLE+CGG +TDAGVKNIKDL AL  LNLSQN +LTDK+LE ISGLT+L
Sbjct  467  GASCFRFFKNLQSLEVCGGLITDAGVKNIKDLKALKQLNLSQNVNLTDKTLELISGLTAL  526

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSN+R+++AGL+HLK L+ L+SL+L+SC+VTAN++KKLQ+T LPNL++ RPE
Sbjct  527  VSLNVSNTRVSNAGLRHLKDLQNLRSLSLDSCRVTANEMKKLQATVLPNLISVRPE  582



>gb|EMS49495.1| hypothetical protein TRIUR3_13085 [Triticum urartu]
Length=499

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN L+ FK LRSLE+CGG +TDAGVKNIKDL  L LLNLSQN +LTDK+LE ISGLT+
Sbjct  383  AGTNCLRCFKGLRSLELCGGLITDAGVKNIKDLKDLTLLNLSQNGNLTDKTLEIISGLTA  442

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LV LN+S+SR+++AGL HL+PL+ L+SL+L+SCKVTA +IKKLQ   LPNLV+ RPE
Sbjct  443  LVLLNLSSSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEIKKLQLAALPNLVSVRPE  499



>ref|XP_003575347.1| PREDICTED: F-box/LRR-repeat protein 14-like [Brachypodium distachyon]
Length=582

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            G +  ++FKNL SLE CGG +TD GVKNIK+L AL LLNLSQN++LTDK+LE ISGLT+L
Sbjct  467  GASCFRYFKNLESLEACGGSITDVGVKNIKELKALTLLNLSQNANLTDKTLELISGLTAL  526

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSR+++AGL+HL  L+ L+SLTL+SC+VTAN+I+KLQ+T LPNL+++RPE
Sbjct  527  VSLNVSNSRVSNAGLRHLNALQNLRSLTLDSCRVTANEIRKLQATALPNLISFRPE  582



>ref|XP_002532313.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30065.1| protein binding protein, putative [Ricinus communis]
Length=597

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL++FKNL+SLEICGGGLTD GVKNIKDL  L +LNLSQNS+LTDK+LE ISGLT 
Sbjct  460  SGTKYLQYFKNLQSLEICGGGLTDDGVKNIKDLVHLTVLNLSQNSNLTDKTLELISGLTE  519

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNL  405
            LVSLNVSNS IT+ GL +LKPLK L+SL+LESCKVTA++I KLQST LPNL
Sbjct  520  LVSLNVSNSLITNEGLHYLKPLKNLRSLSLESCKVTASEISKLQSTALPNL  570



>gb|EAY86666.1| hypothetical protein OsI_08050 [Oryza sativa Indica Group]
Length=582

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT+  + FKNL SLE+CGG +TDAGVKNIKDL AL  LNLSQN +LTDK+LE ISGLT+L
Sbjct  467  GTSCFRFFKNLESLEVCGGLITDAGVKNIKDLKALKQLNLSQNVNLTDKTLELISGLTAL  526

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSN+RI++AGL+HLK L+ L+SL+L+SC+VT +++KKLQ+T LPNL++ RPE
Sbjct  527  VSLNVSNTRISNAGLRHLKDLQNLRSLSLDSCRVTTSEVKKLQATVLPNLISVRPE  582



>ref|XP_008813122.1| PREDICTED: F-box/LRR-repeat protein 14-like [Phoenix dactylifera]
 ref|XP_008813123.1| PREDICTED: F-box/LRR-repeat protein 14-like [Phoenix dactylifera]
Length=577

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  ++FK L+SLE+CGG +TDAGVKNIKDLT+L LLNLSQN +LTD++LE ISGLT+L
Sbjct  462  GTNCFRYFKCLQSLELCGGLITDAGVKNIKDLTSLTLLNLSQNCNLTDETLELISGLTAL  521

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSNSRIT+AGLQHLKPLK L+SL+LESCKVTA ++KKLQ   LPNL+  RPE
Sbjct  522  VSLNVSNSRITNAGLQHLKPLKNLRSLSLESCKVTATEMKKLQLVALPNLITVRPE  577



>gb|AAN62335.1|AF506028_2 CTV.1 [Citrus trifoliata]
Length=205

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 79/112 (71%), Gaps = 21/112 (19%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE +S    
Sbjct  105  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLALLNLSQNCNLTDKTLEYVSN---  161

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLV  402
                    SRITSAG              LESCKVTANDIK+LQS DLPNL 
Sbjct  162  --------SRITSAG----------LRHPLESCKVTANDIKRLQSRDLPNLF  195



>ref|XP_010110472.1| hypothetical protein L484_005452 [Morus notabilis]
 gb|EXC26520.1| hypothetical protein L484_005452 [Morus notabilis]
Length=564

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG NYL+ FK L+SLEICGGGLTDAGVK+I+ L +L  LNLSQNS+LTDK+LE ISGLT+
Sbjct  448  SGMNYLRCFKKLQSLEICGGGLTDAGVKHIQGLASLRRLNLSQNSNLTDKTLEFISGLTT  507

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNS IT+ GL +LKPLK L+SLTLES KVTA+ IKKLQS  LPNLV++RPE
Sbjct  508  LVSLNISNSCITNEGLNYLKPLKSLRSLTLESSKVTASGIKKLQSVALPNLVSFRPE  564



>ref|NP_001047418.1| Os02g0613200 [Oryza sativa Japonica Group]
 dbj|BAD19701.1| leucine-rich repeat-like protein [Oryza sativa Japonica Group]
 dbj|BAF09332.1| Os02g0613200 [Oryza sativa Japonica Group]
 gb|EAZ23798.1| hypothetical protein OsJ_07510 [Oryza sativa Japonica Group]
 dbj|BAG93840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=582

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT+  + FKNL SLE+CGG +TDAGVKNIKDL AL  LNLSQN +LTDK+LE ISGLT+L
Sbjct  467  GTSCFRFFKNLESLEVCGGLITDAGVKNIKDLKALKQLNLSQNVNLTDKTLELISGLTAL  526

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSLNVSN+R+++AGL+HLK L+ L+SL+L+SC+VT +++KKLQ+T LPNL++ RPE
Sbjct  527  VSLNVSNTRVSNAGLRHLKDLQNLRSLSLDSCRVTTSEVKKLQATVLPNLISVRPE  582



>gb|EPS69100.1| hypothetical protein M569_05667, partial [Genlisea aurea]
Length=575

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT +L+ F NL+SLEICGGGLTD GV+NIK L +L LLNLSQN+HLTDKSLE ISGL  
Sbjct  459  SGTGFLQCFTNLQSLEICGGGLTDVGVENIKGLVSLTLLNLSQNNHLTDKSLEFISGLVQ  518

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNSR+T  GL HLK LK L+SLTLES KVTA DIKKL  T LP+LV++RPE
Sbjct  519  LVSLNMSNSRVTGTGLLHLKTLKNLRSLTLESSKVTAGDIKKLHVTYLPHLVSFRPE  575



>gb|ADM75223.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75229.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75233.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75239.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75244.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75249.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75251.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75252.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75254.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75255.1| leucine rich repeat-like protein, partial [Picea sitchensis]
Length=137

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT+ L++FK L+SLE+CGG +TDAGVKNIKDLT++  LNLSQNSHLTD +LE+ISG+T+L
Sbjct  22   GTSCLRYFKKLQSLELCGGSITDAGVKNIKDLTSMMSLNLSQNSHLTDGALESISGMTAL  81

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYR  393
            VSLN+SN+R+T+AGLQHL+PLK L SL+L++CKVT  +I+KLQ+T LPNL   R
Sbjct  82   VSLNISNTRVTNAGLQHLRPLKNLTSLSLQACKVTWPEIRKLQATALPNLAGVR  135



>ref|XP_004953091.1| PREDICTED: putative adenylate cyclase regulatory protein-like 
isoform X1 [Setaria italica]
 ref|XP_004953092.1| PREDICTED: putative adenylate cyclase regulatory protein-like 
isoform X2 [Setaria italica]
Length=582

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            G N  + FKNL+SLE+CGG +TDAGVKNIKDL AL  LNLSQN +LTDK+LE ISGLT+L
Sbjct  467  GANCFRCFKNLKSLEVCGGFITDAGVKNIKDLKALTQLNLSQNINLTDKTLELISGLTAL  526

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            V+LNVSNSR+++AGL+HLK ++ L+SL+L+S +VTAN++KKL++T LPNL++ RPE
Sbjct  527  VNLNVSNSRVSNAGLKHLKDMQNLRSLSLDSTRVTANEMKKLRATTLPNLISMRPE  582



>gb|ADM75240.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75256.1| leucine rich repeat-like protein, partial [Picea sitchensis]
Length=137

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT+ L++FK L+SLE+CGG +TDAGVKNIKDLT++  LNLSQNSHLTD +LE ISG+T+L
Sbjct  22   GTSCLRYFKKLQSLELCGGSITDAGVKNIKDLTSMMSLNLSQNSHLTDGALEFISGMTAL  81

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYR  393
            VSLN+SN+R+T+AGLQHL+PLK L SL+L++CKVT  +I+KLQ+T LPNL   R
Sbjct  82   VSLNISNTRVTNAGLQHLRPLKNLTSLSLQACKVTWPEIRKLQATALPNLAGVR  135



>gb|ADM75221.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75222.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75224.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75225.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75226.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75227.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75228.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75230.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75231.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75232.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75234.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75235.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75236.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75237.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75238.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75241.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75242.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75243.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75245.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75246.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75247.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75248.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75250.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75253.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75257.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75258.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75259.1| leucine rich repeat-like protein, partial [Picea sitchensis]
 gb|ADM75260.1| leucine rich repeat-like protein, partial [Picea sitchensis]
Length=137

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT+ L++FK L+SLE+CGG +TDAGVKNIKDLT++  LNLSQNSHLTD +LE ISG+T+L
Sbjct  22   GTSCLRYFKKLQSLELCGGSITDAGVKNIKDLTSMMSLNLSQNSHLTDGALEFISGMTAL  81

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYR  393
            +SLN+SN+R+T+AGLQHL+PLK L SL+L++CKVT  +I+KLQ+T LPNL   R
Sbjct  82   ISLNISNTRVTNAGLQHLRPLKNLTSLSLQACKVTWPEIRKLQATALPNLAGVR  135



>ref|XP_004978117.1| PREDICTED: F-box/LRR-repeat protein 13-like [Setaria italica]
Length=591

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN  + FKNL+SLE+CGG +TDAGVKNIKDL AL LLNLSQN +LTDK+LE ISGLT+
Sbjct  475  AGTNCFRFFKNLQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGNLTDKTLELISGLTA  534

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL+ L+SL+LESC+VT  +IKKL+   LPNL++ RPE
Sbjct  535  LVSLNVSNSRVSNSGLHHLKPLQNLRSLSLESCRVTPTEIKKLRLAALPNLISVRPE  591



>ref|XP_002448130.1| hypothetical protein SORBIDRAFT_06g021780 [Sorghum bicolor]
 gb|EES12458.1| hypothetical protein SORBIDRAFT_06g021780 [Sorghum bicolor]
Length=581

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N  + FKNL+SLE+CGG +TDAGVKNIKDL AL LLNLSQN +LTDK+LE ISGLT+
Sbjct  465  SGMNCFRFFKNLQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGNLTDKTLELISGLTA  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL  L+SL+LESC+VTA++I KL+   LPNL++ RPE
Sbjct  525  LVSLNVSNSRVSNSGLHHLKPLLNLRSLSLESCRVTASEIDKLRLVALPNLISVRPE  581



>tpg|DAA37066.1| TPA: hypothetical protein ZEAMMB73_067914 [Zea mays]
Length=115

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  722  LKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTslvsln  543
             + FKN++SLE+CGG +TDAGVKNIKDL AL LLNLSQN  LTDK+LE ISGLT+LVSLN
Sbjct  4    FRFFKNIQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGKLTDKTLELISGLTALVSLN  63

Query  542  vsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            VSNSR++++GL HLKPL+ L+SL+LESC+VTA+++ KL+   LPNL++ RPE
Sbjct  64   VSNSRVSNSGLHHLKPLQNLRSLSLESCRVTASEMDKLRLVALPNLISVRPE  115



>ref|NP_001147302.1| regulatory subunit [Zea mays]
 ref|XP_008643583.1| PREDICTED: regulatory subunit isoform X1 [Zea mays]
 ref|XP_008643584.1| PREDICTED: regulatory subunit isoform X1 [Zea mays]
 gb|ACG26679.1| regulatory subunit [Zea mays]
 gb|AFW72318.1| regulatory subunit isoform 1 [Zea mays]
 gb|AFW72319.1| regulatory subunit isoform 2 [Zea mays]
Length=582

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GTN  ++FKNL SLE+CGG +TDAGVKNIKDL AL LLNLSQN++LTDK+LE ISGLT+L
Sbjct  467  GTNCFRYFKNLVSLEVCGGFVTDAGVKNIKDLKALTLLNLSQNANLTDKTLELISGLTAL  526

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            ++LNVSNSR+++AGL+HL  L  L+SL+L+S +VTAN+++KL++T L NL++ RPE
Sbjct  527  INLNVSNSRVSNAGLKHLNDLHNLRSLSLDSTRVTANEMRKLRATVLHNLISMRPE  582



>ref|NP_001141453.1| uncharacterized protein LOC100273563 [Zea mays]
 ref|XP_008667527.1| PREDICTED: uncharacterized protein LOC100273563 isoform X1 [Zea 
mays]
 ref|XP_008667528.1| PREDICTED: uncharacterized protein LOC100273563 isoform X1 [Zea 
mays]
 gb|ACF86403.1| unknown [Zea mays]
 tpg|DAA37064.1| TPA: regulatory subunit [Zea mays]
Length=581

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG +  + FKN++SLE+CGG +TDAGVKNIKDL AL LLNLSQN  LTDK+LE ISGLT+
Sbjct  465  SGMSCFRFFKNIQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGKLTDKTLELISGLTA  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR++++GL HLKPL+ L+SL+LESC+VTA+++ KL+   LPNL++ RPE
Sbjct  525  LVSLNVSNSRVSNSGLHHLKPLQNLRSLSLESCRVTASEMDKLRLVALPNLISVRPE  581



>gb|ACG43200.1| regulatory subunit [Zea mays]
Length=581

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG +  + FKN++SLE+CGG +TDAGVKNIKDL AL LLNLSQN  LTDK+LE ISGLT+
Sbjct  465  SGMSCFRFFKNIQSLEVCGGLITDAGVKNIKDLKALTLLNLSQNGKLTDKTLELISGLTA  524

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSR+++ GL HLKPL+ L+SL+LESC+VTA+++ KL+   LPNL++ RPE
Sbjct  525  LVSLNVSNSRVSNLGLHHLKPLQNLRSLSLESCRVTASEMDKLRLVALPNLISVRPE  581



>gb|EMT00676.1| hypothetical protein F775_32177 [Aegilops tauschii]
Length=587

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            +GTN L+ FK LRSLE+CGG +TDAGVKNIKDL  L LLNLSQN +LTDK+LE ISGLT+
Sbjct  464  AGTNCLRCFKGLRSLELCGGLITDAGVKNIKDLKDLTLLNLSQNGNLTDKTLEIISGLTA  523

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLV  402
            LVSLN+S+SR+++AGL HL+PL+ L+SL+L+SCKVTA +IKKLQ   LPNL+
Sbjct  524  LVSLNLSSSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEIKKLQLAALPNLM  575



>gb|KDO52277.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=472

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 81/117 (69%), Gaps = 31/117 (26%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAG                               LT 
Sbjct  387  SGAAYLRNFKNLRSLEICGGGLTDAG-------------------------------LTG  415

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNSRITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  416  LVSLNVSNSRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  472



>ref|XP_009762906.1| PREDICTED: toll-like receptor 13 isoform X3 [Nicotiana sylvestris]
Length=543

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNLRSL++CGG LTDAGVKN+KDL++L  LNLSQN  LT+ +LE +SGLTS
Sbjct  426  SGTKYLSYFKNLRSLDLCGGRLTDAGVKNMKDLSSLMFLNLSQNLKLTNTALEYLSGLTS  485

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GLQ+LKPLK L+SL LE C VTA +IKKLQ+  L NL  YRP+
Sbjct  486  LVSLNVSNSSITNDGLQYLKPLKNLRSLYLEFCGVTACEIKKLQAKALRNLARYRPD  542



>ref|XP_009762905.1| PREDICTED: toll-like receptor 13 isoform X2 [Nicotiana sylvestris]
Length=591

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNLRSL++CGG LTDAGVKN+KDL++L  LNLSQN  LT+ +LE +SGLTS
Sbjct  474  SGTKYLSYFKNLRSLDLCGGRLTDAGVKNMKDLSSLMFLNLSQNLKLTNTALEYLSGLTS  533

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GLQ+LKPLK L+SL LE C VTA +IKKLQ+  L NL  YRP+
Sbjct  534  LVSLNVSNSSITNDGLQYLKPLKNLRSLYLEFCGVTACEIKKLQAKALRNLARYRPD  590



>ref|XP_009762904.1| PREDICTED: toll-like receptor 13 isoform X1 [Nicotiana sylvestris]
Length=592

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +FKNLRSL++CGG LTDAGVKN+KDL++L  LNLSQN  LT+ +LE +SGLTS
Sbjct  475  SGTKYLSYFKNLRSLDLCGGRLTDAGVKNMKDLSSLMFLNLSQNLKLTNTALEYLSGLTS  534

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLNVSNS IT+ GLQ+LKPLK L+SL LE C VTA +IKKLQ+  L NL  YRP+
Sbjct  535  LVSLNVSNSSITNDGLQYLKPLKNLRSLYLEFCGVTACEIKKLQAKALRNLARYRPD  591



>emb|CDP10490.1| unnamed protein product [Coffea canephora]
Length=579

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG N L +FKNL+SL++CGG LTDAGVKNIK LT+L +LNLSQN  LTD +L+ ISGL +
Sbjct  462  SGVNCLSYFKNLQSLDLCGGKLTDAGVKNIKYLTSLMILNLSQNLDLTDTALKFISGLVA  521

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LV LNVS SRIT+ GL++LKPLK L SL L+ C VT ++I+KLQS  LPNLV +RPE
Sbjct  522  LVCLNVSYSRITNEGLEYLKPLKHLSSLYLDFCNVTGSEIRKLQSKFLPNLVRFRPE  578



>ref|XP_002980094.1| hypothetical protein SELMODRAFT_419616 [Selaginella moellendorffii]
 ref|XP_002992678.1| hypothetical protein SELMODRAFT_162512 [Selaginella moellendorffii]
 gb|EFJ06263.1| hypothetical protein SELMODRAFT_162512 [Selaginella moellendorffii]
 gb|EFJ18964.1| hypothetical protein SELMODRAFT_419616 [Selaginella moellendorffii]
Length=578

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            G   L+HFK L+SLE+CGGG+TD GVK++KDLT L  LNLSQN  LTD++LEA+SGLT L
Sbjct  463  GIGSLRHFKKLQSLEVCGGGITDVGVKSLKDLTDLTYLNLSQNGQLTDQALEALSGLTKL  522

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYR  393
            VSLNV NS +T+AGLQHL PLK L SL L+SCKVT   I+KLQ++ LPNLV  R
Sbjct  523  VSLNVGNSSVTNAGLQHLLPLKNLTSLALQSCKVTLWAIQKLQASSLPNLVIVR  576



>ref|XP_010313811.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313812.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313813.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313814.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
Length=554

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +F+NL+SL++CGG LTD GV+NIKDL+ L  LNLSQN +LTDK+LE +SG+  
Sbjct  438  SGTKYLTYFRNLQSLDLCGGTLTDTGVENIKDLSYLMFLNLSQNRNLTDKTLELLSGMKL  497

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LV LNVSNS IT+ GL++LKPLK L +L LE C VT+ +IKKLQ   L NLV YRP
Sbjct  498  LVYLNVSNSCITNDGLKYLKPLKNLHTLDLEYCNVTSFEIKKLQDNVLLNLVRYRP  553



>ref|XP_010313815.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Solanum 
lycopersicum]
Length=505

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +F+NL+SL++CGG LTD GV+NIKDL+ L  LNLSQN +LTDK+LE +SG+  
Sbjct  389  SGTKYLTYFRNLQSLDLCGGTLTDTGVENIKDLSYLMFLNLSQNRNLTDKTLELLSGMKL  448

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LV LNVSNS IT+ GL++LKPLK L +L LE C VT+ +IKKLQ   L NLV YRP
Sbjct  449  LVYLNVSNSCITNDGLKYLKPLKNLHTLDLEYCNVTSFEIKKLQDNVLLNLVRYRP  504



>ref|XP_009621391.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=591

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL + KNL+SL++CGG LTDAGVKNIKDL++L  LNLSQN  LT+ +LE +SGLTS
Sbjct  475  SGAKYLSYLKNLQSLDLCGGRLTDAGVKNIKDLSSLMFLNLSQNLKLTNTALEYLSGLTS  534

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNS IT+ GLQ+LKPLK L+SL LE C VT  +IKKLQ+  L NL  YRP+
Sbjct  535  LVSLNISNSSITNDGLQYLKPLKNLRSLYLEFCGVTVCEIKKLQAKALRNLARYRPQ  591



>ref|XP_009621390.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL + KNL+SL++CGG LTDAGVKNIKDL++L  LNLSQN  LT+ +LE +SGLTS
Sbjct  476  SGAKYLSYLKNLQSLDLCGGRLTDAGVKNIKDLSSLMFLNLSQNLKLTNTALEYLSGLTS  535

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            LVSLN+SNS IT+ GLQ+LKPLK L+SL LE C VT  +IKKLQ+  L NL  YRP+
Sbjct  536  LVSLNISNSSITNDGLQYLKPLKNLRSLYLEFCGVTVCEIKKLQAKALRNLARYRPQ  592



>ref|XP_009595107.1| PREDICTED: F-box/LRR-repeat protein 14-like [Nicotiana tomentosiformis]
Length=556

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SGT YL +F+NL+SL++CGG LTDAGV+NIKDL++L  LNLSQN +LTDK+LE +SGLT 
Sbjct  438  SGTKYLAYFRNLQSLDLCGGALTDAGVENIKDLSSLMFLNLSQNRNLTDKTLELLSGLTL  497

Query  557  lvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            LVSLNVSNS IT+ GLQHLKPLK L+SL LE C VTA++I KLQ+  LPNLV YRP
Sbjct  498  LVSLNVSNSCITNHGLQHLKPLKNLRSLDLEYCNVTASEIMKLQTNALPNLVRYRP  553



>ref|XP_009796216.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X4 [Nicotiana 
sylvestris]
Length=446

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT YL +F+NL+SL++CGG LTDAGV+NIKDL++L  LNLSQN +LTDK+LE +SGLT L
Sbjct  329  GTKYLAYFRNLQSLDLCGGVLTDAGVENIKDLSSLMFLNLSQNRNLTDKTLELLSGLTLL  388

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            V LNVSNS IT+ GLQ+LKPLK L+SL LE C VTA +IKKLQ+  LPNLV YRP
Sbjct  389  VCLNVSNSCITNDGLQYLKPLKNLRSLDLEYCNVTAFEIKKLQANVLPNLVRYRP  443



>ref|XP_009796214.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Nicotiana 
sylvestris]
Length=511

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT YL +F+NL+SL++CGG LTDAGV+NIKDL++L  LNLSQN +LTDK+LE +SGLT L
Sbjct  394  GTKYLAYFRNLQSLDLCGGVLTDAGVENIKDLSSLMFLNLSQNRNLTDKTLELLSGLTLL  453

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            V LNVSNS IT+ GLQ+LKPLK L+SL LE C VTA +IKKLQ+  LPNLV YRP
Sbjct  454  VCLNVSNSCITNDGLQYLKPLKNLRSLDLEYCNVTAFEIKKLQANVLPNLVRYRP  508



>ref|XP_009796213.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            GT YL +F+NL+SL++CGG LTDAGV+NIKDL++L  LNLSQN +LTDK+LE +SGLT L
Sbjct  440  GTKYLAYFRNLQSLDLCGGVLTDAGVENIKDLSSLMFLNLSQNRNLTDKTLELLSGLTLL  499

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRP  390
            V LNVSNS IT+ GLQ+LKPLK L+SL LE C VTA +IKKLQ+  LPNLV YRP
Sbjct  500  VCLNVSNSCITNDGLQYLKPLKNLRSLDLEYCNVTAFEIKKLQANVLPNLVRYRP  554



>ref|XP_001758973.1| predicted protein [Physcomitrella patens]
 gb|EDQ76042.1| predicted protein [Physcomitrella patens]
Length=584

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            G   L+HFK L++LE+CGGG+TDAGV++IKDLT+L  LNLSQN  LTD SL+ +SG+ +L
Sbjct  469  GMACLRHFKKLQTLELCGGGITDAGVRSIKDLTSLTSLNLSQNMRLTDNSLQYLSGMKNL  528

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYR  393
            VSLN++NSR+T+AGLQHL+PL  L SL L+ CKVT   +++LQ+T LP+L   R
Sbjct  529  VSLNLANSRVTNAGLQHLRPLTNLTSLALQDCKVTLPAVERLQATYLPSLTVIR  582



>gb|KDO52281.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=469

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTs  558
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISGLT 
Sbjct  387  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGLTG  446

Query  557  lvslnvsnSRITSAG  513
            LVSLNVSNSRITSAG
Sbjct  447  LVSLNVSNSRITSAG  461



>ref|XP_001780819.1| predicted protein [Physcomitrella patens]
 gb|EDQ54376.1| predicted protein [Physcomitrella patens]
Length=564

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  734  GTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGLTsl  555
            G   L+HFKNL+SLE+CGGG+TD GV +IKDLT L  LNLS N  LTD+SL+ +SG+ +L
Sbjct  449  GMARLRHFKNLQSLELCGGGITDVGVSSIKDLTLLTSLNLSHNLRLTDRSLQYLSGMENL  508

Query  554  vslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNL  405
            VSLNV+NS++T+AGLQHL+PL KL SL L+ CKVT   +  L++T LPNL
Sbjct  509  VSLNVANSKVTNAGLQHLRPLTKLTSLALQGCKVTRTAVDHLKATSLPNL  558



>gb|ACJ85778.1| unknown [Medicago truncatula]
Length=81

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  593  DKSLEAISGLTslvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDL  414
            DK++E I+GLT+LVSLN+SN+RITSAGLQHLK LK L+SLTLESCKVTANDIKK +   L
Sbjct  13   DKTVELIAGLTALVSLNLSNTRITSAGLQHLKTLKNLRSLTLESCKVTANDIKKFKLIHL  72

Query  413  PNLVNYRPE  387
            PNLV++RPE
Sbjct  73   PNLVSFRPE  81



>gb|KDO52282.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=448

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -3

Query  737  SGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDltalnllnlsqnshlTDKSLEAISGL  564
            SG  YL++FKNLRSLEICGGGLTDAGVK+IKDL++L LLNLSQN +LTDK+LE ISG+
Sbjct  387  SGAAYLRNFKNLRSLEICGGGLTDAGVKHIKDLSSLTLLNLSQNCNLTDKTLELISGI  444



>gb|AIE39571.1| F-box/LRR repeat protein, partial [Humulus lupulus]
Length=77

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  593  DKSLEAISGLTslvslnvsnSRITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDL  414
            +K+LE ISGLT+L+SLN+SNS +T+AGLQ+LKPLK L+SLTLESCKVTA++IK LQ   L
Sbjct  9    NKTLELISGLTTLLSLNMSNSCVTNAGLQYLKPLKNLRSLTLESCKVTASEIKILQCVAL  68

Query  413  PNLVNYRPE  387
            PNL+N+RPE
Sbjct  69   PNLINFRPE  77



>ref|XP_006427462.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 gb|ESR40702.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
Length=529

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -3

Query  530  RITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            RITSAGL+HLKPLK L+SLTLESCKVTANDIK+LQS DLPNLV++RPE
Sbjct  482  RITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE  529



>ref|XP_007215815.1| hypothetical protein PRUPE_ppa004098mg [Prunus persica]
 gb|EMJ17014.1| hypothetical protein PRUPE_ppa004098mg [Prunus persica]
Length=530

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -3

Query  530  RITSAGlqhlkplkklksltLESCKVTANDIKKLQSTDLPNLVNYRPE  387
            RIT++GL+HLK LK LKSLTLESCKVTAN+I+KLQ TDLPNLV++RPE
Sbjct  483  RITNSGLRHLKTLKNLKSLTLESCKVTANEIRKLQLTDLPNLVSFRPE  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515