BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015G07

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFR58665.1|  jasmonoyl-L-isoleucine hydrolase 1                      268   1e-83   Nicotiana attenuata
ref|XP_009630468.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    267   4e-83   Nicotiana tomentosiformis
ref|XP_006343020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    266   9e-83   Solanum tuberosum [potatoes]
ref|XP_009786385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    264   4e-82   Nicotiana sylvestris
ref|XP_004235624.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    262   3e-81   Solanum lycopersicum
emb|CDO97948.1|  unnamed protein product                                258   3e-80   Coffea canephora [robusta coffee]
ref|XP_002515893.1|  IAA-amino acid hydrolase ILR1 precursor, put...    251   3e-77   Ricinus communis
ref|XP_007150549.1|  hypothetical protein PHAVU_005G1617000g            243   4e-77   Phaseolus vulgaris [French bean]
ref|XP_004146834.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    251   4e-77   Cucumis sativus [cucumbers]
gb|KDP40816.1|  hypothetical protein JCGZ_24815                         251   6e-77   Jatropha curcas
ref|XP_007024408.1|  Peptidase M20/M25/M40 family protein               250   2e-76   
ref|XP_011013030.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    249   3e-76   Populus euphratica
ref|XP_008244751.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    249   4e-76   Prunus mume [ume]
ref|XP_004297620.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    249   4e-76   Fragaria vesca subsp. vesca
ref|XP_003546640.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    248   8e-76   Glycine max [soybeans]
ref|XP_008447583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    248   8e-76   Cucumis melo [Oriental melon]
ref|XP_003543612.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    248   1e-75   Glycine max [soybeans]
gb|ACZ56438.1|  IAA-amino acid hydrolase                                248   1e-75   Populus tomentosa [Chinese white poplar]
ref|XP_002303219.1|  putative auxin-amidohydrolase precursor fami...    247   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_003597383.1|  IAA-amino acid hydrolase ILR1-like protein         247   2e-75   
ref|XP_007215385.1|  hypothetical protein PRUPE_ppa005752mg             247   2e-75   Prunus persica
ref|XP_003597649.1|  IAA-amino acid hydrolase ILR1-like protein         245   1e-74   
gb|AES67900.2|  IAA-amino acid hydrolase ILR1-like protein              245   1e-74   Medicago truncatula
gb|ABF55219.1|  auxin conjugate hydrolase                               245   1e-74   Medicago truncatula
ref|XP_006426465.1|  hypothetical protein CICLE_v10025591mg             244   2e-74   Citrus clementina [clementine]
ref|XP_002281321.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    244   2e-74   Vitis vinifera
ref|XP_006466100.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    244   3e-74   Citrus sinensis [apfelsine]
gb|ABW34918.1|  IAA-amino acid hydrolase 3                              238   4e-74   Eucommia ulmoides
gb|KDO58672.1|  hypothetical protein CISIN_1g013076mg                   244   4e-74   Citrus sinensis [apfelsine]
ref|XP_004486800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    244   4e-74   Cicer arietinum [garbanzo]
emb|CAN70580.1|  hypothetical protein VITISV_033718                     243   7e-74   Vitis vinifera
gb|KJB70347.1|  hypothetical protein B456_011G068400                    243   9e-74   Gossypium raimondii
ref|XP_008387506.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    243   1e-73   
emb|CAG32961.1|  putative auxin-amidohydrolase precursor                242   1e-73   Populus tremula x Populus alba [gray poplar]
ref|XP_003597644.1|  IAA-amino acid hydrolase ILR1-like protein         241   3e-73   Medicago truncatula
ref|XP_004287508.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    241   6e-73   Fragaria vesca subsp. vesca
gb|AFK37903.1|  unknown                                                 239   3e-72   Medicago truncatula
ref|XP_010244354.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    239   3e-72   Nelumbo nucifera [Indian lotus]
gb|KHG30726.1|  IAA-amino acid hydrolase ILR1-like 4                    239   4e-72   Gossypium arboreum [tree cotton]
ref|XP_011072466.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    238   8e-72   Sesamum indicum [beniseed]
ref|XP_006451369.1|  hypothetical protein CICLE_v100084061mg            233   2e-71   
gb|KDO55922.1|  hypothetical protein CISIN_1g013332mg                   233   2e-71   Citrus sinensis [apfelsine]
ref|XP_008242448.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    237   2e-71   Prunus mume [ume]
ref|XP_007202052.1|  hypothetical protein PRUPE_ppa005751mg             237   2e-71   Prunus persica
ref|XP_011077949.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    236   3e-71   Sesamum indicum [beniseed]
ref|XP_011077948.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    236   3e-71   Sesamum indicum [beniseed]
ref|XP_007135595.1|  hypothetical protein PHAVU_010G142600g             236   3e-71   Phaseolus vulgaris [French bean]
gb|EYU21408.1|  hypothetical protein MIMGU_mgv1a006385mg                236   5e-71   Erythranthe guttata [common monkey flower]
ref|XP_003597645.1|  IAA-amino acid hydrolase ILR1-like protein         234   1e-70   Medicago truncatula
ref|XP_009338136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    234   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_006451368.1|  hypothetical protein CICLE_v100084061mg            232   6e-70   Citrus clementina [clementine]
gb|KHN39276.1|  IAA-amino acid hydrolase ILR1-like 4                    231   8e-70   Glycine soja [wild soybean]
gb|KDO55917.1|  hypothetical protein CISIN_1g013332mg                   232   9e-70   Citrus sinensis [apfelsine]
ref|XP_006475371.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    232   9e-70   Citrus sinensis [apfelsine]
ref|XP_003531633.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    232   1e-69   Glycine max [soybeans]
ref|XP_009352597.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    231   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_003597384.1|  IAA-amino acid hydrolase ILR1-like protein         231   2e-69   Medicago truncatula
ref|XP_010088385.1|  IAA-amino acid hydrolase ILR1-like 4               231   2e-69   Morus notabilis
ref|XP_003530016.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    231   4e-69   
gb|KHN32672.1|  IAA-amino acid hydrolase ILR1-like 4                    236   5e-69   Glycine soja [wild soybean]
ref|XP_010062569.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    229   1e-68   Eucalyptus grandis [rose gum]
ref|XP_011077950.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    226   2e-68   
ref|XP_009624362.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    228   4e-68   Nicotiana tomentosiformis
ref|XP_004158429.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    227   7e-68   
ref|XP_008450808.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    227   8e-68   Cucumis melo [Oriental melon]
emb|CDY22869.1|  BnaA06g02080D                                          227   9e-68   Brassica napus [oilseed rape]
gb|KDO55916.1|  hypothetical protein CISIN_1g013332mg                   227   1e-67   Citrus sinensis [apfelsine]
ref|XP_008380826.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    227   1e-67   
ref|XP_004135685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    226   2e-67   Cucumis sativus [cucumbers]
ref|XP_006353512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    226   2e-67   Solanum tuberosum [potatoes]
ref|XP_010690089.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    226   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009147731.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    226   2e-67   Brassica rapa
ref|NP_001043347.1|  Os01g0560000                                       226   4e-67   
ref|XP_010479682.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    225   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010462018.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    225   5e-67   Camelina sativa [gold-of-pleasure]
emb|CDX87841.1|  BnaC06g09030D                                          225   6e-67   
ref|XP_010500762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    225   6e-67   Camelina sativa [gold-of-pleasure]
gb|KFK35825.1|  hypothetical protein AALP_AA4G042000                    223   6e-67   Arabis alpina [alpine rockcress]
ref|NP_175587.1|  IAA-amino acid hydrolase IAR3                         224   7e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528938.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    224   9e-67   Tarenaya hassleriana [spider flower]
ref|XP_010535205.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    224   1e-66   Tarenaya hassleriana [spider flower]
sp|Q84XG9.1|ILL1_ORYSI  RecName: Full=IAA-amino acid hydrolase IL...    224   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_004510337.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    224   1e-66   
ref|XP_006646005.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    224   2e-66   Oryza brachyantha
ref|XP_002891660.1|  IAA-alanine resistant 3                            223   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_008806725.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    223   3e-66   Phoenix dactylifera
gb|EYU30670.1|  hypothetical protein MIMGU_mgv1a006375mg                223   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_002283047.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    223   3e-66   Vitis vinifera
ref|XP_010924947.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    223   4e-66   Elaeis guineensis
gb|KDP33760.1|  hypothetical protein JCGZ_07331                         223   5e-66   Jatropha curcas
emb|CAN61999.1|  hypothetical protein VITISV_007874                     222   5e-66   Vitis vinifera
emb|CDY43926.1|  BnaA05g15360D                                          222   7e-66   Brassica napus [oilseed rape]
ref|NP_001288913.1|  IAA-amino acid hydrolase ILR1-like 4 precursor     222   7e-66   Brassica rapa
gb|ABB60090.1|  IAA-amino acid hydrolase 3                              222   8e-66   Brassica rapa
ref|XP_006307542.1|  hypothetical protein CARUB_v10009165mg             222   9e-66   
dbj|BAJ94305.1|  predicted protein                                      221   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007012935.1|  Peptidase M20/M25/M40 family protein isoform 1     221   1e-65   
ref|XP_010049575.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    221   1e-65   Eucalyptus grandis [rose gum]
ref|XP_007012939.1|  Peptidase M20/M25/M40 family protein isoform 5     221   2e-65   
gb|ABB16358.1|  IAA hydrolase                                           221   2e-65   Phalaenopsis hybrid cultivar
ref|XP_010545642.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    221   3e-65   Tarenaya hassleriana [spider flower]
gb|EMT10443.1|  IAA-amino acid hydrolase ILR1-like protein 1            220   3e-65   
gb|AAU06081.1|  auxin amidohydrolase                                    220   3e-65   Triticum aestivum [Canadian hard winter wheat]
gb|KDO55915.1|  hypothetical protein CISIN_1g013332mg                   219   5e-65   Citrus sinensis [apfelsine]
gb|ACU18798.1|  unknown                                                 212   5e-65   Glycine max [soybeans]
emb|CDM83125.1|  unnamed protein product                                219   6e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010231929.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    219   1e-64   Brachypodium distachyon [annual false brome]
ref|XP_009794201.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    219   1e-64   Nicotiana sylvestris
ref|XP_010049762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    219   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006392997.1|  hypothetical protein EUTSA_v10011481mg             218   1e-64   
ref|XP_006392998.1|  hypothetical protein EUTSA_v10011481mg             218   3e-64   Eutrema salsugineum [saltwater cress]
gb|KCW82520.1|  hypothetical protein EUGRSUZ_C03922                     220   4e-64   Eucalyptus grandis [rose gum]
ref|XP_004251653.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    218   4e-64   Solanum lycopersicum
ref|XP_010911155.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    216   1e-63   Elaeis guineensis
ref|XP_004486799.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    216   2e-63   Cicer arietinum [garbanzo]
ref|XP_006853919.1|  hypothetical protein AMTR_s00036p00189900          216   2e-63   Amborella trichopoda
ref|XP_009396760.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    216   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46529.1|  unknown                                                 215   5e-63   Lotus japonicus
ref|XP_008797894.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    214   5e-63   Phoenix dactylifera
ref|XP_002514178.1|  metallopeptidase, putative                         212   1e-62   
gb|KHN11323.1|  IAA-amino acid hydrolase ILR1-like 4                    212   4e-62   Glycine soja [wild soybean]
ref|XP_003530010.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    212   6e-62   
emb|CBI27959.3|  unnamed protein product                                210   1e-61   Vitis vinifera
gb|KJB54328.1|  hypothetical protein B456_009G029600                    208   1e-61   Gossypium raimondii
ref|XP_003531635.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    211   2e-61   Glycine max [soybeans]
gb|KHG25042.1|  IAA-amino acid hydrolase ILR1-like 4                    210   3e-61   Gossypium arboreum [tree cotton]
ref|NP_001242296.1|  uncharacterized protein LOC100789607 precursor     210   3e-61   Glycine max [soybeans]
ref|XP_006585543.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    202   8e-61   Glycine max [soybeans]
gb|ACF84306.1|  unknown                                                 207   1e-60   Zea mays [maize]
gb|KJB65086.1|  hypothetical protein B456_010G080300                    209   1e-60   Gossypium raimondii
ref|NP_001142151.1|  hypothetical protein precursor                     208   2e-60   Zea mays [maize]
gb|KEH18273.1|  IAA-amino acid hydrolase ILR1-like protein              204   3e-60   Medicago truncatula
ref|NP_001242429.1|  uncharacterized protein LOC100790664 precursor     207   3e-60   Glycine max [soybeans]
gb|KJB54330.1|  hypothetical protein B456_009G029600                    207   4e-60   Gossypium raimondii
gb|KJB54329.1|  hypothetical protein B456_009G029600                    207   4e-60   Gossypium raimondii
gb|KJB54327.1|  hypothetical protein B456_009G029600                    207   4e-60   Gossypium raimondii
gb|AFK45080.1|  unknown                                                 201   5e-60   Lotus japonicus
ref|XP_007135596.1|  hypothetical protein PHAVU_010G142700g             206   6e-60   Phaseolus vulgaris [French bean]
emb|CAA73905.1|  JR3 protein                                            206   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968975.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    206   1e-59   Setaria italica
gb|EPS67015.1|  hypothetical protein M569_07761                         205   2e-59   Genlisea aurea
gb|ABF55222.1|  auxin conjugate hydrolase                               205   2e-59   Medicago truncatula
ref|XP_004969012.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    204   9e-59   Setaria italica
ref|XP_008797895.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    202   3e-58   Phoenix dactylifera
ref|XP_006305862.1|  hypothetical protein CARUB_v10010946mg             202   4e-58   Capsella rubella
ref|XP_002891662.1|  hypothetical protein ARALYDRAFT_892161             202   4e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_010451360.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    196   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010483143.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    196   9e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010462020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    196   9e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010479683.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    195   2e-55   Camelina sativa [gold-of-pleasure]
gb|KFK28293.1|  hypothetical protein AALP_AA8G497500                    195   2e-55   Arabis alpina [alpine rockcress]
gb|ABR17898.1|  unknown                                                 195   4e-55   Picea sitchensis
gb|ABK24715.1|  unknown                                                 194   5e-55   Picea sitchensis
ref|XP_010443315.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    193   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010500765.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    193   2e-54   Camelina sativa [gold-of-pleasure]
emb|CDM83724.1|  unnamed protein product                                191   3e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006401299.1|  hypothetical protein EUTSA_v10013558mg             191   9e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006281445.1|  hypothetical protein CARUB_v10027523mg             190   2e-53   Capsella rubella
ref|XP_010500767.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    189   3e-53   
ref|NP_175589.1|  IAA-amino acid hydrolase ILR1-like 5                  189   4e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ABC68429.1|  putative auxin conjugate hydrolase                      179   5e-53   Tragopogon pratensis [Jack-go-to-bed-at-noon]
pdb|1XMB|A  Chain A, X-ray Structure Of Iaa-aminoacid Hydrolase F...    188   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAL59907.1|  IAA-amino acid hydrolase                                188   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200477.1|  IAA-amino acid hydrolase ILR1-like 2                  188   8e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49016.1|  ILL2                                                    187   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ABC68430.1|  putative auxin conjugate hydrolase                      178   1e-52   Tragopogon dubius [yellow salsify]
ref|XP_004969701.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    186   6e-52   Setaria italica
ref|XP_002864473.1|  hypothetical protein ARALYDRAFT_495757             185   1e-51   
gb|KFK27232.1|  hypothetical protein AALP_AA8G354700                    184   3e-51   Arabis alpina [alpine rockcress]
gb|EEC71359.1|  hypothetical protein OsI_03451                          184   3e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001044020.1|  Os01g0706900                                       184   4e-51   
ref|NP_001152128.1|  IAA-amino acid hydrolase ILR1-like 4 precursor     183   6e-51   Zea mays [maize]
ref|XP_008655104.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    183   6e-51   Zea mays [maize]
ref|NP_001288981.1|  IAA-amino acid hydrolase ILR1-like 2 precursor     183   7e-51   Brassica rapa
ref|XP_006646253.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    182   1e-50   Oryza brachyantha
ref|XP_009132189.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    182   1e-50   Brassica rapa
emb|CDY32768.1|  BnaA10g10810D                                          182   1e-50   Brassica napus [oilseed rape]
tpg|DAA57933.1|  TPA: hypothetical protein ZEAMMB73_224624              177   1e-50   
emb|CDX88581.1|  BnaA03g10680D                                          182   2e-50   
gb|KHF97690.1|  IAA-amino acid hydrolase ILR1-like 6                    177   4e-50   Gossypium arboreum [tree cotton]
emb|CDY11910.1|  BnaC03g13360D                                          180   7e-50   Brassica napus [oilseed rape]
ref|XP_002458379.1|  hypothetical protein SORBIDRAFT_03g032500          179   1e-49   Sorghum bicolor [broomcorn]
ref|NP_200476.1|  IAA-amino acid hydrolase ILR1-like 1                  179   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    177   2e-48   Tarenaya hassleriana [spider flower]
ref|NP_001159338.1|  hypothetical protein precursor                     176   2e-48   Zea mays [maize]
ref|XP_007137440.1|  hypothetical protein PHAVU_009G1272001g            171   6e-48   Phaseolus vulgaris [French bean]
emb|CDY32874.1|  BnaC09g33210D                                          175   8e-48   Brassica napus [oilseed rape]
gb|KDP21295.1|  hypothetical protein JCGZ_21766                         174   9e-48   Jatropha curcas
gb|KJB59248.1|  hypothetical protein B456_009G246300                    175   1e-47   Gossypium raimondii
ref|XP_007019095.1|  IAA-leucine resistant-like gene 6 isoform 1        175   1e-47   Theobroma cacao [chocolate]
ref|XP_008778350.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    171   2e-47   
ref|XP_006472793.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    174   2e-47   Citrus sinensis [apfelsine]
ref|XP_009391385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    173   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45331.1|  hypothetical protein MIMGU_mgv1a023576mg                172   6e-47   Erythranthe guttata [common monkey flower]
ref|XP_003567041.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    172   6e-47   
gb|KDO80612.1|  hypothetical protein CISIN_1g011407mg                   173   6e-47   Citrus sinensis [apfelsine]
gb|KDO80611.1|  hypothetical protein CISIN_1g011407mg                   173   7e-47   Citrus sinensis [apfelsine]
ref|XP_006434209.1|  hypothetical protein CICLE_v10000964mg             173   7e-47   Citrus clementina [clementine]
ref|XP_009760823.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    172   1e-46   Nicotiana sylvestris
ref|XP_007039231.1|  IAA-leucine-resistant-like 3                       171   1e-46   Theobroma cacao [chocolate]
gb|KJB64483.1|  hypothetical protein B456_010G051100                    172   1e-46   Gossypium raimondii
ref|XP_010088388.1|  IAA-amino acid hydrolase ILR1-like 5               171   2e-46   Morus notabilis
ref|XP_004241428.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    171   2e-46   
gb|KJB74616.1|  hypothetical protein B456_012G001500                    166   2e-46   Gossypium raimondii
ref|XP_002521309.1|  IAA-amino acid hydrolase ILR1 precursor, put...    170   3e-46   Ricinus communis
ref|XP_004168826.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    166   3e-46   
ref|XP_002306640.1|  hypothetical protein POPTR_0005s20110g             172   3e-46   
ref|XP_007044501.1|  Peptidase M20/M25/M40 family protein, putati...    166   4e-46   
ref|XP_008378480.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    171   5e-46   
ref|XP_009596693.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    169   6e-46   Nicotiana tomentosiformis
gb|KJB74617.1|  hypothetical protein B456_012G001500                    166   7e-46   Gossypium raimondii
gb|ACZ56435.1|  IAA-amino acid hydrolase                                170   8e-46   Populus tomentosa [Chinese white poplar]
gb|KJB74618.1|  hypothetical protein B456_012G001500                    166   1e-45   Gossypium raimondii
ref|XP_011011908.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    170   1e-45   Populus euphratica
ref|XP_002513747.1|  IAA-amino acid hydrolase ILR1 precursor, put...    169   1e-45   Ricinus communis
ref|XP_008381545.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    168   2e-45   
ref|XP_002302231.2|  hypothetical protein POPTR_0002s08300g             169   2e-45   Populus trichocarpa [western balsam poplar]
gb|KHG23253.1|  IAA-amino acid hydrolase ILR1-like 3                    169   2e-45   Gossypium arboreum [tree cotton]
ref|XP_004290879.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    169   2e-45   Fragaria vesca subsp. vesca
ref|XP_010999399.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    169   2e-45   Populus euphratica
gb|KDP37575.1|  hypothetical protein JCGZ_08266                         168   2e-45   Jatropha curcas
ref|XP_002266978.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    168   3e-45   Vitis vinifera
ref|XP_004502492.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    168   4e-45   Cicer arietinum [garbanzo]
ref|XP_003526641.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    167   5e-45   Glycine max [soybeans]
ref|XP_009351899.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    167   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_008466723.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    167   7e-45   Cucumis melo [Oriental melon]
ref|XP_002963174.1|  hypothetical protein SELMODRAFT_141529             166   7e-45   Selaginella moellendorffii
ref|XP_010928552.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    167   7e-45   Elaeis guineensis
ref|XP_006347315.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    167   7e-45   Solanum tuberosum [potatoes]
gb|KJB74615.1|  hypothetical protein B456_012G001500                    166   7e-45   Gossypium raimondii
ref|XP_010100519.1|  IAA-amino acid hydrolase ILR1-like 2               167   8e-45   Morus notabilis
ref|XP_002269424.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    167   8e-45   Vitis vinifera
ref|XP_009351298.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    167   9e-45   Pyrus x bretschneideri [bai li]
ref|XP_006351275.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    167   9e-45   Solanum tuberosum [potatoes]
gb|KJB74614.1|  hypothetical protein B456_012G001500                    166   1e-44   Gossypium raimondii
ref|XP_011009011.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    167   1e-44   Populus euphratica
ref|XP_006378179.1|  hypothetical protein POPTR_0010s04530g             167   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_003602066.1|  IAA-amino acid hydrolase ILR1-like protein         167   1e-44   Medicago truncatula
ref|XP_011027512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    167   1e-44   Populus euphratica
ref|XP_002981614.1|  hypothetical protein SELMODRAFT_421067             165   1e-44   Selaginella moellendorffii
ref|XP_007222851.1|  hypothetical protein PRUPE_ppa008809mg             163   1e-44   
ref|XP_009762344.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    167   2e-44   Nicotiana sylvestris
ref|XP_009592954.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    166   2e-44   Nicotiana tomentosiformis
ref|XP_004149796.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    166   2e-44   Cucumis sativus [cucumbers]
ref|XP_010104509.1|  IAA-amino acid hydrolase ILR1-like 6               166   2e-44   Morus notabilis
ref|XP_007044502.1|  Peptidase M20/M25/M40 family protein, putati...    161   2e-44   
ref|XP_002520216.1|  IAA-amino acid hydrolase ILR1 precursor, put...    166   2e-44   Ricinus communis
gb|KHN35503.1|  IAA-amino acid hydrolase ILR1-like 6                    164   3e-44   Glycine soja [wild soybean]
ref|XP_007217993.1|  hypothetical protein PRUPE_ppa005643mg             164   3e-44   
ref|XP_008234625.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    165   3e-44   Prunus mume [ume]
gb|KGN47720.1|  hypothetical protein Csa_6G384060                       167   4e-44   Cucumis sativus [cucumbers]
gb|EEC81804.1|  hypothetical protein OsI_25527                          162   4e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_007217994.1|  hypothetical protein PRUPE_ppa005643mg             164   6e-44   Prunus persica
emb|CBI32084.3|  unnamed protein product                                168   8e-44   Vitis vinifera
ref|XP_003523432.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    164   8e-44   Glycine max [soybeans]
ref|XP_010243489.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    164   8e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004502777.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    164   1e-43   Cicer arietinum [garbanzo]
ref|XP_008219626.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    164   1e-43   Prunus mume [ume]
ref|XP_004307893.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    163   1e-43   Fragaria vesca subsp. vesca
ref|XP_008244971.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    163   2e-43   
gb|ABR16872.1|  unknown                                                 163   2e-43   Picea sitchensis
ref|XP_010934037.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    162   3e-43   Elaeis guineensis
ref|XP_006478084.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    162   3e-43   Citrus sinensis [apfelsine]
ref|XP_006441277.1|  hypothetical protein CICLE_v10020281mg             162   4e-43   Citrus clementina [clementine]
gb|KDO37850.1|  hypothetical protein CISIN_1g014449mg                   162   4e-43   Citrus sinensis [apfelsine]
ref|XP_010934036.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    162   4e-43   Elaeis guineensis
gb|EAZ39283.1|  hypothetical protein OsJ_23715                          160   5e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006846441.1|  hypothetical protein AMTR_s00018p00068150          161   6e-43   Amborella trichopoda
ref|XP_007223059.1|  hypothetical protein PRUPE_ppa006982mg             160   7e-43   
ref|XP_009405312.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    161   7e-43   
ref|XP_011075876.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    161   7e-43   Sesamum indicum [beniseed]
ref|XP_009414063.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    162   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010268965.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    161   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008783551.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    160   2e-42   Phoenix dactylifera
ref|XP_006652529.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    160   2e-42   Oryza brachyantha
ref|XP_010943800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    160   2e-42   Elaeis guineensis
ref|XP_010034919.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    160   2e-42   Eucalyptus grandis [rose gum]
sp|Q8H3C9.1|ILL7_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    160   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    160   2e-42   
ref|XP_004249219.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    161   2e-42   
ref|XP_006438486.1|  hypothetical protein CICLE_v10031540mg             157   3e-42   
ref|XP_009400482.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    159   3e-42   
ref|XP_003602410.1|  IAA-amino acid hydrolase ILR1-like protein         159   4e-42   
ref|XP_004155341.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    159   5e-42   
ref|XP_002466140.1|  hypothetical protein SORBIDRAFT_01g002090          159   5e-42   
ref|XP_009414584.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    159   5e-42   
ref|XP_002446800.1|  hypothetical protein SORBIDRAFT_06g022860          159   6e-42   
ref|XP_009414583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    159   6e-42   
ref|XP_004135471.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    159   7e-42   
gb|KDO82611.1|  hypothetical protein CISIN_1g013395mg                   156   1e-41   
ref|XP_009360455.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    158   1e-41   
ref|XP_010103068.1|  IAA-amino acid hydrolase ILR1-like 3               158   1e-41   
ref|XP_008389584.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    158   1e-41   
ref|XP_004238716.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    158   2e-41   
ref|XP_006438487.1|  hypothetical protein CICLE_v10031540mg             158   2e-41   
ref|XP_006483777.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    158   2e-41   
ref|XP_008446258.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    158   2e-41   
ref|XP_008353108.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    156   2e-41   
ref|XP_009784160.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    157   2e-41   
emb|CBI19006.3|  unnamed protein product                                158   3e-41   
ref|XP_002284503.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    158   3e-41   
ref|XP_004959131.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    157   3e-41   
ref|XP_009613546.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    157   4e-41   
gb|KDO82610.1|  hypothetical protein CISIN_1g013395mg                   157   5e-41   
gb|KJB77153.1|  hypothetical protein B456_012G123400                    156   6e-41   
gb|EMS55973.1|  IAA-amino acid hydrolase ILR1-like 7                    153   6e-41   
ref|XP_006401620.1|  hypothetical protein EUTSA_v10014131mg             153   7e-41   
ref|XP_007153678.1|  hypothetical protein PHAVU_003G055600g             156   8e-41   
ref|XP_010906094.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    157   8e-41   
ref|XP_004297670.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    156   9e-41   
tpg|DAA36899.1|  TPA: hypothetical protein ZEAMMB73_374396              155   1e-40   
ref|XP_010683632.1|  PREDICTED: IAA-amino acid hydrolase ILR1           155   1e-40   
gb|EMT32321.1|  IAA-amino acid hydrolase ILR1-like protein 4            155   1e-40   
ref|XP_006355931.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    155   1e-40   
ref|XP_004136498.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    155   1e-40   
ref|XP_003523305.2|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    155   1e-40   
ref|XP_006838393.1|  hypothetical protein AMTR_s00002p00075740          155   1e-40   
ref|XP_002459629.1|  hypothetical protein SORBIDRAFT_02g007720          155   2e-40   
emb|CDP10924.1|  unnamed protein product                                153   2e-40   
ref|NP_001150846.1|  IAA-amino acid hydrolase ILR1-like 3 precursor     156   2e-40   
gb|EMS50410.1|  IAA-amino acid hydrolase ILR1-like 2                    154   2e-40   
ref|XP_010251241.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    154   2e-40   
tpg|DAA36900.1|  TPA: IAA-amino acid hydrolase ILR1-like 3              155   2e-40   
ref|XP_009361341.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    153   3e-40   
ref|XP_010268967.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    155   3e-40   
ref|XP_010251233.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    154   4e-40   
ref|XP_010037297.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      154   4e-40   
ref|XP_010530441.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    151   4e-40   
ref|XP_011087079.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    154   5e-40   
gb|EAZ31367.1|  hypothetical protein OsJ_15493                          153   6e-40   
ref|XP_004976258.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    153   7e-40   
ref|XP_002269226.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    153   8e-40   
ref|XP_011069524.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    154   8e-40   
ref|NP_001053339.1|  Os04g0521800                                       153   8e-40   
ref|XP_010246176.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    153   9e-40   
gb|KCW70617.1|  hypothetical protein EUGRSUZ_F03795                     150   9e-40   
dbj|BAK08232.1|  predicted protein                                      152   1e-39   
ref|XP_003557336.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 7    152   1e-39   
ref|XP_009417547.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    153   1e-39   
gb|EMT21700.1|  IAA-amino acid hydrolase ILR1-like protein 7            154   1e-39   
ref|XP_004955918.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    152   1e-39   
ref|XP_009609811.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    150   1e-39   
gb|ACL52754.1|  unknown                                                 150   1e-39   
ref|XP_002975937.1|  hypothetical protein SELMODRAFT_104527             152   1e-39   
dbj|BAG99008.1|  unnamed protein product                                147   2e-39   
ref|XP_011071286.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    154   2e-39   
ref|XP_004955917.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    152   2e-39   
gb|KHN10633.1|  IAA-amino acid hydrolase ILR1-like 4                    151   2e-39   
ref|XP_002968548.1|  hypothetical protein SELMODRAFT_409459             151   2e-39   
ref|XP_010044662.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    152   2e-39   
gb|EMT31863.1|  IAA-amino acid hydrolase ILR1-like protein 8            149   2e-39   
ref|XP_010272050.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    152   3e-39   
ref|XP_007202069.1|  hypothetical protein PRUPE_ppa005951mg             151   4e-39   
ref|XP_003532037.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    151   4e-39   
ref|XP_003628629.1|  IAA-amino acid hydrolase ILR1-like protein         151   5e-39   
dbj|BAK01726.1|  predicted protein                                      151   5e-39   
gb|AFK43667.1|  unknown                                                 150   6e-39   
ref|XP_006658443.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    150   6e-39   
ref|XP_002308453.2|  IAA-amino acid hydrolase 1 family protein          150   7e-39   
ref|NP_001140633.1|  hypothetical protein                               150   8e-39   
gb|KCW48983.1|  hypothetical protein EUGRSUZ_K02598                     150   8e-39   
gb|AFW67046.1|  hypothetical protein ZEAMMB73_649011                    150   9e-39   
gb|EMT31861.1|  IAA-amino acid hydrolase ILR1-like protein 8            151   9e-39   
dbj|BAJ99345.1|  predicted protein                                      150   1e-38   
ref|NP_200225.1|  IAA-amino acid hydrolase ILR1-like 3                  150   1e-38   
ref|XP_002321367.2|  hypothetical protein POPTR_0015s00630g             148   1e-38   
ref|NP_001059294.1|  Os07g0249800                                       147   1e-38   
ref|XP_011046909.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      150   1e-38   
dbj|BAJ90175.1|  predicted protein                                      149   1e-38   
ref|XP_004303517.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      149   2e-38   
ref|NP_001051827.2|  Os03g0836800                                       145   2e-38   
ref|XP_008243488.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      149   2e-38   
gb|KDP32812.1|  hypothetical protein JCGZ_12104                         147   2e-38   
ref|XP_010674873.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    150   2e-38   
dbj|BAK07626.1|  predicted protein                                      149   3e-38   
gb|EMT32322.1|  IAA-amino acid hydrolase ILR1-like protein 4            149   3e-38   
ref|XP_010063397.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    149   3e-38   
ref|XP_010246184.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    149   3e-38   
ref|XP_004955914.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    149   3e-38   
ref|XP_002275866.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like      149   3e-38   
gb|EYU22976.1|  hypothetical protein MIMGU_mgv1a005140mg                149   4e-38   
ref|XP_010227391.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    149   4e-38   
ref|XP_010229420.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    148   4e-38   
dbj|BAH20262.1|  AT3G02875                                              144   4e-38   
ref|XP_011003274.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    149   4e-38   
ref|XP_007204388.1|  hypothetical protein PRUPE_ppa005836mg             149   4e-38   
ref|XP_008243485.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    148   4e-38   
ref|XP_010093789.1|  IAA-amino acid hydrolase ILR1-like 7               148   5e-38   
ref|XP_002466139.1|  hypothetical protein SORBIDRAFT_01g002080          147   6e-38   
ref|XP_010537042.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    148   6e-38   
ref|XP_010254871.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    148   8e-38   
ref|XP_002459628.1|  hypothetical protein SORBIDRAFT_02g007710          148   9e-38   
ref|XP_010037298.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    147   9e-38   
ref|XP_006602366.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    147   9e-38   
emb|CDY69786.1|  BnaC06g41050D                                          146   1e-37   
gb|EMT00286.1|  IAA-amino acid hydrolase ILR1-like protein 9            142   1e-37   
ref|XP_010037299.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    147   1e-37   
ref|NP_001142187.1|  hypothetical protein precursor                     147   1e-37   
gb|EMT05755.1|  IAA-amino acid hydrolase ILR1-like protein 8            147   1e-37   
ref|XP_011074843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    148   1e-37   
gb|EEC81805.1|  hypothetical protein OsI_25528                          147   1e-37   
ref|XP_004959130.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    147   1e-37   
ref|XP_009609812.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    144   1e-37   
ref|XP_003557334.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 9    147   1e-37   
sp|Q8H3C8.1|ILL8_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    147   2e-37   
emb|CDP00215.1|  unnamed protein product                                147   2e-37   
ref|XP_006280851.1|  hypothetical protein CARUB_v10026837mg             143   2e-37   
ref|XP_006356685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    146   2e-37   
gb|ACN27971.1|  unknown                                                 144   2e-37   
ref|XP_007136362.1|  hypothetical protein PHAVU_009G038900g             146   2e-37   
ref|XP_002530514.1|  IAA-amino acid hydrolase ILR1 precursor, put...    146   3e-37   
gb|ACF85145.1|  unknown                                                 144   3e-37   
gb|EMT13982.1|  hypothetical protein F775_52700                         145   4e-37   
ref|XP_004241059.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    146   4e-37   
ref|XP_008808815.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 7    145   4e-37   
gb|KDP36173.1|  hypothetical protein JCGZ_08817                         145   4e-37   
ref|XP_002317832.1|  hypothetical protein POPTR_0012s00750g             145   5e-37   
gb|EMS66894.1|  IAA-amino acid hydrolase ILR1-like 5                    145   5e-37   
ref|XP_006307296.1|  hypothetical protein CARUB_v10008915mg             146   5e-37   
ref|XP_006297680.1|  hypothetical protein CARUB_v10013712mg             145   6e-37   
ref|XP_002281507.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      145   6e-37   
ref|NP_001051828.1|  Os03g0836900                                       145   6e-37   
ref|XP_006280852.1|  hypothetical protein CARUB_v10026837mg             143   6e-37   
ref|XP_003580154.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    145   7e-37   
gb|EMT13980.1|  IAA-amino acid hydrolase ILR1-like protein 5            141   7e-37   
ref|XP_008798874.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    145   7e-37   
ref|XP_010532197.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    143   8e-37   
emb|CBI30348.3|  unnamed protein product                                148   8e-37   
sp|Q851L5.1|ILL3_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    144   9e-37   
ref|XP_002864304.1|  hypothetical protein ARALYDRAFT_495494             145   9e-37   
gb|ACZ56436.1|  IAA-amino acid hydrolase                                145   1e-36   
ref|NP_001169595.1|  uncharacterized protein LOC100383476 precursor     145   1e-36   
ref|XP_004955916.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    145   1e-36   
ref|XP_010461441.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    145   1e-36   
ref|XP_002441732.1|  hypothetical protein SORBIDRAFT_08g001450          144   2e-36   
ref|XP_011046911.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      144   2e-36   
ref|XP_010446503.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    144   2e-36   
ref|XP_010558596.1|  PREDICTED: IAA-amino acid hydrolase ILR1           144   2e-36   
dbj|BAJ93855.1|  predicted protein                                      144   2e-36   
emb|CAG32960.1|  putative auxin-amidohydrolase precursor                144   2e-36   
emb|CDY14333.1|  BnaA10g07220D                                          144   2e-36   
ref|XP_010500141.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    144   2e-36   
ref|XP_009794644.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    144   2e-36   
gb|AAB60293.1|  ILR1                                                    144   2e-36   
gb|AAK97436.2|AF385367_1  IAA amidohydrolase                            144   2e-36   
gb|AAM63645.1|  IAA-amino acid hydrolase (ILR1)                         144   2e-36   
ref|NP_186937.1|  IAA-amino acid hydrolase ILR1                         144   3e-36   
ref|XP_010463717.1|  PREDICTED: IAA-amino acid hydrolase ILR1 iso...    144   3e-36   
ref|XP_002308452.1|  IAA-amino acid hydrolase 1 family protein          144   3e-36   
ref|XP_009119945.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    143   3e-36   
ref|XP_010479046.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    144   3e-36   
emb|CDY60579.1|  BnaCnng36490D                                          143   3e-36   
emb|CBI30350.3|  unnamed protein product                                141   3e-36   
ref|XP_010691394.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    143   3e-36   
ref|XP_004509886.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    143   4e-36   
ref|XP_008680979.1|  PREDICTED: uncharacterized protein LOC100191...    144   4e-36   
gb|ACG28942.1|  IAA-amino acid hydrolase ILR1-like 6 precursor          144   4e-36   
ref|XP_008367343.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      140   4e-36   
gb|EMS55264.1|  IAA-amino acid hydrolase ILR1-like 5                    142   4e-36   
gb|AAL47552.1|  IAA-amino acid conjugate hydrolase-like protein         143   5e-36   
ref|XP_002882255.1|  IAA amidohydrolase                                 143   5e-36   
emb|CAA09330.1|  gr1-protein                                            143   5e-36   
ref|NP_175086.1|  IAA-amino acid hydrolase ILR1-like 6                  143   5e-36   
ref|XP_002976283.1|  hypothetical protein SELMODRAFT_105028             142   6e-36   
gb|AFW69207.1|  IAA-amino acid hydrolase ILR1-like 6                    143   6e-36   
gb|KDO70552.1|  hypothetical protein CISIN_1g013571mg                   140   7e-36   
emb|CDY12538.1|  BnaC06g00640D                                          139   8e-36   
ref|XP_009349385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      142   8e-36   
ref|XP_002459630.1|  hypothetical protein SORBIDRAFT_02g007730          142   8e-36   
ref|XP_008243487.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      142   8e-36   
ref|XP_007027898.1|  Iaa-amino acid hydrolase 4, putative               143   8e-36   
gb|KFK36207.1|  hypothetical protein AALP_AA4G091700                    142   9e-36   
emb|CDY42210.1|  BnaA01g25850D                                          136   9e-36   
ref|XP_006658442.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    141   1e-35   
ref|XP_006430119.1|  hypothetical protein CICLE_v10011738mg             142   1e-35   
ref|XP_006657280.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    142   1e-35   
ref|XP_010502342.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      142   1e-35   
ref|XP_010093788.1|  IAA-amino acid hydrolase                           142   2e-35   
ref|XP_007203288.1|  hypothetical protein PRUPE_ppa025680mg             140   2e-35   
ref|XP_002275838.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    141   2e-35   
emb|CBI23103.3|  unnamed protein product                                137   2e-35   
ref|XP_006478083.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    141   2e-35   
ref|XP_010442989.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    141   2e-35   
ref|XP_010683630.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    141   2e-35   
ref|XP_002893987.1|  gr1-protein                                        141   2e-35   
ref|XP_008367918.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    141   2e-35   
gb|KFK37687.1|  hypothetical protein AALP_AA3G015600                    140   4e-35   
ref|XP_006481705.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    140   4e-35   
ref|XP_008360613.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      135   4e-35   
gb|KDO70551.1|  hypothetical protein CISIN_1g013571mg                   140   4e-35   
gb|KCW86759.1|  hypothetical protein EUGRSUZ_B03368                     140   4e-35   
ref|XP_002321954.2|  hypothetical protein POPTR_0015s00630g             138   4e-35   
ref|NP_001288853.1|  IAA-amino acid hydrolase ILR1-like 6               140   5e-35   
ref|XP_011094270.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    140   5e-35   
gb|EEC81225.1|  hypothetical protein OsI_24268                          140   5e-35   
ref|XP_008443589.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 8    134   5e-35   
ref|NP_001058422.1|  Os06g0691400                                       140   6e-35   
ref|NP_001148528.1|  IAA-amino acid hydrolase ILR1 precursor            140   6e-35   
ref|XP_006481704.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      140   7e-35   
ref|XP_008391948.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    139   8e-35   



>gb|AFR58665.1| jasmonoyl-L-isoleucine hydrolase 1 [Nicotiana attenuata]
Length=441

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QLR+RIEEVIVGQAAVQRC
Sbjct  257  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEEVIVGQAAVQRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL  EKP  PPT+ND++LH+HFQ+VAGD+LG+  VKD +PLM  +DFAFYQEV+P
Sbjct  317  NATVDFLTKEKPFFPPTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEVIP  376

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW----VT  211
            GY Y LG++DE  ++K  S HSPYFK+NE+A P GAALQASLA RY+LE Q +     ++
Sbjct  377  GYFYLLGMQDE-TNEKLVSVHSPYFKINEEALPIGAALQASLAIRYLLEAQSQVPSSSIS  435

Query  210  NKHDEL  193
            + HDEL
Sbjct  436  DHHDEL  441



>ref|XP_009630468.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=441

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 153/186 (82%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QLR+RIEEVIVGQAAVQRC
Sbjct  257  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEEVIVGQAAVQRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL  EKP  PPT+ND++LH+HFQ+VAGD+LG+  VKD +PLM  +DFAFYQEV+P
Sbjct  317  NATVDFLTKEKPFFPPTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEVIP  376

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW----VT  211
            GY Y LG++DE  ++K  S HSPYFK+NE+A P GAALQASLA RY+LE Q +     + 
Sbjct  377  GYFYLLGMQDE-TNEKLVSVHSPYFKINEEALPIGAALQASLAIRYLLEAQPQVPSSSIN  435

Query  210  NKHDEL  193
            + HDEL
Sbjct  436  DHHDEL  441



>ref|XP_006343020.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=445

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR+RIEEVIVGQAAVQRC
Sbjct  262  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVIVGQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL ++KP  PPT+ND++LH+HFQ+VAGD+LG+  VKD +PLM  +DFAFYQEV+P
Sbjct  322  NATVDFLTNDKPFFPPTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---VTN  208
            GY Y LG++ E  ++  AS HSPYFK+NE+A P+GAALQASLA RY+LE Q +      N
Sbjct  382  GYFYMLGMQGE-TNENPASVHSPYFKINEEALPFGAALQASLAIRYLLEAQPQVPLSSIN  440

Query  207  KHDEL  193
             HDEL
Sbjct  441  GHDEL  445



>ref|XP_009786385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=441

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 153/186 (82%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QLR+RIEEVIVGQAAVQRC
Sbjct  257  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEEVIVGQAAVQRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL  EKP  PPT+ND++LH+HFQ+VAGD+LG+  VKD +PLM  +DFAFYQEV+P
Sbjct  317  NATVDFLTKEKPFFPPTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEVIP  376

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW----VT  211
            GY Y LG+++E  ++K  S HSPYFK+NE+A P GAALQASLA  Y+LE Q +     ++
Sbjct  377  GYFYLLGMQEE-TNEKLVSVHSPYFKINEEALPIGAALQASLAITYLLEAQSQVPSSSIS  435

Query  210  NKHDEL  193
            + HDEL
Sbjct  436  DHHDEL  441



>ref|XP_004235624.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=445

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 152/185 (82%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR+RIEEVIVGQAAVQRC
Sbjct  262  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVIVGQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL + KP  PPT+ND++LH+HFQ+VAGD+LG+  VKD +PLM  +DFAFYQEV+P
Sbjct  322  NATVDFLTNSKPFFPPTVNDKNLHKHFQRVAGDMLGNDHVKDMEPLMGSEDFAFYQEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG++ E  ++  AS HSPYFK+NE+A P GAALQASLA  Y+LE Q +  +   N
Sbjct  382  GYFYMLGMQGE-TNENPASVHSPYFKINEEALPLGAALQASLAITYLLEAQPQVPSSSIN  440

Query  207  KHDEL  193
             HDEL
Sbjct  441  GHDEL  445



>emb|CDO97948.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 146/173 (84%), Gaps = 1/173 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E ++QLR+RIEEVIVGQAAVQRC
Sbjct  211  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESLMQLRQRIEEVIVGQAAVQRC  270

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFL +EKP  PPT+N++DLH HF KVA D++G++ VK+ +PLM  +DF+F+QEV+P
Sbjct  271  NATVNFLSTEKPFFPPTVNNKDLHNHFLKVASDMVGTANVKEMQPLMGSEDFSFFQEVIP  330

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLE  220
            GY   +G+KDE  + K AS HSP+FK+NEDA P GAAL ASLA R++LE   E
Sbjct  331  GYFIFIGVKDE-KNTKPASVHSPFFKINEDALPLGAALHASLAIRFLLESNAE  382



>ref|XP_002515893.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF46313.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=435

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QLR+RIEEVI GQA+VQRC
Sbjct  252  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFKQLRQRIEEVITGQASVQRC  311

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATV+FLE +KP  PPT+ND+ LH+ F  VAGD+LGS +VKD +PLM  +DFAFYQE+MP
Sbjct  312  KATVDFLEKDKPPFPPTVNDKKLHEFFATVAGDVLGSDKVKDMQPLMGSEDFAFYQEIMP  371

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---VTN  208
            GYI+ +G+++E    K  S HSP+F++NED  PYGAAL ASLA RY+L  Q E    V  
Sbjct  372  GYIFFIGMQNE-TRKKLQSAHSPHFEINEDVLPYGAALHASLATRYLLNLQPEHPLPVEK  430

Query  207  KHDEL  193
             HDEL
Sbjct  431  YHDEL  435



>ref|XP_007150549.1| hypothetical protein PHAVU_005G1617000g, partial [Phaseolus vulgaris]
 gb|ESW22543.1| hypothetical protein PHAVU_005G1617000g, partial [Phaseolus vulgaris]
Length=178

 Score =   243 bits (619),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = -2

Query  720  VVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCNATVNF  541
            VVTVG F+GGGAFNVIPDSVTIGGTFRAFSRE  +QLR+RIE+VI+GQAAVQRCNATVNF
Sbjct  1    VVTVGKFQGGGAFNVIPDSVTIGGTFRAFSRESFMQLRRRIEQVIIGQAAVQRCNATVNF  60

Query  540  LESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMPGYIYGL  361
            L+ EKP  PPT+N+ DLH+ F+ VAG L+G+ +VKD +PLM  +DFAFYQEV PGY + L
Sbjct  61   LDEEKPFFPPTVNNGDLHEFFKSVAGSLIGADKVKDLQPLMGSEDFAFYQEVFPGYFFLL  120

Query  360  GLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE--RQLEWVTNK-HDEL  193
            G++D A+ ++    HSPY+K+NEDA PYGAAL ASLA RY+L+  + L  V  K HDEL
Sbjct  121  GMED-ASVERLELPHSPYYKINEDALPYGAALHASLATRYLLKLNQDLPVVEEKHHDEL  178



>ref|XP_004146834.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 ref|XP_004154807.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 gb|KGN59844.1| hypothetical protein Csa_3G850490 [Cucumis sativus]
Length=449

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 150/185 (81%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF ++ MVQL++RI+EVI GQA V RC
Sbjct  266  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKDSMVQLKQRIKEVITGQAIVHRC  325

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE++KP  PPT+ND++LH+HFQ VAGD+LG  +VKD +P+M  +DF+FYQE++P
Sbjct  326  NATVDFLENDKPIFPPTVNDKELHEHFQNVAGDMLGIDKVKDMQPVMGSEDFSFYQEMIP  385

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + LG+++E +     S HSPYF++NEDA PYGAAL ASLA RY+LE Q +  +    
Sbjct  386  GYFFFLGMENETSGHLD-SVHSPYFRINEDALPYGAALHASLATRYLLELQSKVNSPEEK  444

Query  207  KHDEL  193
            +HDEL
Sbjct  445  RHDEL  449



>gb|KDP40816.1| hypothetical protein JCGZ_24815 [Jatropha curcas]
Length=441

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFSRE  +QLR+RIEEVI GQA+VQRC
Sbjct  258  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSRESFMQLRQRIEEVITGQASVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             AT+NFL+++KP  PPTIND+ LH++F+ VAGD+ G  +VKD +PLM  +DFAFYQEV+P
Sbjct  318  KATINFLQNDKPFFPPTINDKQLHKYFKVVAGDVFGIDKVKDMQPLMGSEDFAFYQEVVP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLE---WVTN  208
            GY   +G+++E    +    H+P+F++NED FPYGAAL ASLAARY+LE QLE       
Sbjct  378  GYFAFIGMQNE-TRKRLEYVHTPFFEINEDVFPYGAALHASLAARYLLESQLEVPLLEEK  436

Query  207  KHDEL  193
             HDEL
Sbjct  437  HHDEL  441



>ref|XP_007024408.1| Peptidase M20/M25/M40 family protein [Theobroma cacao]
 gb|EOY27030.1| Peptidase M20/M25/M40 family protein [Theobroma cacao]
Length=448

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 150/187 (80%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E + QL++RIEEVI GQAAVQRC
Sbjct  263  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESLTQLKQRIEEVIKGQAAVQRC  322

Query  558  NATVNFLESEKPS--IPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEV  385
            +ATV+F E+EKP    PPT+N++DLH+HFQ VAGD+LG+ +VKD +PLM  +DFAFYQE 
Sbjct  323  SATVDFYENEKPVPIFPPTVNNKDLHEHFQNVAGDMLGADKVKDMQPLMGSEDFAFYQEA  382

Query  384  MPGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK  205
            +PGY + LG++D+    +  S HSPYF +NED  PYGAAL ASLAARY+L  + ++ + K
Sbjct  383  IPGYFFMLGMRDDTG-PQLKSVHSPYFMINEDVLPYGAALHASLAARYLLAAEPKFHSPK  441

Query  204  ---HDEL  193
               HDEL
Sbjct  442  EELHDEL  448



>ref|XP_011013030.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=438

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF +E  +QLR RIEEV+ GQAAVQRC
Sbjct  255  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKESFMQLRHRIEEVVTGQAAVQRC  314

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A +NFLE+EKP  PPTIND+ LH +F+ VA DLLG  +VKD +PLM  +DFAFYQE++P
Sbjct  315  KAVINFLENEKPFFPPTINDKYLHNYFRIVASDLLGIDKVKDMQPLMGSEDFAFYQEMIP  374

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + +G+++E    +  S HSPYF++NED  PYGAAL ASLAARY+LE Q E      N
Sbjct  375  GYFFFIGMQNE-THKQLQSPHSPYFEINEDVLPYGAALHASLAARYLLEFQPEVTLPEEN  433

Query  207  KHDEL  193
             HDEL
Sbjct  434  DHDEL  438



>ref|XP_008244751.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 148/188 (79%), Gaps = 10/188 (5%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GG AFNVIPDSV IGGTFRAF+RE ++QL++RI+EVI+GQA+VQRC
Sbjct  262  DPLDSQVVTVGKFQGGDAFNVIPDSVRIGGTFRAFTRESLMQLKQRIKEVIMGQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATVNFLE EKP  PPTIN +DLH+HF+ VAGD+LG  RVKDH+PLM  +DFA+YQE +P
Sbjct  322  SATVNFLEDEKPLSPPTINHKDLHEHFRNVAGDMLGIHRVKDHQPLMGSEDFAYYQEAIP  381

Query  378  GYIYGLGLKDEAADDKSAS---EHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---  217
            GY + LG+    ADDK       HSP+F++NEDA P+GAAL ASLA RY+LE Q E    
Sbjct  382  GYFFLLGM----ADDKLGPLHMPHSPHFQINEDALPFGAALHASLAIRYLLELQQEVPLP  437

Query  216  VTNKHDEL  193
                HDEL
Sbjct  438  AQEYHDEL  445



>ref|XP_004297620.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Fragaria vesca 
subsp. vesca]
Length=445

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG  +GG AFNVIPDSVTIGGTFRAFS+E ++QL++RIE+VI+GQAAVQRC
Sbjct  262  DPLDSQVVTVGKVQGGEAFNVIPDSVTIGGTFRAFSKESLMQLKQRIEKVIIGQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNF E EKP  PPT+N ++LH HFQ VAGD+LG+ +VK+H PLM  +DFA+YQE +P
Sbjct  322  NATVNFCEDEKPLFPPTVNHKELHTHFQNVAGDMLGAHKVKNHPPLMGSEDFAYYQEAIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLE  220
            G+ + LG+KD+       + HSPYF++NEDA PYGAAL ASLA RY++E Q E
Sbjct  382  GFFFFLGMKDDRLGYLD-TPHSPYFRINEDALPYGAALHASLAFRYLIETQQE  433



>ref|XP_003546640.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=444

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR+RIE+VI GQAAVQRC
Sbjct  261  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESFMQLRQRIEQVITGQAAVQRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFL+ EKP  PPT+N+ DLH +F+ VAG LLG + VK+ +PLM  +DFAFYQEV P
Sbjct  321  NATVNFLDDEKPFSPPTVNNGDLHGYFESVAGSLLGVNNVKEMQPLMGSEDFAFYQEVFP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ--LEWVTNK  205
            GY + LG+ D A+++   S HSPYFK+NEDA PYGAAL  SLA+ Y+L+    +  V  K
Sbjct  381  GYFFLLGM-DNASNEHLESPHSPYFKINEDALPYGAALHVSLASSYLLKLNPDISVVGGK  439

Query  204  -HDEL  193
             HDEL
Sbjct  440  HHDEL  444



>ref|XP_008447583.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=449

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF ++ MVQL++RI+EVI GQA V RC
Sbjct  266  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKDSMVQLKQRIKEVITGQAIVHRC  325

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE++KP  PPT+ND++LH+HFQ VAGD+LG  +VK+ +P+M  +DF+FYQE++P
Sbjct  326  NATVDFLENDKPIFPPTVNDKELHEHFQNVAGDMLGIDKVKEMQPVMGSEDFSFYQEMIP  385

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            GY + LG+++E +     S HSPYF++NEDA PYGAAL ASLA RY+LE Q
Sbjct  386  GYFFFLGMENETSGHLD-SVHSPYFRINEDALPYGAALHASLATRYLLELQ  435



>ref|XP_003543612.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN30029.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 148/185 (80%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSV IGGTFRAFS+E  +QLR+RIE+VI GQAAVQRC
Sbjct  261  DPLDSQVVTVGKFQGGGAFNVIPDSVAIGGTFRAFSKESFMQLRQRIEQVITGQAAVQRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFL+ EKP  PPT+N+ DLH++F+ VAG LLG + VKD +PLM  +DFAFYQEV P
Sbjct  321  NATVNFLDDEKPFFPPTVNNGDLHEYFKSVAGSLLGVNNVKDMQPLMGSEDFAFYQEVFP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE--RQLEWVTNK  205
            GY + LG+++ + +    S HSPYFK+NEDA PYGAAL ASLA+ Y+L+  + +  V  K
Sbjct  381  GYFFLLGMENVSIEHLE-SPHSPYFKINEDALPYGAALHASLASSYLLKLNQDIPVVEGK  439

Query  204  -HDEL  193
             HDEL
Sbjct  440  HHDEL  444



>gb|ACZ56438.1| IAA-amino acid hydrolase [Populus tomentosa]
Length=438

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF +E  +QLR+RIEEV+ GQAAVQRC
Sbjct  255  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKESFMQLRQRIEEVVTGQAAVQRC  314

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A +NFLE+EKP  PPTIND++LH +F+ VA D+LG+ +VKD +PLM  +DFAFYQE +P
Sbjct  315  KAVINFLENEKPFFPPTINDKNLHDYFRVVASDVLGTDKVKDMQPLMGSEDFAFYQEKIP  374

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + LG+++E    +  S HSPYF++NED  PYGAAL  SLAARY+LE Q +      N
Sbjct  375  GYFFFLGMQNE-TRKQLQSPHSPYFEINEDVLPYGAALHVSLAARYLLEFQPQVTLPEEN  433

Query  207  KHDEL  193
             HDEL
Sbjct  434  DHDEL  438



>ref|XP_002303219.1| putative auxin-amidohydrolase precursor family protein [Populus 
trichocarpa]
 gb|EEE78198.1| putative auxin-amidohydrolase precursor family protein [Populus 
trichocarpa]
Length=438

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF +E  +QL++RIEEV+ GQAAVQRC
Sbjct  255  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFLKESFMQLKQRIEEVVTGQAAVQRC  314

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A +NFLE+EKP  PPTIND+ LH +F+ VA D+LG  +VKD +PLM  +DFAFYQE++P
Sbjct  315  KAVINFLENEKPFFPPTINDKYLHDYFRIVASDMLGIDKVKDMQPLMGSEDFAFYQEMIP  374

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + +G+++E    +  S HSPYF++NED  PYGAAL ASLAARY+LE Q E      N
Sbjct  375  GYFFFIGMQNE-THKQLQSPHSPYFEINEDVLPYGAALHASLAARYLLEFQPEVTLPEEN  433

Query  207  KHDEL  193
             HDEL
Sbjct  434  DHDEL  438



>ref|XP_003597383.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AES67634.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP+DSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF RE    LR RIE+VI GQA V RC
Sbjct  264  DPVDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFPRESFTHLRHRIEQVITGQAVVHRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFLE EKP IPPTIN+  LH HFQ VAG LLG  +VKD +P++  +DFAFYQ  +P
Sbjct  324  NATVNFLEEEKPFIPPTINNGGLHDHFQSVAGRLLGVDKVKDQQPMLGSEDFAFYQAALP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI--LERQLEWVTNK  205
            GYI+ LG++D +  ++  S HSPY+KVNEDA PYGAAL ASLA+RY+  L +++  V  K
Sbjct  384  GYIFLLGMEDVSV-ERLPSGHSPYYKVNEDALPYGAALHASLASRYLVKLHQEVPVVERK  442

Query  204  -HDEL  193
             HDEL
Sbjct  443  IHDEL  447



>ref|XP_007215385.1| hypothetical protein PRUPE_ppa005752mg [Prunus persica]
 gb|EMJ16584.1| hypothetical protein PRUPE_ppa005752mg [Prunus persica]
Length=445

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 147/188 (78%), Gaps = 10/188 (5%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GG AFNVIPDSV IGGTFRAF+RE ++QL++RI+EVI+GQA+VQRC
Sbjct  262  DPLDSQVVTVGKFQGGDAFNVIPDSVRIGGTFRAFTRESLMQLQQRIKEVIMGQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATVNFLE EKP  PPTIN +DL +HFQ VAGD+LG  RVKDH+PLM  +DFA+YQE +P
Sbjct  322  SATVNFLEDEKPLSPPTINHKDLQEHFQNVAGDMLGIHRVKDHQPLMGSEDFAYYQEAIP  381

Query  378  GYIYGLGLKDEAADDKSAS---EHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---  217
            GY + LG+    ADDK       HSP+F++NEDA P+GAAL ASLA RY+LE Q E    
Sbjct  382  GYFFLLGM----ADDKLGPLHMPHSPHFQINEDALPFGAALHASLAIRYLLELQQEVPLP  437

Query  216  VTNKHDEL  193
                HDEL
Sbjct  438  AQEYHDEL  445



>ref|XP_003597649.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=448

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP+DSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFSRE    LR RIE+VI GQAAV RC
Sbjct  265  DPVDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSRESFTHLRHRIEQVITGQAAVHRC  324

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFLE E P IPPT+N+  LH +F+ VAG LLG  ++KD +P +  +DFAFYQE +P
Sbjct  325  NATVNFLEEETPFIPPTVNNGGLHDYFESVAGRLLGVDKIKDQQPTVGSEDFAFYQEAIP  384

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI--LERQLEWVTNK  205
            GYI+ LG++D +  ++  S HSPYFKVNEDA PYGAAL ASLA+RY+  L +++  V  K
Sbjct  385  GYIFLLGMEDVSV-ERLPSGHSPYFKVNEDALPYGAALHASLASRYLVKLHQEVPVVKGK  443

Query  204  -HDEL  193
             HDEL
Sbjct  444  IHDEL  448



>gb|AES67900.2| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=452

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP+DSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFSRE    LR RIE+VI GQAAV RC
Sbjct  269  DPVDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSRESFTHLRHRIEQVITGQAAVHRC  328

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFLE E P IPPT+N+  LH +F+ VAG LLG  ++KD +P +  +DFAFYQE +P
Sbjct  329  NATVNFLEEETPFIPPTVNNGGLHDYFESVAGRLLGVDKIKDQQPTVGSEDFAFYQEAIP  388

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI--LERQLEWVTNK  205
            GYI+ LG++D +  ++  S HSPYFKVNEDA PYGAAL ASLA+RY+  L +++  V  K
Sbjct  389  GYIFLLGMEDVSV-ERLPSGHSPYFKVNEDALPYGAALHASLASRYLVKLHQEVPVVKGK  447

Query  204  -HDEL  193
             HDEL
Sbjct  448  IHDEL  452



>gb|ABF55219.1| auxin conjugate hydrolase [Medicago truncatula]
Length=452

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP+DSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFSRE    LR RIE+VI GQAAV RC
Sbjct  269  DPVDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSRESFTHLRHRIEQVITGQAAVHRC  328

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFLE E P IPPT+N+  LH +F+ VAG LLG  ++KD +P +  +DFAFYQE +P
Sbjct  329  NATVNFLEEETPFIPPTVNNGGLHDYFESVAGRLLGVDKIKDQQPTVGSEDFAFYQEAIP  388

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI--LERQLEWVTNK  205
            GYI+ LG++D  + ++  S HSPYFKVNEDA PYGAAL ASLA+RY+  L +++  V  K
Sbjct  389  GYIFLLGMED-VSIERLPSGHSPYFKVNEDALPYGAALHASLASRYLVKLHQEVPVVKGK  447

Query  204  -HDEL  193
             HDEL
Sbjct  448  IHDEL  452



>ref|XP_006426465.1| hypothetical protein CICLE_v10025591mg [Citrus clementina]
 gb|ESR39705.1| hypothetical protein CICLE_v10025591mg [Citrus clementina]
Length=450

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSV IGGTFRAFS+E   QL++RIEEVI+GQAAVQRC
Sbjct  267  DPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRC  326

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+FL  EKP  PPTIN+ DLH++FQ VAGD+L + +VK   P+M  +DF+FYQEVMP
Sbjct  327  SATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMP  386

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            GY + LG+K+E    K  S HSPYF +NEDA PYGAAL ASLA RY+LE
Sbjct  387  GYFFFLGMKNETL-GKVESTHSPYFTLNEDALPYGAALHASLALRYLLE  434



>ref|XP_002281321.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
 emb|CBI35990.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL+SQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E ++QL++RIEEVI  QAAVQRC
Sbjct  258  DPLESQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESIMQLKQRIEEVITRQAAVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F E EKP  P TIN+ +LH+HFQ V G++LG   VKD +PLM  +DF+FYQE MP
Sbjct  318  NATVDFHEKEKPLFPATINNPNLHKHFQNVVGNMLGVHNVKDMQPLMGSEDFSFYQEEMP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + LG+KDEA   +  S HSP+FK+NEDA PYGAAL ASLAA Y+LE Q +  + +  
Sbjct  378  GYFFFLGMKDEAL-GRLPSVHSPHFKINEDALPYGAALHASLAATYLLEIQPQPSSREGK  436

Query  204  -HDEL  193
             HDEL
Sbjct  437  HHDEL  441



>ref|XP_006466100.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=450

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSV IGGTFRAFS+E   QL++RIEEVI+GQAAVQRC
Sbjct  267  DPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRC  326

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+FL  EKP  PPTIN+ DLH++FQ VAGD+L + +VK   P+M  +DF+FYQEVMP
Sbjct  327  SATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMP  386

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            GY + LG+K+E    K  S HSPYF +NEDA PYGAAL ASLA RY+LE
Sbjct  387  GYFFFLGMKNETL-GKVESIHSPYFTLNEDALPYGAALHASLALRYLLE  434



>gb|ABW34918.1| IAA-amino acid hydrolase 3 [Eucommia ulmoides]
Length=277

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF ++  +QLR+RIEEVI+ Q+AVQRC
Sbjct  94   DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKDSFMQLRQRIEEVIIRQSAVQRC  153

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL  +KP  PPT+N +DLH HFQKVAG++LG   VK  +PLM  +DF+FYQE +P
Sbjct  154  NATVDFLTEDKPFFPPTVNHQDLHHHFQKVAGEMLGHHNVKHMEPLMGSEDFSFYQERIP  213

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLE---WVTN  208
            GY + LG++ E   +K AS HSPYF +NED+ P+GA+L ASLA +Y++E + E     T 
Sbjct  214  GYFFFLGVRPE-GHEKPASVHSPYFTINEDSLPFGASLHASLAYKYLVEFRKETPTLPTQ  272

Query  207  KHDEL  193
             H EL
Sbjct  273  HHGEL  277



>gb|KDO58672.1| hypothetical protein CISIN_1g013076mg [Citrus sinensis]
Length=450

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSV IGGTFRAFS+E   QL++RIEEVI+GQAAVQRC
Sbjct  267  DPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRC  326

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+FL  EKP  PPTIN+ DLH++FQ VAGD+L + +VK   P+M  +DF+FYQEVMP
Sbjct  327  SATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMP  386

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            GY + LG+K+E    K  S HSPYF +NEDA PYGAAL ASLA RY+LE
Sbjct  387  GYFFFLGMKNETL-GKVESIHSPYFTLNEDALPYGAALHASLALRYLLE  434



>ref|XP_004486800.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=445

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 144/186 (77%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD+QVVTVG+F+GGGAFNVIPDSVTIGGTFRAFS E  + LR RIE+VI GQAAV RC
Sbjct  261  DPLDTQVVTVGNFQGGGAFNVIPDSVTIGGTFRAFSHESFMHLRNRIEQVITGQAAVHRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFL+ EK   PPTIND  LH +F+ VAG LLG  +V D +P+M G+DFAFYQ+ +P
Sbjct  321  NATVNFLQEEKIFFPPTINDAGLHDYFRSVAGSLLGVDKVNDMQPVMGGEDFAFYQQALP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            GYI+ LG+++ +A+      HSPYFK+NEDA PYGAAL ASLAARY++E + E V     
Sbjct  381  GYIFLLGMRNPSAEPLHIV-HSPYFKINEDALPYGAALHASLAARYLVEFRQEEVPVVEG  439

Query  210  NKHDEL  193
              HDEL
Sbjct  440  KYHDEL  445



>emb|CAN70580.1| hypothetical protein VITISV_033718 [Vitis vinifera]
Length=441

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL+SQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E ++QL++RIEEVI  QAAVQRC
Sbjct  258  DPLESQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESIMQLKQRIEEVITRQAAVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F E EKP  P TIN+ +LH+HFQ VAG++LG   VKD +PLM  +DF+FYQE MP
Sbjct  318  NATVDFHEKEKPLFPATINNPNLHKHFQNVAGNMLGVHNVKDMQPLMGSEDFSFYQEEMP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + LG+KDEA   +  S HSP+FK+NE A PYGAAL ASLAA Y+LE Q +  + +  
Sbjct  378  GYFFFLGMKDEAL-GRLPSVHSPHFKINEGALPYGAALHASLAATYLLEIQPQPSSREGK  436

Query  204  -HDEL  193
             HDEL
Sbjct  437  HHDEL  441



>gb|KJB70347.1| hypothetical protein B456_011G068400 [Gossypium raimondii]
Length=453

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+  ++QL+KRIEEVI GQAAVQRC
Sbjct  268  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKASLIQLKKRIEEVIKGQAAVQRC  327

Query  558  NATVNFLESEKPSI--PPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEV  385
            +ATV+F  ++KP +  PPT+ND+DLH+HF KVAGD+LG+ +VKD KP+M  +DFAFYQE 
Sbjct  328  SATVDFSNTKKPMLLFPPTVNDKDLHEHFLKVAGDMLGNDKVKDMKPVMGSEDFAFYQEA  387

Query  384  MPGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT--  211
             PGY + +G++DE +  K +S H+P F +NED  PYGAAL ASLA  Y+LE + +     
Sbjct  388  FPGYFFFIGMQDENS-PKLSSVHTPNFTINEDILPYGAALHASLATTYLLEAESKLRPTG  446

Query  210  -NKHDEL  193
             N HDEL
Sbjct  447  GNLHDEL  453



>ref|XP_008387506.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Malus domestica]
Length=445

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E  + L++RIEEVI  QA+VQRC
Sbjct  262  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESFMHLKQRIEEVITRQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E EKP  P  +ND+DLHQHF  VAGDLLG   + +  PLM  +DFAFYQEV+P
Sbjct  322  NATVLFNEKEKPFYPVVVNDKDLHQHFLNVAGDLLGPRNILEKPPLMGAEDFAFYQEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + +G+K+E +  K  S HSP F++NED  PYGAAL ASLA RY+LE Q E   +K  
Sbjct  382  GYFFMVGMKNE-SQGKLESGHSPNFRINEDVLPYGAALHASLATRYLLENQPESTLSKGD  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  SHDEL  445



>emb|CAG32961.1| putative auxin-amidohydrolase precursor [Populus tremula x Populus 
alba]
Length=438

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVT GGTFRAF +E  +QLR+RIEEV+ GQAAVQRC
Sbjct  255  DPLDSQVVTVAKFQGGGAFNVIPDSVTTGGTFRAFLKESFMQLRQRIEEVVTGQAAVQRC  314

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A +N LE+EKP  PPTIND++LH +F+ VA D+LG  +VKD +PLM  +DFAFYQE +P
Sbjct  315  KAVINLLENEKPFFPPTINDKNLHDYFRVVASDVLGIDKVKDMQPLMGSEDFAFYQEKIP  374

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + +G+++E    +  S HSPYF++NED  PYGAAL ASLAARY+LE Q +      N
Sbjct  375  GYFFFVGMQNE-TRKQLQSPHSPYFEINEDVLPYGAALHASLAARYLLEFQPQVTLPEEN  433

Query  207  KHDEL  193
             HDEL
Sbjct  434  DHDEL  438



>ref|XP_003597644.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|ABF55220.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|AES67895.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV   +GGGAFNVIPDSVTIGGTFRAFS E   QLR RIE++I GQAAVQRC
Sbjct  264  DPLDSQVLTVAMIQGGGAFNVIPDSVTIGGTFRAFSNESFTQLRHRIEQIITGQAAVQRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+FLE EKP  PPT+ND  LH +FQ VAG LLG+ +VK  +P+M  +DFAFYQE +P
Sbjct  324  HATVSFLEEEKPFFPPTVNDGGLHDYFQSVAGSLLGADKVKGMQPMMGSEDFAFYQEAIP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE--RQLEWVTNK  205
            GYI+ LG++D +  ++  S HSPYFKVNED  PYGAAL ASLA+RY+L+  +++  V  K
Sbjct  384  GYIFLLGMEDVSV-ERLPSGHSPYFKVNEDVLPYGAALHASLASRYLLKLRQEVPIVEGK  442

Query  204  -HDEL  193
             HDEL
Sbjct  443  YHDEL  447



>ref|XP_004287508.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS++   QL++RIEEVI  QA+VQRC
Sbjct  280  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKDSFFQLKERIEEVITRQASVQRC  339

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E  KP  P TIND++LH+HFQKVAGDLLGS  V + KPLM  +DF+FYQEV+P
Sbjct  340  NATVLFNEIAKPFYPATINDKNLHEHFQKVAGDLLGSQNVLEKKPLMGAEDFSFYQEVIP  399

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            GY + LG+K++ +  +    HSPYF++NED  PYGAA  ASLA RY+LE Q
Sbjct  400  GYYFFLGMKND-SQGQFKPMHSPYFRINEDVLPYGAAFHASLATRYLLENQ  449



>gb|AFK37903.1| unknown [Medicago truncatula]
Length=447

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV   +GGGAFNVIPDSVTIGGTFRAFS E   QLR RIE++I GQAAVQRC
Sbjct  264  DPLDSQVLTVAMIQGGGAFNVIPDSVTIGGTFRAFSNESFTQLRHRIEQIITGQAAVQRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+FLE EKP  PPT+ND  LH +FQ VAG LLG+ +VK  +P+M  +DFAFYQE +P
Sbjct  324  HATVSFLEEEKPFFPPTVNDGGLHDYFQSVAGSLLGADKVKGMQPMMGSEDFAFYQEAIP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE--RQLEWVTNK  205
            GYI+ LG++D +  ++  S HSPYFKVNE   PYGAAL ASLA+RY+L+  +++  V  K
Sbjct  384  GYIFLLGMEDVSV-ERLPSGHSPYFKVNEGVLPYGAALHASLASRYLLKLRQEVPIVEGK  442

Query  204  -HDEL  193
             HDEL
Sbjct  443  YHDEL  447



>ref|XP_010244354.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Nelumbo nucifera]
Length=452

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI GQAAVQRC
Sbjct  269  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFMQLKQRIEEVITGQAAVQRC  328

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F   +KP  P T+N +DLH++FQ+VAGD+LG   VKD +PLM  +DFAF+ E +P
Sbjct  329  SATVDFFLDQKPHFPVTVNSQDLHEYFQQVAGDMLGIRNVKDMQPLMGSEDFAFFSEAVP  388

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE---RQLEWVTN  208
            GY + LG+K++    K    HSPYF +NEDA PYGAALQASLAARY+LE   +     T 
Sbjct  389  GYYFFLGMKND-TRGKLEPGHSPYFTINEDALPYGAALQASLAARYLLEFHPKSHFQETK  447

Query  207  KHDEL  193
             HDEL
Sbjct  448  FHDEL  452



>gb|KHG30726.1| IAA-amino acid hydrolase ILR1-like 4 [Gossypium arboreum]
Length=453

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSV IGGTFRAFS+  ++QL+KRIEEVI GQAAVQRC
Sbjct  268  DPLDSQVVTVAKFQGGGAFNVIPDSVRIGGTFRAFSKASLIQLKKRIEEVIKGQAAVQRC  327

Query  558  NATVNFLESEKPSI--PPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEV  385
            +ATV+F  ++KP +  PPT+ND+DLH+HF KVAGD+LG+ +VKD KP+M  +DFAFYQE 
Sbjct  328  SATVDFYNTKKPMLFFPPTVNDKDLHEHFLKVAGDMLGNDKVKDMKPVMGSEDFAFYQEA  387

Query  384  MPGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT--  211
             PGY + +G++DE +  K +S H+P F +NED  PYGAAL ASL   Y+LE + +     
Sbjct  388  FPGYFFFIGMQDENS-PKLSSVHNPNFTINEDVLPYGAALHASLVTTYLLEAESKLRPTE  446

Query  210  -NKHDEL  193
             N HDEL
Sbjct  447  GNLHDEL  453



>ref|XP_011072466.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Sesamum indicum]
Length=445

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F+GGGAFNVIPDSVTIGGTFRAFS+E +++L++RIEEVIVGQAAVQRC
Sbjct  262  DPLDSQVLTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESLMKLKQRIEEVIVGQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   ++P  PPT+N+  LH+ FQ+VAGD+LG++ V D +PLM  +DF+FYQE++P
Sbjct  322  NATVTFESKDRPFFPPTVNEGGLHKLFQRVAGDMLGTAGVNDMQPLMGSEDFSFYQEIIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + LG+KDE   ++    HSPYF+++E   PYGAAL ASLA RY+ E Q    T    
Sbjct  382  GYFFFLGMKDETL-EQPVMPHSPYFRIDEGGLPYGAALHASLAVRYLSESQTAARTYNGY  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  HHDEL  445



>ref|XP_006451369.1| hypothetical protein CICLE_v100084061mg [Citrus clementina]
 gb|ESR64609.1| hypothetical protein CICLE_v100084061mg [Citrus clementina]
Length=309

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEEV++ QA+VQRC
Sbjct  128  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRC  187

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   +K   P T+N+++LH+HFQKVAGD+LG   +K+++PLM  +DF+F+ E +P
Sbjct  188  NATVTF--DDKSFYPVTVNNKNLHEHFQKVAGDMLGIQNIKENRPLMGTEDFSFFAEAIP  245

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    K  + HSPYF+VNEDA PYGA L ASLA RY+LE Q +      +
Sbjct  246  GYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAVLHASLATRYLLENQPKTTLASRS  304

Query  207  KHDEL  193
             HDEL
Sbjct  305  LHDEL  309



>gb|KDO55922.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=309

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEEV++ QA+VQRC
Sbjct  128  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRC  187

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   +K   P T+N+++LH+HFQKVA D+LG   +K+++PLM  +DF+F+ E +P
Sbjct  188  NATVTF--DDKSFYPVTVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEAIP  245

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    K  + HSPYF+VNEDA PYGAAL ASLA RY+LE Q +      +
Sbjct  246  GYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAALHASLATRYLLENQPKTTLASRS  304

Query  207  KHDEL  193
             HDEL
Sbjct  305  LHDEL  309



>ref|XP_008242448.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL+SQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI  QA+VQRC
Sbjct  262  DPLESQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESFIQLKQRIEEVITRQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E +KP  P  +ND++LH+HF+ VAGDLLG   + + +P+M  +DF+FYQE +P
Sbjct  322  NATVLFNERDKPFYPVAVNDKNLHEHFRNVAGDLLGPQNILERQPMMGAEDFSFYQEAIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + +G+K+E +  K  S HSP+F+VNED  PYGAAL ASLA RY+LE Q +    K  
Sbjct  382  GYFFFVGMKNE-SQGKFESGHSPFFRVNEDVLPYGAALHASLATRYLLENQPKSTLPKGS  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  FHDEL  445



>ref|XP_007202052.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
 gb|EMJ03251.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
Length=445

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL+SQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI  QA+VQRC
Sbjct  262  DPLESQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESFIQLKQRIEEVITRQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E +KP  P  +ND++LH+HF+ VAGDLLG   + + +P+M  +DF+FYQE +P
Sbjct  322  NATVLFNERDKPFYPVAVNDKNLHEHFRNVAGDLLGPQNILERQPMMGAEDFSFYQEAIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + +G+K+E +  K  S HSP+F+VNED  PYGAAL ASLA RY+LE Q +    K  
Sbjct  382  GYFFFVGMKNE-SQGKFESGHSPFFRVNEDVLPYGAALHASLATRYLLENQPKSTLPKGS  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  FHDEL  445



>ref|XP_011077949.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X2 [Sesamum 
indicum]
Length=446

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GG AFNVIPDSVTI GTFRAFS+E  +QL+ RIEEVI  QA+VQRC
Sbjct  263  DPLDSQVVTIAKFQGGHAFNVIPDSVTIAGTFRAFSQESFMQLKHRIEEVITLQASVQRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VNF   EKP  P T+ND+DLH+HFQK+AG +LG   VK+ +PLM  +DF+F+ E +P
Sbjct  323  NASVNFYADEKPFYPVTVNDKDLHKHFQKIAGHMLGDENVKEVQPLMGAEDFSFFAEAIP  382

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY Y +G+ +E  + + AS HSPYFKVNEDA PYGAAL AS+AA Y+LE      T K  
Sbjct  383  GYFYYIGMFNE-TEGQLASGHSPYFKVNEDALPYGAALHASIAATYLLEHHSPIATQKRS  441

Query  204  -HDEL  193
             HDEL
Sbjct  442  SHDEL  446



>ref|XP_011077948.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Sesamum 
indicum]
Length=450

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GG AFNVIPDSVTI GTFRAFS+E  +QL+ RIEEVI  QA+VQRC
Sbjct  267  DPLDSQVVTIAKFQGGHAFNVIPDSVTIAGTFRAFSQESFMQLKHRIEEVITLQASVQRC  326

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VNF   EKP  P T+ND+DLH+HFQK+AG +LG   VK+ +PLM  +DF+F+ E +P
Sbjct  327  NASVNFYADEKPFYPVTVNDKDLHKHFQKIAGHMLGDENVKEVQPLMGAEDFSFFAEAIP  386

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY Y +G+ +E  + + AS HSPYFKVNEDA PYGAAL AS+AA Y+LE      T K  
Sbjct  387  GYFYYIGMFNE-TEGQLASGHSPYFKVNEDALPYGAALHASIAATYLLEHHSPIATQKRS  445

Query  204  -HDEL  193
             HDEL
Sbjct  446  SHDEL  450



>ref|XP_007135595.1| hypothetical protein PHAVU_010G142600g [Phaseolus vulgaris]
 gb|ESW07589.1| hypothetical protein PHAVU_010G142600g [Phaseolus vulgaris]
Length=442

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GG AFN+IPDSVTIGGTFRAFS+E   QL++RIEEV++ QA+VQRC
Sbjct  259  DPLDSQVVTVGKFQGGSAFNIIPDSVTIGGTFRAFSKESFQQLKQRIEEVVIAQASVQRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFL+ + P  P TIN+ DLH+HFQ VAG+LLG ++V + +PLM  +DF+FYQEV+P
Sbjct  319  NATVNFLQDQNPFFPVTINNGDLHEHFQSVAGNLLGVNKVNEMQPLMGAEDFSFYQEVIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + +G+++ A+ +K    HSP+FK+NED  PYGAAL ASLA  Y+L+   +  + +  
Sbjct  379  GYFFMVGMQN-ASHEKLEQVHSPHFKINEDVLPYGAALHASLAVSYLLKHPQDIASAEGK  437

Query  204  -HDEL  193
             HDEL
Sbjct  438  YHDEL  442



>gb|EYU21408.1| hypothetical protein MIMGU_mgv1a006385mg [Erythranthe guttata]
Length=446

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 141/186 (76%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFNVIPDSVTIGGTFRAFS E  +QL++RI+EVI+GQAAVQRC
Sbjct  262  DPLDSQVLTVAKFHGGGAFNVIPDSVTIGGTFRAFSNESFLQLKQRIKEVIIGQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+V+F   +K   PPT+ND+DLH+ FQ+VAGD+L  S VK+ +PLM  +DF+FYQE +P
Sbjct  322  NASVSFESKDKIFFPPTVNDKDLHKLFQRVAGDMLSISGVKEMQPLMGSEDFSFYQEKIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            GY + LG+KDE A +K A  HSPYF++NED  P+GAAL AS+  RY+ +      T    
Sbjct  382  GYFFLLGMKDETA-EKPAHAHSPYFRINEDGLPFGAALHASMVVRYLFDSHKAGSTYSGY  440

Query  210  NKHDEL  193
              HDEL
Sbjct  441  RAHDEL  446



>ref|XP_003597645.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AES67896.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL++QVVTVG+ +GGGA NVIPDSVTIGGTFRAF RE + QLR RIE+VI+GQAAV RC
Sbjct  264  DPLETQVVTVGNIQGGGAVNVIPDSVTIGGTFRAFLRESLTQLRHRIEQVIIGQAAVHRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL+ + PS+PPTIN+  LH +FQ VAG LLG  +VK H  LM  +DFAFYQE MP
Sbjct  324  NATVSFLDDKIPSVPPTINNDSLHDYFQSVAGSLLGIDKVKGHHLLMGSEDFAFYQEAMP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI--LERQLEWVTNK  205
            GY++ +G++D +  ++  S HSPYFKVNED FPYGAAL  SLA RY+  L +++     K
Sbjct  384  GYVFIVGMEDVSV-ERLRSWHSPYFKVNEDVFPYGAALHISLATRYLAKLNQEVPAEDGK  442

Query  204  -HDEL  193
             HDEL
Sbjct  443  YHDEL  447



>ref|XP_009338136.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
Length=473

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GG AFNVIPDSV IGGTFRAF+ + ++QL++RI++VI GQA+V RC
Sbjct  290  DPLDSQVVTVGKFQGGDAFNVIPDSVKIGGTFRAFTMKSLMQLKQRIKQVITGQASVHRC  349

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATVNF E EKP  PPTIN  DLH+HF+ VAGD+LG  +VKDH+PLM  +DFA+YQE +P
Sbjct  350  IATVNFFEDEKPISPPTINHNDLHEHFRNVAGDMLGFQKVKDHQPLMGSEDFAYYQEAIP  409

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + LG+ D+A      + HSP+F++NEDA P+GAAL A+ A RY+LE   E  +    
Sbjct  410  GYFFLLGMADDALGPLP-TPHSPHFRINEDALPFGAALHAAFAVRYLLEFPQEVPSPAQE  468

Query  207  KHDEL  193
             HDEL
Sbjct  469  HHDEL  473



>ref|XP_006451368.1| hypothetical protein CICLE_v100084061mg, partial [Citrus clementina]
 gb|ESR64608.1| hypothetical protein CICLE_v100084061mg, partial [Citrus clementina]
Length=421

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEEV++ QA+VQRC
Sbjct  240  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRC  299

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   +K   P T+N+++LH+HFQKVAGD+LG   +K+++PLM  +DF+F+ E +P
Sbjct  300  NATVTF--DDKSFYPVTVNNKNLHEHFQKVAGDMLGIQNIKENRPLMGTEDFSFFAEAIP  357

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    K  + HSPYF+VNEDA PYGA L ASLA RY+LE Q +      +
Sbjct  358  GYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAVLHASLATRYLLENQPKTTLASRS  416

Query  207  KHDEL  193
             HDEL
Sbjct  417  LHDEL  421



>gb|KHN39276.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=395

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QVVTV  F+GGGAFNVIPD VTIGGTFRAFSRE + QL++RI++V++GQAAVQRC
Sbjct  211  DPLDPQVVTVAKFQGGGAFNVIPDYVTIGGTFRAFSREKLDQLKQRIKQVVIGQAAVQRC  270

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHK-PLMAGDDFAFYQEVM  382
            NATVNFL+  +PS PPT+N+ DLH+ F  VAG+LLG++ V   K P+MA +DFAFYQEV+
Sbjct  271  NATVNFLDETRPSYPPTVNNGDLHKLFVDVAGNLLGTNNVNIEKTPIMAAEDFAFYQEVI  330

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ---LEWVT  211
            PGY   LG+K  A+ +   S HSPY K++EDA PYGAAL ASLA  Y+L  Q    + V 
Sbjct  331  PGYFIMLGVKS-ASPEPHQSLHSPYLKISEDALPYGAALHASLATSYLLRYQQDVAKVVG  389

Query  210  NKHDEL  193
              HDEL
Sbjct  390  KYHDEL  395



>gb|KDO55917.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=443

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEEV++ QA+VQRC
Sbjct  262  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   +K   P T+N+++LH+HFQKVA D+LG   +K+++PLM  +DF+F+ E +P
Sbjct  322  NATVTF--DDKSFYPVTVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    K  + HSPYF+VNEDA PYGAAL ASLA RY+LE Q +      +
Sbjct  380  GYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAALHASLATRYLLENQPKTTLASRS  438

Query  207  KHDEL  193
             HDEL
Sbjct  439  LHDEL  443



>ref|XP_006475371.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=443

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEEV++ QA+VQRC
Sbjct  262  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   +K   P T+N+++LH+HFQKVAGD+LG   +K+++PLM  +DF+F+ E +P
Sbjct  322  NATVTF--DDKSFYPVTVNNKNLHEHFQKVAGDMLGIQNIKENRPLMGTEDFSFFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    K  + HSPYF+VNEDA PYGA L ASLA RY+LE Q +      +
Sbjct  380  GYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAVLHASLATRYLLENQPKTTLASRS  438

Query  207  KHDEL  193
             HDEL
Sbjct  439  LHDEL  443



>ref|XP_003531633.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN11319.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=442

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GG AFNVIPDSVTIGGTFRAFS+E   QLR+RIE+V++ QAAV RC
Sbjct  259  DPLDSQVVTVGKFQGGNAFNVIPDSVTIGGTFRAFSKESFQQLRQRIEQVVIAQAAVLRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNF E EKP  P TIN+ DLH+HF  VA +LLG ++V D  PLM  +DF+FYQEVMP
Sbjct  319  NATVNFFEGEKPFFPATINNNDLHEHFGTVAVNLLGINKVNDMPPLMGAEDFSFYQEVMP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY   +G+++  + +K    HSPYFK+NED  PYGAAL ASLA  Y+L+   +  +    
Sbjct  379  GYFAFIGIQN-PSHEKLEQVHSPYFKINEDVLPYGAALHASLAVSYLLKHPQDVPSAEGK  437

Query  207  KHDEL  193
             HDEL
Sbjct  438  HHDEL  442



>ref|XP_009352597.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
Length=445

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E  + L++RIEEVI  QA+VQRC
Sbjct  262  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESFMHLKQRIEEVITRQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E  KP  P  INDRDLHQHF  VAGDLLG   + + +P M  +DFAFYQEV+P
Sbjct  322  NATVLFNEKAKPFYPVVINDRDLHQHFLNVAGDLLGPRNIIERQPTMGAEDFAFYQEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + +G+K+E+  +     HSP F+VNED   YGAAL  SLA RY+LE Q E  +   N
Sbjct  382  GYFFVVGMKNESQGELEPG-HSPNFRVNEDVLLYGAALHVSLATRYLLENQPESTSSKGN  440

Query  207  KHDEL  193
              DEL
Sbjct  441  SQDEL  445



>ref|XP_003597384.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AES67635.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=443

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD+QVVTVG+ +GGGAFNVIP+ VTIGGTFRAF RE   QLR+RIE+VI+GQAAV RC
Sbjct  260  DPLDTQVVTVGNIQGGGAFNVIPNFVTIGGTFRAFLRESFTQLRQRIEQVIIGQAAVHRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE +  S PPTIN+  LH +FQ VAG LLG  +VK H  LM  +DFAFYQE MP
Sbjct  320  NATVSFLEDKISSYPPTINNDSLHDYFQSVAGSLLGVDKVKGHHLLMGSEDFAFYQEAMP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI--LERQLEWVTNK  205
            GY++ +G++D +  ++  S HSPYFKVNED  PYG AL  SLA RY+  L +++  V  K
Sbjct  380  GYVFIVGMEDVSV-ERLRSWHSPYFKVNEDVLPYGVALHVSLATRYLTKLNQEVPTVDGK  438

Query  204  -HDEL  193
             HDEL
Sbjct  439  YHDEL  443



>ref|XP_010088385.1| IAA-amino acid hydrolase ILR1-like 4 [Morus notabilis]
 gb|EXB34859.1| IAA-amino acid hydrolase ILR1-like 4 [Morus notabilis]
Length=445

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR RIEEVI GQA+VQRC
Sbjct  262  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFMQLRHRIEEVITGQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE+EKP  PPT+N  DLH +F++VAG+LLG  +VKD +PLM  +DF+FYQE +P
Sbjct  322  NATVDFLENEKPFFPPTVNHEDLHDYFRRVAGELLGIHKVKDMQPLMGSEDFSFYQEAIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY + LG++D+    K  S HSP+F++NED FPYGAAL A+LAA Y+ E Q E    +  
Sbjct  382  GYFFLLGMEDKTL-GKLESVHSPFFQINEDVFPYGAALHAALAASYLSEFQHEVPIPEGE  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  YHDEL  445



>ref|XP_003530016.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=442

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QVVTV  F+GGGAFNVIPD VTIGGTFRAFSRE + QL++RI++V++GQAAVQRC
Sbjct  258  DPLDPQVVTVAKFQGGGAFNVIPDYVTIGGTFRAFSREKLDQLKQRIKQVVIGQAAVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHK-PLMAGDDFAFYQEVM  382
            NATVNFL+  +PS PPT+N+ DLH+ F  VAG+LLG++ V   K P+MA +DFAFYQEV+
Sbjct  318  NATVNFLDETRPSYPPTVNNGDLHKLFVDVAGNLLGTNNVNIEKTPIMAAEDFAFYQEVI  377

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ---LEWVT  211
            PGY   LG+K  A+ +   S HSPY K++EDA PYGAAL ASLA  Y+L  Q    + V 
Sbjct  378  PGYFIMLGVKS-ASPEPHQSLHSPYLKISEDALPYGAALHASLATSYLLRYQQDVAKVVG  436

Query  210  NKHDEL  193
              HDEL
Sbjct  437  KYHDEL  442



>gb|KHN32672.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=687

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR+RIE+VI GQAAVQRC
Sbjct  211  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFSKESFMQLRQRIEQVITGQAAVQRC  270

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVNFL+ EKP  PPT+N+ DLH +F+ VAG LLG + VK+ +PLM  +DFAFYQEV P
Sbjct  271  NATVNFLDDEKPFSPPTVNNGDLHGYFESVAGSLLGVNNVKEMQPLMGSEDFAFYQEVFP  330

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQAS  256
            GY + LG+ D A+++   S HSPYFK+NEDA PYGAAL  +
Sbjct  331  GYFFLLGM-DNASNEHLESPHSPYFKINEDALPYGAALHVT  370



>ref|XP_010062569.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW69702.1| hypothetical protein EUGRSUZ_F03096 [Eucalyptus grandis]
Length=446

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIP+SVTIGGTFRAFS E  + L++RIEEV+  QAAVQRC
Sbjct  262  DPLDSQVVTVAKFQGGGAFNVIPESVTIGGTFRAFSNESFMHLKQRIEEVVTSQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F   E    PPTIND  LH+HF+KVA +LLG  ++ D +P+M  +DF+FYQEV+P
Sbjct  322  HATVHFFSEENLFFPPTINDESLHKHFKKVARELLGPHKINDMQPMMGSEDFSFYQEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            GY + LG+ D+  +   ++ HSPYFK+NED  PYG+AL ASLA  Y+L++Q
Sbjct  382  GYFFFLGVGDDTGERYDSAPHSPYFKINEDGLPYGSALHASLAVTYLLDQQ  432



>ref|XP_011077950.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X3 [Sesamum 
indicum]
Length=341

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = -2

Query  729  DSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCNAT  550
            D +VVT+  F+GG AFNVIPDSVTI GTFRAFS+E  +QL+ RIEEVI  QA+VQRCNA+
Sbjct  161  DLEVVTIAKFQGGHAFNVIPDSVTIAGTFRAFSQESFMQLKHRIEEVITLQASVQRCNAS  220

Query  549  VNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMPGYI  370
            VNF   EKP  P T+ND+DLH+HFQK+AG +LG   VK+ +PLM  +DF+F+ E +PGY 
Sbjct  221  VNFYADEKPFYPVTVNDKDLHKHFQKIAGHMLGDENVKEVQPLMGAEDFSFFAEAIPGYF  280

Query  369  YGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK---HD  199
            Y +G+ +E  + + AS HSPYFKVNEDA PYGAAL AS+AA Y+LE      T K   HD
Sbjct  281  YYIGMFNE-TEGQLASGHSPYFKVNEDALPYGAALHASIAATYLLEHHSPIATQKRSSHD  339

Query  198  EL  193
            EL
Sbjct  340  EL  341



>ref|XP_009624362.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=445

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RI EVI  QAAVQRC
Sbjct  262  NPLDSQVVTVGMFKGGGAFNVIPDSVTIGGTFRAFSKESFTQLKQRIVEVITRQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F    +P  P T+N++ LH+HF+ VA  +LG+ ++ + KP M  +DF+F+ E  P
Sbjct  322  NATVDFDTKNRPFYPVTVNNKALHEHFRDVAAQMLGNDKIIEKKPTMGTEDFSFFAEAFP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    +  S H+P+++VNEDA PYGAAL ASLA  Y+LERQL+  T   N
Sbjct  382  GYFYLLGMVDE-TKGRFESGHNPFYRVNEDALPYGAALHASLATTYLLERQLKTTTHDRN  440

Query  207  KHDEL  193
             HDEL
Sbjct  441  VHDEL  445



>ref|XP_004158429.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
4-like [Cucumis sativus]
Length=445

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 137/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RI EVI  QA VQRC
Sbjct  262  DPLDSQVVTIAKFQGGGAFNVIPDSVTIGGTFRAFSKESFIQLKQRIVEVITNQAKVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E +KP  P T+N+++L++HF+ VA D+LG+  + D +PLM  +DF FY EV+P
Sbjct  322  NATVEFNEDQKPXFPVTVNNQNLYKHFRTVAVDMLGTKNILDMQPLMGAEDFGFYGEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            G  Y LG+K+E    K    HSPY+ VNED  PYGAALQAS+A RY+LE   +  + K  
Sbjct  382  GLFYFLGMKNETI-GKFEQGHSPYYIVNEDVLPYGAALQASIATRYLLEHSPKSTSTKEH  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  SHDEL  445



>ref|XP_008450808.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=445

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RI EVI  QA VQRC
Sbjct  262  DPLDSQVVTIAKFQGGGAFNVIPDSVTIGGTFRAFSKESFIQLKQRIVEVITKQAKVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E +KP  P T+ND++L++HF+ VA D+LG+  + D +PLM  +DF FY EV+P
Sbjct  322  NATVEFNEDQKPFFPVTLNDQNLYKHFRTVAVDMLGTKNILDMQPLMGAEDFGFYGEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            G  Y LG+K+E    K    HSPY+ VNED  PYGAALQAS+AARY++E   +  + K  
Sbjct  382  GLFYFLGMKNETI-GKFEQGHSPYYIVNEDVLPYGAALQASIAARYLIEYSPKSTSTKGH  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  SHDEL  445



>emb|CDY22869.1| BnaA06g02080D [Brassica napus]
Length=442

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL+ EKP  PPT+ND+ LH  F+ V+GD+LG+    + +PLM  +DF+FYQ  MP
Sbjct  322  NATVDFLQEEKPFFPPTVNDKALHMFFKNVSGDMLGTENYFEMQPLMGAEDFSFYQVSMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNKHD  199
            G+   +G+++E A    AS HSPYF+VNE+  PYGAAL AS+A RY+L+ +   ++N  D
Sbjct  382  GHFSFVGMQNE-AHSPMASPHSPYFEVNEEVLPYGAALHASMATRYLLDLKTSSLSNSKD  440

Query  198  EL  193
            EL
Sbjct  441  EL  442



>gb|KDO55916.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=445

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 8/187 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEE--VIVGQAAVQ  565
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEE  V++ QA+VQ
Sbjct  262  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEWQVVMKQASVQ  321

Query  564  RCNATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEV  385
            RCNATV F   +K   P T+N+++LH+HFQKVA D+LG   +K+++PLM  +DF+F+ E 
Sbjct  322  RCNATVTF--DDKSFYPVTVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEA  379

Query  384  MPGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT--  211
            +PGY Y LG+ DE    K  + HSPYF+VNEDA PYGAAL ASLA RY+LE Q +     
Sbjct  380  IPGYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAALHASLATRYLLENQPKTTLAS  438

Query  210  -NKHDEL  193
             + HDEL
Sbjct  439  RSLHDEL  445



>ref|XP_008380826.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Malus domestica]
Length=446

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QV+TVG F+GG AFNVIPDSV I GTFRAF+ E ++QL++RI++VI GQA+V RC
Sbjct  263  DPLDXQVITVGKFQGGDAFNVIPDSVKIDGTFRAFTTESLMQLKQRIKQVITGQASVHRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATVNF E EKP  PPT+N +DL +HF+ VAGD+LG  +VKDH+  M  +DFA+YQE +P
Sbjct  323  LATVNFFEDEKPLSPPTVNHKDLREHFRNVAGDMLGFEKVKDHQRWMGSEDFAYYQEAIP  382

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY   LG+ D+A        HSPYF++NEDA PYGAAL AS AARY+LE Q E       
Sbjct  383  GYFSFLGMADDALGPLPMP-HSPYFRINEDALPYGAALHASFAARYLLEFQQEVPLPERE  441

Query  207  KHDEL  193
             HDEL
Sbjct  442  HHDEL  446



>ref|XP_004135685.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 gb|KGN66199.1| hypothetical protein Csa_1G575150 [Cucumis sativus]
Length=445

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RI EVI  QA VQRC
Sbjct  262  DPLDSQVVTIAKFQGGGAFNVIPDSVTIGGTFRAFSKESFIQLKQRIVEVITNQAKVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F E +KP  P T+N+ +L++HF+ VA D+LG+  + D +PLM  +DF FY EV+P
Sbjct  322  NATVEFNEDQKPFFPVTVNNHNLYKHFRTVAVDMLGTKNILDMQPLMGAEDFGFYGEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            G  Y LG+K+E    K    HSPY+ VNED  PYGAALQAS+A RY+LE   +  + K  
Sbjct  382  GLFYFLGMKNETV-GKFEQGHSPYYIVNEDVLPYGAALQASIATRYLLEHSPKSTSTKEH  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  SHDEL  445



>ref|XP_006353512.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=446

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RI EVI  QAAVQRC
Sbjct  263  DPLDSQVVTVAKFKGGGAFNVIPDSVTIGGTFRAFSKESFTQLKQRIVEVITRQAAVQRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F    +P  P T+N++ LH+HF+ VAG +LG  ++ + KP M  +DF+F+ E  P
Sbjct  323  NATVDFDTKNRPFYPVTVNNKALHEHFRNVAGQMLGIDKILEKKPTMGSEDFSFFAEAFP  382

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    +  S HSP+++VNEDA PYG AL ASLA  Y+LE QL+  T   N
Sbjct  383  GYFYLLGMVDE-TKGRFESGHSPFYRVNEDALPYGVALHASLATTYLLEHQLKSTTRDQN  441

Query  207  KHDEL  193
             HDEL
Sbjct  442  VHDEL  446



>ref|XP_010690089.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=450

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 141/187 (75%), Gaps = 7/187 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRA  +E +++L++RI EVI+ QAAVQRC
Sbjct  266  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRALLKESLLRLKQRIGEVIISQAAVQRC  325

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             AT++F +SE    PPTIND +LH+ F +VA D+LGS  VK+ KPL   +DFAFYQEV+P
Sbjct  326  TATIDFYDSEN-FYPPTINDENLHELFTRVASDMLGSRNVKEAKPLTGSEDFAFYQEVIP  384

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY++ +GLK+E     S SEH+P F VNED  PYGA+L ASLA RY+LE+  +  T    
Sbjct  385  GYLFFVGLKNE-TRGISGSEHNPKFMVNEDVLPYGASLHASLAVRYLLEKGAKIPTQDIT  443

Query  204  ---HDEL  193
               HDEL
Sbjct  444  HQFHDEL  450



>ref|XP_009147731.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Brassica rapa]
Length=442

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL+ EKP  PPT+ND+ LH  F+ V+GD+LG+    + +PLM  +DF+FYQ  MP
Sbjct  322  NATVDFLQEEKPFFPPTVNDKALHMFFKNVSGDMLGTKNYFEMQPLMGAEDFSFYQVSMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNKHD  199
            G+   +G+++E A    AS HSPYF+VNE+  PYGAAL AS+A RY+L+ +    +N  D
Sbjct  382  GHFSFVGMQNE-AHSPMASPHSPYFEVNEEVLPYGAALHASMATRYLLDSKTSSPSNSKD  440

Query  198  EL  193
            EL
Sbjct  441  EL  442



>ref|NP_001043347.1| Os01g0560000 [Oryza sativa Japonica Group]
 sp|Q8S9S4.1|ILL1_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB85405.1| putative auxin amidohydrolase [Oryza sativa Japonica Group]
 dbj|BAF05261.1| Os01g0560000 [Oryza sativa Japonica Group]
 gb|EAZ12344.1| hypothetical protein OsJ_02236 [Oryza sativa Japonica Group]
 dbj|BAG97475.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  259  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+FL+ ++P  PPTIN   LH  F KVA +++G   V+D +PLM  +DFAFY + +P
Sbjct  319  NAVVDFLDKDRPFFPPTINSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIP  378

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWV--TN  208
              Y Y LG+ +E    + A  HSPYF +NEDA PYGAALQASLAARY+LE Q        
Sbjct  379  ATYYYFLGMYNETRGPQ-APHHSPYFTINEDALPYGAALQASLAARYLLEHQPPTTGKAK  437

Query  207  KHDEL  193
             HDEL
Sbjct  438  AHDEL  442



>ref|XP_010479682.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Camelina sativa]
Length=441

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +  +QL+KRIE+VI  QA+V  C
Sbjct  259  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVHMC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F+E EKP  PPT+ND++LH+ F+ V+GD+LG+    + +PLM  +DF+FYQE +P
Sbjct  319  NATVDFIEEEKPFFPPTVNDKELHKFFKNVSGDMLGTENYVEMQPLMGSEDFSFYQETIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--K  205
            G+   +G++++ A    AS HSP+F+VNE+  PYGA+L AS+A RY+LE +   +T   K
Sbjct  379  GHFSFVGMQNK-AHSPMASPHSPFFEVNEELLPYGASLHASMATRYLLELKASTLTQSYK  437

Query  204  HDEL  193
             DEL
Sbjct  438  KDEL  441



>ref|XP_010462018.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Camelina 
sativa]
 ref|XP_010462019.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X2 [Camelina 
sativa]
Length=441

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +  +QL+KRIE+VI  QA+V  C
Sbjct  259  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVHMC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F+E EKP  PPT+ND++LH+ F+ V+GD+LG+    + +PLM  +DF+FYQE +P
Sbjct  319  NATVDFIEEEKPFFPPTVNDKELHKFFKNVSGDMLGTENYVEMQPLMGSEDFSFYQETIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--K  205
            G+   +G++++ A    AS HSP+F+VNE+  PYGA+L AS+A RY+LE +   +T   K
Sbjct  379  GHFSFVGMQNK-AHSPMASPHSPFFEVNEELLPYGASLHASMATRYLLELKASTLTQSYK  437

Query  204  HDEL  193
             DEL
Sbjct  438  RDEL  441



>emb|CDX87841.1| BnaC06g09030D [Brassica napus]
Length=444

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE EKP  PPT+ND+DLH  F+ V+GD+LG+    + +PLM  +DF+FYQ+ MP
Sbjct  322  NATVDFLEEEKPFFPPTVNDKDLHMFFKNVSGDMLGTQNYVEMQPLMGSEDFSFYQQAMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A RY+L+
Sbjct  382  GHFSFVGMQNE-AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLLD  429



>ref|XP_010500762.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Camelina sativa]
Length=441

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +  +QL+KRIE+VI  QA+V  C
Sbjct  259  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVHMC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F+E EKP  PPT+ND++LH+ F+ V+GD+LG+    + +PLM  +DF+FYQE +P
Sbjct  319  NATVDFIEEEKPFFPPTVNDKELHKFFKNVSGDMLGTENYVEMQPLMGSEDFSFYQEAIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--K  205
            G+   +G++++ A    AS HSP+F+VNE+  PYGA+L AS+A RY+LE +   +T   K
Sbjct  379  GHFSFVGMQNK-AHSPMASPHSPFFEVNEELLPYGASLHASMATRYLLELKASTLTQSYK  437

Query  204  HDEL  193
             DEL
Sbjct  438  KDEL  441



>gb|KFK35825.1| hypothetical protein AALP_AA4G042000 [Arabis alpina]
Length=393

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  211  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSPKSFAQLKKRIEQVITRQASVHMC  270

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE  KP  PPT+ND+DLHQ F+ V+GDLLG+    + +PLM  +DF+FYQE MP
Sbjct  271  NATVDFLEDNKPFFPPTVNDKDLHQFFKNVSGDLLGTENYFEMQPLMGSEDFSFYQESMP  330

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYIL  235
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A R++L
Sbjct  331  GHFSFVGMQNE-AHSPMASPHSPYFEVNEETLPYGASLHASMATRFLL  377



>ref|NP_175587.1| IAA-amino acid hydrolase IAR3 [Arabidopsis thaliana]
 sp|O04373.2|ILL4_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50883.1|AC025294_21 IAA-Ala hydrolase (IAR3) [Arabidopsis thaliana]
 gb|AAK53028.1|AF375444_1 At1g51760/F19C24_4 [Arabidopsis thaliana]
 gb|AAC32192.1| IAA-Ala hydrolase [Arabidopsis thaliana]
 gb|AAN28900.1| At1g51760/F19C24_4 [Arabidopsis thaliana]
 gb|AEE32712.1| IAA-amino acid hydrolase ILR1-like 4 [Arabidopsis thaliana]
Length=440

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +  +QL+KRIE+VI  QA+V  C
Sbjct  258  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVNMC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F+E EKP  PPT+ND+ LHQ F+ V+GD+LG     + +PLM  +DF+FYQ+ +P
Sbjct  318  NATVDFIEEEKPFFPPTVNDKALHQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQQAIP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWV--TNK  205
            G+   +G++++ A    AS HSPYF+VNE+  PYGA+L AS+A RY+LE +   +  +NK
Sbjct  378  GHFSFVGMQNK-ARSPMASPHSPYFEVNEELLPYGASLHASMATRYLLELKASTLNKSNK  436

Query  204  HDEL  193
             DEL
Sbjct  437  KDEL  440



>ref|XP_010528938.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=445

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS E   QL+KRIE+VI  QA+VQRC
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSNESFKQLKKRIEQVITRQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATV+FLE  KP  PPT+ND++LH  F+KVAG++LG+    + +PLM  +DF+FYQE  P
Sbjct  322  IATVDFLEEGKPFFPPTVNDKNLHGFFKKVAGEMLGTENYSEMQPLMGSEDFSFYQEAKP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G  Y +G+++E    +  + HSPYF+VNE+A PYGAAL ASLAA Y+LE +
Sbjct  382  GLFYFVGMQEE-GKPRMENLHSPYFRVNEEAIPYGAALHASLAATYLLESR  431



>ref|XP_010535205.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=444

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS+E   QL+ RIE+VI  QA+VQRC
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSKESFKQLKTRIEQVITRQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE  KP  PPT+ND+DLH+ F+ VAGD+LG+    + KPLM  +DF+ YQEV P
Sbjct  322  NATVDFLEG-KPFFPPTVNDKDLHRFFKNVAGDVLGTENYSEMKPLMGSEDFSSYQEVKP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G+ Y +G++++       + HSPYF+VNED+ PYGAAL ASLA RY+LE +
Sbjct  381  GFFYFVGMQNKGHPPMD-NPHSPYFRVNEDSLPYGAALHASLATRYLLESR  430



>sp|Q84XG9.1|ILL1_ORYSI RecName: Full=IAA-amino acid hydrolase ILR1-like 1; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAO25632.1| IAA-amino acid hydrolase [Oryza sativa Indica Group]
 gb|EAY74541.1| hypothetical protein OsI_02433 [Oryza sativa Indica Group]
Length=442

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  259  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+FL+ ++P  PPTIN   LH  F KVA +++G   V+D +PLM  +DFAFY + +P
Sbjct  319  NAVVDFLDKDRPFFPPTINSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIP  378

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWV--TN  208
              Y Y LG+ +E    + A  HSPYF +NEDA PYGAALQASLA RY+LE Q        
Sbjct  379  ATYYYFLGMYNETRGPQ-APHHSPYFTINEDALPYGAALQASLATRYLLEHQPPTTGKAK  437

Query  207  KHDEL  193
             HDEL
Sbjct  438  AHDEL  442



>ref|XP_004510337.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=442

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GG AFNVIPD VTIGGTFRAFS++   QLR+RIEEVIVGQAAVQRC
Sbjct  257  DPLDSQVVTIAMFQGGSAFNVIPDYVTIGGTFRAFSKQSFNQLRQRIEEVIVGQAAVQRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
            NATVNF +  KPS PPT+N+ DLH+HF  VA D+LG ++V    +P M  +DF+FYQEV+
Sbjct  317  NATVNFFDESKPSYPPTVNNGDLHEHFVNVAVDMLGINKVDSVTQPSMGAEDFSFYQEVI  376

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ---LEWVT  211
            PGY + LG+++ A++++  S HSPY  +NED  PYG  L ASLA+ Y+L+ Q      V 
Sbjct  377  PGYFFMLGMQN-ASNNRFDSLHSPYLTINEDGLPYGVPLHASLASSYLLKLQQXXXXGVQ  435

Query  210  NK-HDEL  193
             K HDEL
Sbjct  436  RKYHDEL  442



>ref|XP_006646005.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
1-like [Oryza brachyantha]
Length=454

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  271  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  330

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+FL  ++P  PPTIN   LH  F KVA +++G   V+D +PLM  +DFAFY + +P
Sbjct  331  NAVVDFLNKDRPFFPPTINHAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIP  390

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWV--TN  208
              Y Y LG+ +E    + A  HSPYF +NED  PYGAALQASLAARY+LE Q   +    
Sbjct  391  ATYYYFLGMCNETRGPQ-APHHSPYFTINEDTLPYGAALQASLAARYLLEHQHAAIDKVR  449

Query  207  KHDEL  193
             HDEL
Sbjct  450  AHDEL  454



>ref|XP_002891660.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67919.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +  +QL+KRIE+VI  QA+V  C
Sbjct  258  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVNMC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F+E EKP  PPT+ND+DLHQ F+ V+GD+LG     + +PLM  +DF+FYQ+ +P
Sbjct  318  NATVDFIEEEKPFFPPTVNDKDLHQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQQAIP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--K  205
            G+   +G++++ A    A+ HSPYF+VNE+  PYGA+L AS+A RY+LE +   +    K
Sbjct  378  GHFSFVGMQNK-AHSPMANPHSPYFEVNEELLPYGASLHASMATRYLLELKASTLNKSYK  436

Query  204  HDEL  193
             DEL
Sbjct  437  KDEL  440



>ref|XP_008806725.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Phoenix dactylifera]
 ref|XP_008777919.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Phoenix dactylifera]
Length=436

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RIEEVIV QA+VQRC
Sbjct  254  DPLDSQVLTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFSQLKQRIEEVIVAQASVQRC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+FL  E+P  P T+N  DLH+HFQKVA ++LGSS V+D +P+M  +DFAF+ EV+P
Sbjct  314  SATVDFLIKERPFFPVTVNSNDLHEHFQKVAEEMLGSSNVRDRQPVMGAEDFAFFTEVIP  373

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQL-EWVTNK  205
              Y Y +G+ + A+       HSPYF VNE+A PYGAAL ASLA  Y+ E        + 
Sbjct  374  MAYYYFVGMMN-ASHGPLHPAHSPYFTVNEEALPYGAALHASLAVWYLFENHAPSSKADS  432

Query  204  HDEL  193
            HDEL
Sbjct  433  HDEL  436



>gb|EYU30670.1| hypothetical protein MIMGU_mgv1a006375mg [Erythranthe guttata]
Length=446

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  FRGG AFNVIPDSVTIGGTFRAFS++G ++L+ RIEEVI  QAAVQRC
Sbjct  263  DPLDSQVVTIAKFRGGHAFNVIPDSVTIGGTFRAFSKQGFIELKHRIEEVITLQAAVQRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VNF   EKP  P T ND++LHQHF K+A  ++G  ++++ +P M  +DF+F+ E +P
Sbjct  323  NASVNFYGEEKPFYPVTSNDKELHQHFLKIARSMIGDEKIQELQPSMGSEDFSFFAESIP  382

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE-RQLEWVTNK-  205
            GY Y +G+ +E  + +  + HSPYF+VNEDA PYGAAL ASLAA Y+LE R      N+ 
Sbjct  383  GYFYYVGMVNE-TEGQMETGHSPYFRVNEDALPYGAALHASLAATYLLEGRSSVEAQNRS  441

Query  204  -HDEL  193
             HDEL
Sbjct  442  FHDEL  446



>ref|XP_002283047.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=439

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 137/186 (74%), Gaps = 8/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI  Q++VQRC
Sbjct  258  DPLDSQVVTVAKFKGGGAFNVIPDSVTIGGTFRAFSKESFLQLKQRIEEVITLQSSVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F     P  P T N++DLH+HFQ VAGD+LG+  +K+   +M  +DF+F+ E +P
Sbjct  318  NATVHF---NDPFYPVTANNKDLHKHFQNVAGDMLGTQNIKEMPLVMGAEDFSFFAEAIP  374

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY Y LG+K+E         H+PY+ VNEDA PYGAAL ASLA RY+LE Q   +T+   
Sbjct  375  GYFYYLGMKNETRGQLELG-HTPYYTVNEDALPYGAALHASLATRYLLEYQQPIITSPKE  433

Query  204  --HDEL  193
              HDEL
Sbjct  434  SLHDEL  439



>ref|XP_010924947.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=437

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RIEEVIV QA+VQRC
Sbjct  254  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFSQLKQRIEEVIVAQASVQRC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F+  E+P  P T+N  +LH +F KVA  ++GS+ V+D +P+M  +DFAF+ EV+P
Sbjct  314  SATVDFIAKERPFFPVTVNSNNLHGYFHKVAEQMVGSNNVRDRQPVMGAEDFAFFTEVVP  373

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT--N  208
              Y Y +G+ D A++      HSPYF VNE+A PYGAAL ASLAARY+ E      +  N
Sbjct  374  MAYYYFVGMND-ASNGPQHPPHSPYFTVNEEALPYGAALHASLAARYLFENHAPSPSKAN  432

Query  207  KHDEL  193
             HDEL
Sbjct  433  THDEL  437



>gb|KDP33760.1| hypothetical protein JCGZ_07331 [Jatropha curcas]
Length=447

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 137/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+  F+GG AFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI  QA+VQRC
Sbjct  264  DPLDSQVVTIAKFQGGEAFNVIPDSVTIGGTFRAFSKESFIQLKQRIEEVITRQASVQRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   EKP  P T+N++DLH+HF  VA D+LG+  + + +P+M  +DF+F+ E +P
Sbjct  324  NATVMFNSDEKPFYPATVNNQDLHKHFINVATDMLGAQNIIEMQPVMGAEDFSFFAEAIP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY + +G+K+E +     + HSPYF VNED  PYGAAL ASLA RY+LE Q E      N
Sbjct  384  GYFFFVGMKNE-SQGPIRNGHSPYFTVNEDVLPYGAALYASLATRYLLEYQPESKPSEGN  442

Query  207  KHDEL  193
             HDEL
Sbjct  443  IHDEL  447



>emb|CAN61999.1| hypothetical protein VITISV_007874 [Vitis vinifera]
Length=416

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 136/186 (73%), Gaps = 8/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI  Q++VQRC
Sbjct  235  DPLDSQVVTVAKFKGGGAFNVIPDSVTIGGTFRAFSKESFLQLKQRIEEVITLQSSVQRC  294

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F     P  P T N++DLH+HFQ VAGD+LG+  +K+   +M  +DF+F+ E +P
Sbjct  295  NATVHF---NDPFYPVTANNKDLHKHFQNVAGDMLGTQNIKEMPLVMGAEDFSFFAEAIP  351

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY Y LG+K+E         H PY+ VNEDA PYGAAL ASLA RY+LE Q   +T+   
Sbjct  352  GYFYYLGMKNETRGQLELG-HXPYYTVNEDALPYGAALHASLATRYLLEYQQPIITSPKE  410

Query  204  --HDEL  193
              HDEL
Sbjct  411  SLHDEL  416



>emb|CDY43926.1| BnaA05g15360D [Brassica napus]
Length=444

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE EKP  PPT+N +DLH  F+ V+GD+LG+    + +PLM  +DF+FYQ+ MP
Sbjct  322  NATVDFLEEEKPFFPPTVNHKDLHMFFKNVSGDMLGTQNYVEMQPLMGSEDFSFYQQSMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A RY+L+
Sbjct  382  GHFSFVGMQNE-AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLLD  429



>ref|NP_001288913.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Brassica rapa]
 gb|ABB60091.1| IAA-amino acid hydrolase 3 [Brassica rapa]
Length=444

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE EKP  PPT+N +DLH  F+ V+GD+LG+    + +PLM  +DF+FYQ+ MP
Sbjct  322  NATVDFLEEEKPFFPPTVNHKDLHMFFKNVSGDMLGTQNYVEMQPLMGSEDFSFYQQSMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A RY+L+
Sbjct  382  GHFSFVGMQNE-AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLLD  429



>gb|ABB60090.1| IAA-amino acid hydrolase 3 [Brassica rapa]
Length=441

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  259  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFTQLKKRIEQVITRQASVHMC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE EKP  PPT+N +DLH  F+ V+GD+LG+    + +PLM  +DF+FYQ+ MP
Sbjct  319  NATVDFLEEEKPFFPPTVNHKDLHMFFKNVSGDMLGTQNYVEMQPLMGSEDFSFYQQSMP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A RY+L+
Sbjct  379  GHFSFVGMQNE-AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLLD  426



>ref|XP_006307542.1| hypothetical protein CARUB_v10009165mg [Capsella rubella]
 gb|EOA40440.1| hypothetical protein CARUB_v10009165mg [Capsella rubella]
Length=440

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +  +QL+KRIE+VI  QA+V  C
Sbjct  258  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFLQLKKRIEQVITRQASVHMC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F+E EKP  PPT+ND+DLH+ F+ V+GD+LG     + +PLM  +DF+FYQE +P
Sbjct  318  NATVDFIEDEKPFFPPTVNDKDLHKFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQETIP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--K  205
            G+   +G++++ A    AS HSP+F+VNE   PYGA+L AS+A RY+LE +   +    K
Sbjct  378  GHFSFVGMQNK-AHAPMASPHSPFFEVNEQLLPYGASLHASMATRYLLELKASTLNKSYK  436

Query  204  HDEL  193
             DEL
Sbjct  437  KDEL  440



>dbj|BAJ94305.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 140/186 (75%), Gaps = 5/186 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  257  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVTQASVQRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL+ ++P  PPTIN+ +LH  F KV  +++G ++V++ +PLM  +DF+FY EV+P
Sbjct  317  SAVVDFLDKDRPFFPPTINNPELHDFFVKVGSEMVGPNKVREKQPLMGAEDFSFYTEVVP  376

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQL---EWVT  211
              Y Y +G+ +E    + A  HSPYF +NED  PYGAA+QASLAARY+LE QL     V 
Sbjct  377  KTYYYFVGMLNETRGPQ-APHHSPYFTINEDTLPYGAAMQASLAARYLLEHQLVTAAKVV  435

Query  210  NKHDEL  193
               DEL
Sbjct  436  EPRDEL  441



>ref|XP_007012935.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY30554.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=444

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++G F+GGGAFNVIPDSVTIGGTFRAFS+E  VQL++RIEEVI+ QA+VQRC
Sbjct  262  DPLDSQVVSIGKFQGGGAFNVIPDSVTIGGTFRAFSKESFVQLKQRIEEVIMKQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   EK S P ++N+++LH++F+KVAGD+LG   + + +P+M G+DFAF+ E +P
Sbjct  322  NATVIF--DEKSSYPVSLNNKELHEYFRKVAGDMLGLENIVEMQPIMGGEDFAFFSEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            G  + LG+K+E    +  S HSPY++VNED  PYGA L ASLA RY+LE   +  +    
Sbjct  380  GLFFFLGMKNE-TQGQFHSGHSPYYRVNEDVLPYGAVLHASLATRYLLENLPKHTSPPKG  438

Query  210  NKHDEL  193
            + HDEL
Sbjct  439  SYHDEL  444



>ref|XP_010049575.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW82275.1| hypothetical protein EUGRSUZ_C03691 [Eucalyptus grandis]
Length=445

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 138/185 (75%), Gaps = 6/185 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV    GGGAFNVIPDSVTIGGTFR FS +G++QL++RIEEVI+ QA+VQRC
Sbjct  264  DPLDSQVVTVAKIEGGGAFNVIPDSVTIGGTFRVFSMDGLIQLKQRIEEVIMRQASVQRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F  S KP  PPT N + LH+HF+ VA D+LG  ++   +PLM  +DF+FY EV+P
Sbjct  324  NATVSF--SVKPFYPPTANHKALHEHFKNVARDMLGPDKILGMEPLMGSEDFSFYTEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            GY Y +G+KDE+     A  HSP++++NEDA  YGAAL A+LA RYILE Q +    K  
Sbjct  382  GYFYYVGMKDESLGKMEAG-HSPHYRLNEDALSYGAALHAALATRYILENQQKSDAAKES  440

Query  204  -HDEL  193
             HDEL
Sbjct  441  SHDEL  445



>ref|XP_007012939.1| Peptidase M20/M25/M40 family protein isoform 5 [Theobroma cacao]
 gb|EOY30558.1| Peptidase M20/M25/M40 family protein isoform 5 [Theobroma cacao]
Length=445

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++G F+GGGAFNVIPDSVTIGGTFRAFS+E  VQL++RIEEVI+ QA+VQRC
Sbjct  263  DPLDSQVVSIGKFQGGGAFNVIPDSVTIGGTFRAFSKESFVQLKQRIEEVIMKQASVQRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   EK S P ++N+++LH++F+KVAGD+LG   + + +P+M G+DFAF+ E +P
Sbjct  323  NATVIF--DEKSSYPVSLNNKELHEYFRKVAGDMLGLENIVEMQPIMGGEDFAFFSEAIP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            G  + LG+K+E    +  S HSPY++VNED  PYGA L ASLA RY+LE   +  +    
Sbjct  381  GLFFFLGMKNE-TQGQFHSGHSPYYRVNEDVLPYGAVLHASLATRYLLENLPKHTSPPKG  439

Query  210  NKHDEL  193
            + HDEL
Sbjct  440  SYHDEL  445



>gb|ABB16358.1| IAA hydrolase [Phalaenopsis hybrid cultivar]
Length=444

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RIEEVIV QA+VQRC
Sbjct  258  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFSKESFYQLKQRIEEVIVAQASVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATVNFLE E+P  P T+N+  LH HF KVAG ++G   V+D  P+M  +DFAF+ E++P
Sbjct  318  SATVNFLEKERPFFPVTVNNETLHAHFLKVAGGIVGPGNVRDRHPVMGAEDFAFFTEIVP  377

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNKH  202
              Y Y LG++ E+ +      HSPYF VNED  PYGAAL ASLA +++LE  L   +  H
Sbjct  378  RTYYYFLGMQSESGELLRPG-HSPYFTVNEDVLPYGAALHASLAQQFLLEADLALQSPSH  436



>ref|XP_010545642.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=445

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 128/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GG AFNVIPDSVTIGGTFRAFS E   QL+KRIE+VI  QA+VQRC
Sbjct  262  DPLDSQVVTVAKFKGGDAFNVIPDSVTIGGTFRAFSSESFNQLKKRIEQVITSQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F E  +P  PPT+ND++LH+ F+ V G++LG    ++ +P+M  +DFAFYQE  P
Sbjct  322  NATVDFFEEGRPFFPPTVNDKELHRFFKNVTGEMLGMENYEETQPVMGAEDFAFYQEAKP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G  Y LG++ E    +    HSPYF+VNE + PYGAALQASLA RY+LE
Sbjct  382  GLFYFLGMEKE-GHPRLEGGHSPYFRVNEGSLPYGAALQASLATRYLLE  429



>gb|EMT10443.1| IAA-amino acid hydrolase ILR1-like protein 1 [Aegilops tauschii]
Length=437

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  254  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFMKESFNQLKQRIEEVIVTQASVQRC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL+ +KP  PPTIN+ +LH  F KV  +++G + V++ +PLM  +DF+FY E +P
Sbjct  314  SAVVDFLDKDKPFFPPTINNPELHDFFAKVCSEMVGPNNVREKQPLMGAEDFSFYTEAVP  373

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA+QASLAARY+LE Q
Sbjct  374  KTYYYFVGMLNETRGPQ-APHHSPYFTINEDALPYGAAMQASLAARYLLEHQ  424



>gb|AAU06081.1| auxin amidohydrolase [Triticum aestivum]
Length=437

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  254  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFMKESFNQLKQRIEEVIVTQASVQRC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL+ +KP  PPTIN+ +LH  F KV  +++G + V++ +PLM  +DF+FY E +P
Sbjct  314  SAVVDFLDKDKPFFPPTINNPELHDFFAKVCSEMVGPNNVREKQPLMGAEDFSFYTEAVP  373

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA+QASLAARY+LE Q
Sbjct  374  KTYYYFVGMLNETRGPQ-APHHSPYFTINEDALPYGAAMQASLAARYLLEHQ  424



>gb|KDO55915.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=423

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GGGAFN+IPDSVTIGGTFRAFS+E ++QL++RIEEV++ QA+VQRC
Sbjct  262  DPLDSQVLTVAKFEGGGAFNIIPDSVTIGGTFRAFSKESIIQLKQRIEEVVMKQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   +K   P T+N+++LH+HFQKVA D+LG   +K+++PLM  +DF+F+ E +P
Sbjct  322  NATVTF--DDKSFYPVTVNNKNLHEHFQKVAADMLGVQNIKENRPLMGTEDFSFFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLA  250
            GY Y LG+ DE    K  + HSPYF+VNEDA PYGAAL ASLA
Sbjct  380  GYFYYLGMNDE-TKGKFETGHSPYFRVNEDALPYGAALHASLA  421



>gb|ACU18798.1| unknown [Glycine max]
Length=201

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QV+T+   +GG AFNVIPD VTIGGTFRAFSRE +  L++RIE+VI+GQAAVQRC
Sbjct  19   DPLDPQVLTIAKLQGGDAFNVIPDYVTIGGTFRAFSRERLEHLKQRIEQVIIGQAAVQRC  78

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRV-KDHKPLMAGDDFAFYQEVM  382
            NATVNFL+ E P  PPT+N+ DLH+ F  VAG+LLG ++V  + +  MA +DFAFYQE +
Sbjct  79   NATVNFLDEENPLYPPTVNNGDLHKFFVDVAGNLLGINKVDTNMEQDMAAEDFAFYQEFI  138

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK-  205
            PGY + LG+ + A+ +  A  HSPY  +NED  PYGAAL ASLA  Y+ ++ +  V  K 
Sbjct  139  PGYYFTLGM-EIASSEPVAPLHSPYLVINEDGLPYGAALHASLATGYLYQQDVAKVVGKY  197

Query  204  HDEL  193
            HD+L
Sbjct  198  HDQL  201



>emb|CDM83125.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  252  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVTQASVQRC  311

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL+ +KP  PPTIN+ +LH  F KV  +++G + V++ +PLM  +DF+FY E +P
Sbjct  312  SAVVDFLDKDKPFFPPTINNPELHDFFAKVGSEMVGPNNVREKQPLMGAEDFSFYTEAVP  371

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA+QASLAARY+LE Q
Sbjct  372  KTYYYFVGMLNETRGPQ-APHHSPYFTINEDALPYGAAMQASLAARYLLEHQ  422



>ref|XP_010231929.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Brachypodium 
distachyon]
Length=444

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  261  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL+ ++P  PPTIN  +LH  F KVA +++G + V+D +PLM  +DF+FY E +P
Sbjct  321  SAVVDFLKKDRPFFPPTINSPELHDFFGKVASEMVGPNNVRDRQPLMGAEDFSFYAEAVP  380

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA+Q SLAARY+LE Q
Sbjct  381  TTYYYFVGMLNETRGPQ-APHHSPYFTINEDAMPYGAAMQTSLAARYLLEHQ  431



>ref|XP_009794201.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=445

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RI EVI  QAAVQRC
Sbjct  262  DPLDSQVVTVAKFKGGGAFNVIPDSVTIGGTFRAFSKESFTQLKQRIVEVITRQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            N TV+F    +P  P T+N++ LH+HF+ VA  +LG+ ++ + KP M  +DF+F+ E  P
Sbjct  322  NTTVDFDTENRPFYPVTVNNKALHEHFRDVAAQMLGNDKIIEKKPTMGTEDFSFFAEAFP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            GY Y LG+ DE    +  S H+P+++VNEDA PYGAAL ASLA  Y+LE Q++  T   N
Sbjct  382  GYFYLLGMVDE-TKGRFESGHNPFYRVNEDALPYGAALHASLATTYLLEHQVKATTQDRN  440

Query  207  KHDEL  193
              DEL
Sbjct  441  VRDEL  445



>ref|XP_010049762.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
Length=454

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 131/171 (77%), Gaps = 3/171 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV    GGGAFNVIPDSVTIGGTFR FS +G++QL++RIEEVI+ QA+VQRC
Sbjct  264  DPLDSQVVTVAKIEGGGAFNVIPDSVTIGGTFRVFSMDGLIQLKQRIEEVIMRQASVQRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F  S KP  PPT N + LH+HF+ VA D+LG   +   +PLM  +DF+FY EV+P
Sbjct  324  NATVSF--SVKPFYPPTANHKALHEHFKNVARDMLGPDNILGMEPLMGSEDFSFYTEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            GY Y +G+KDE+     A  HSP++++NEDA  YGAAL A+LA RYILE Q
Sbjct  382  GYFYYVGMKDESLGKMEAG-HSPHYRLNEDALSYGAALHAALATRYILENQ  431



>ref|XP_006392997.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
 gb|ESQ30283.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
Length=402

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  220  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFKQLQKRIEQVITRQASVHMC  279

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL+  KP  PPT+ND+ LHQ F+ V+GD+LG     + +PLM  +DF+FYQE MP
Sbjct  280  NATVDFLQEVKPFFPPTVNDKGLHQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQESMP  339

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A RY+L+
Sbjct  340  GHFSFVGMQNE-AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLLD  387



>ref|XP_006392998.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
 gb|ESQ30284.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
Length=444

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRAFS +   QL+KRIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFKQLQKRIEQVITRQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL+  KP  PPT+ND+ LHQ F+ V+GD+LG     + +PLM  +DF+FYQE MP
Sbjct  322  NATVDFLQEVKPFFPPTVNDKGLHQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQESMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G+++E A    AS HSPYF+VNE+  PYGA+L AS+A RY+L+
Sbjct  382  GHFSFVGMQNE-AHSPMASPHSPYFEVNEELLPYGASLHASMATRYLLD  429



>gb|KCW82520.1| hypothetical protein EUGRSUZ_C03922 [Eucalyptus grandis]
Length=539

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 131/171 (77%), Gaps = 3/171 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV    GGGAFNVIPDSVTIGGTFR FS +G++QL++RIEEVI+ QA+VQRC
Sbjct  349  DPLDSQVVTVAKIEGGGAFNVIPDSVTIGGTFRVFSMDGLIQLKQRIEEVIMRQASVQRC  408

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F  S KP  PPT N + LH+HF+ VA D+LG   +   +PLM  +DF+FY EV+P
Sbjct  409  NATVSF--SVKPFYPPTANHKALHEHFKNVARDMLGPDNILGMEPLMGSEDFSFYTEVIP  466

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            GY Y +G+KDE+     A  HSP++++NEDA  YGAAL A+LA RYILE Q
Sbjct  467  GYFYYVGMKDESLGKMEAG-HSPHYRLNEDALSYGAALHAALATRYILENQ  516



>ref|XP_004251653.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=446

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 132/185 (71%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E   QL++RI EVI  QAAVQRC
Sbjct  263  DPLDSQVVTVAKFKGGGAFNVIPDSVTIGGTFRAFSKESFAQLKQRIVEVITRQAAVQRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F    +P  P T+N++ LH+ F+ VAG +LG  ++   KP M  +DF+F+ E +P
Sbjct  323  NATVDFDTKNRPFYPVTVNNKALHEQFRNVAGQMLGIDKIIAMKPTMGTEDFSFFAEAIP  382

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---N  208
            G  Y LG+ DE    +  S HSP+++VNED  PYG AL ASLA  Y+LE QL+  T   N
Sbjct  383  GCFYLLGMVDE-TKGRFESGHSPFYRVNEDVLPYGVALHASLATTYLLEHQLKSTTRDQN  441

Query  207  KHDEL  193
             HDEL
Sbjct  442  VHDEL  446



>ref|XP_010911155.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=437

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP+DSQVVTV  F+GG AFNVIPDSVT+GGTFR+ S  G  QL++RIEEVIV QA+VQRC
Sbjct  254  DPMDSQVVTVAKFQGGTAFNVIPDSVTLGGTFRSLSNRGFSQLKQRIEEVIVAQASVQRC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NAT +F+  E P +P T+N +DLH+HFQKVAG++LGS+ V + +P+  GDDFAF+ E +P
Sbjct  314  NATTDFMNKEHPFLPATVNSKDLHEHFQKVAGEMLGSNNVIEKQPVTGGDDFAFFSEAVP  373

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK-  205
              Y Y LG+K+++      + HSPYF +NE+A  YGAAL ASLA RY+ E +    +N  
Sbjct  374  RAYYYFLGMKNDSGGPHHPA-HSPYFTINEEALSYGAALHASLAVRYLSENRSPSTSNAN  432

Query  204  -HDEL  193
             H EL
Sbjct  433  LHYEL  437



>ref|XP_004486799.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=443

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFR FS + + QLR RIE+VI GQAAV RC
Sbjct  260  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRVFSDKSLKQLRSRIEQVITGQAAVHRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE E    PPTIN+  LH +FQ +AG +LG  +VKD +P+M  +DFAFYQ+ +P
Sbjct  320  NATVSFLEEEMGLSPPTINNGGLHGYFQSIAGSVLGVDKVKDMQPVMGSEDFAFYQQALP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE--RQLEWVTNK  205
            GYI+ LG+++ +  ++    HSPYFK+NEDA PYGAAL A+LAARY++E  +++  V  K
Sbjct  380  GYIFLLGMENPSV-ERLHLPHSPYFKINEDALPYGAALHAALAARYLVEFHQEVSVVEGK  438

Query  204  -HDEL  193
             HDEL
Sbjct  439  YHDEL  443



>ref|XP_006853919.1| hypothetical protein AMTR_s00036p00189900 [Amborella trichopoda]
 gb|ERN15386.1| hypothetical protein AMTR_s00036p00189900 [Amborella trichopoda]
Length=445

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF+     QL++RI+EVIV QAAVQRC
Sbjct  257  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFANNTFYQLKQRIQEVIVSQAAVQRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A+VNF ES++P  PPT+N++DLH+ F  VA ++LG + +++ +PLM  +DF+FY E +P
Sbjct  317  SASVNFFESDRPFFPPTVNNKDLHELFSGVAIEMLGRTNLQEMQPLMGAEDFSFYGEKIP  376

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
             Y + +G+K+E +    AS HSP+F VNED  PYGAAL ASLA RY+
Sbjct  377  AYYFFVGMKNE-SQGPLASGHSPFFTVNEDVLPYGAALHASLAIRYL  422



>ref|XP_009396760.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAF++E   QL++RIEEVIV QA+VQRC
Sbjct  255  DPLDSQVVTVAKFQGGGAFNVIPDSVTIGGTFRAFTKESFYQLKQRIEEVIVAQASVQRC  314

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A+V+FL  ++P  P T+N +DLH HFQKVA  +LG S V D KP+M  +DFA + EV+P
Sbjct  315  SASVDFLNKDRPFFPVTVNSKDLHGHFQKVAAKMLGVSNVVDRKPVMGAEDFALFGEVIP  374

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ--LEWVTN  208
              Y Y +G+ +E       + HSPYF +NE A PYGAAL ASLA  Y+ E+   L     
Sbjct  375  AAYYYFVGMVNETQGPMYPA-HSPYFTINEAALPYGAALHASLAMSYLSEKHTPLSSTEK  433

Query  207  KHDEL  193
             HDEL
Sbjct  434  VHDEL  438



>gb|AFK46529.1| unknown [Lotus japonicus]
Length=447

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGA NVIPD V IGGTFR+FS E +  LR+R+E+VIVGQAAVQRC
Sbjct  262  DPLDSQVVTVAKFQGGGALNVIPDYVIIGGTFRSFSTESLEHLRQRVEQVIVGQAAVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVM  382
            NATVNFL+   PS PPTIND  LH+ F+ VA +LLG+++V  D  P+ A +DF+FYQ+V+
Sbjct  322  NATVNFLDEASPSYPPTINDGGLHEQFRDVAENLLGANKVHFDKPPVTASEDFSFYQKVI  381

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLE  220
            PGY + LG++  + D ++   HSPY  +NE+  PYGAAL ASLA  Y LE+ L+
Sbjct  382  PGYFFFLGMQKASNDHRAHFVHSPYLVINEEGLPYGAALHASLAVNY-LEKYLQ  434



>ref|XP_008797894.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGG FNVIP+SVTIGGTFRA S+E   QL++RIEEVIV QA+VQRC
Sbjct  255  DPLDSQVVTVAKFQGGGLFNVIPNSVTIGGTFRALSKESFSQLKQRIEEVIVAQASVQRC  314

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NAT +FL+ + P  P T+N +DLH+HFQKVA ++LGS+ V + +P+M G+DFAF+   +P
Sbjct  315  NATTDFLDRKHPFYPTTVNSKDLHEHFQKVAEEMLGSNSVIERQPVMGGEDFAFFAAAVP  374

Query  378  -GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK-  205
              Y Y +G+K+++   +    HSPYF +NE+A PYGAAL ASLA RY+ E +    +N  
Sbjct  375  RAYYYFVGIKNDSRGPQYPV-HSPYFAINEEALPYGAALHASLAVRYLSENRSSSPSNAN  433

Query  204  -HDEL  193
             HDEL
Sbjct  434  VHDEL  438



>ref|XP_002514178.1| metallopeptidase, putative [Ricinus communis]
 gb|EEF48132.1| metallopeptidase, putative [Ricinus communis]
Length=370

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 133/181 (73%), Gaps = 2/181 (1%)
 Frame = -2

Query  735  PLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCN  556
            PLDSQVVT+  F+GGGAFN+IPDSVTIGGTFRAFS++  +Q+++RIEEVI  QA+VQRCN
Sbjct  189  PLDSQVVTIAKFQGGGAFNIIPDSVTIGGTFRAFSKDSFIQIKQRIEEVITKQASVQRCN  248

Query  555  ATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMPG  376
            ATV F   EKP    T+N++DLH+ F  +A  +LG+  VK+ +PLM  +DF F+ E +PG
Sbjct  249  ATVRFNVDEKPLYTVTVNNKDLHKQFVNIAIAMLGAQNVKEMQPLMGAEDF-FFAEAVPG  307

Query  375  YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNKHDE  196
              + LG+KDE +     S HSPYF+VNE+  PYGA+L ASLA RY+LE Q E  T K + 
Sbjct  308  CFFFLGMKDE-SHGPPGSGHSPYFRVNEEVLPYGASLHASLAVRYLLEYQPESRTTKENL  366

Query  195  L  193
            L
Sbjct  367  L  367



>gb|KHN11323.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 135/186 (73%), Gaps = 4/186 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QV+T+   +GG AFNVIPD VTIGGTFRAFSRE +  L++RIE+VI+GQAAV RC
Sbjct  259  DPLDPQVLTIAKLQGGDAFNVIPDYVTIGGTFRAFSRETLEHLKQRIEQVIIGQAAVLRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRV-KDHKPLMAGDDFAFYQEVM  382
            NA+VNF E E P  PPTIN+ DLH+ F  VAG+LLG ++V  + +  MA +DFAFYQEV+
Sbjct  319  NASVNFFEEENPLYPPTINNGDLHKLFVDVAGNLLGINKVDTNMEQDMAAEDFAFYQEVI  378

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ---LEWVT  211
            PGY + LG+K+ ++ +  A  HSPY  +NED  PYGAAL ASLA  Y+ + Q    + V 
Sbjct  379  PGYYFTLGMKNASSFEPVAPLHSPYLVINEDGLPYGAALHASLATGYLTKYQRGIAKVVG  438

Query  210  NKHDEL  193
              HD+L
Sbjct  439  KYHDQL  444



>ref|XP_003530010.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=441

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QV+T+   +GG AFNVIPD VTIGGTFRAFSRE +  L++RIE+VI+GQAAVQRC
Sbjct  259  DPLDPQVLTIAKLQGGDAFNVIPDYVTIGGTFRAFSRERLEHLKQRIEQVIIGQAAVQRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRV-KDHKPLMAGDDFAFYQEVM  382
            NATVNFL+ E P  PPT+N+ DLH+ F  VAG+LLG ++V  + +  MA +DFAFYQE +
Sbjct  319  NATVNFLDEENPLYPPTVNNGDLHKFFVDVAGNLLGINKVDTNMEQDMAAEDFAFYQEFI  378

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK-  205
            PGY + LG+ + A+ +  A  HSPY  +NED  PYGAAL ASLA  Y+ ++ +  V  K 
Sbjct  379  PGYYFTLGM-EIASSEPVAPLHSPYLVINEDGLPYGAALHASLATGYLYQQDVAKVVGKY  437

Query  204  HDEL  193
            HD+L
Sbjct  438  HDQL  441



>emb|CBI27959.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QL++RIEEVI  Q++VQRC
Sbjct  211  DPLDSQVVTVAKFKGGGAFNVIPDSVTIGGTFRAFSKESFLQLKQRIEEVITLQSSVQRC  270

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+F     P  P T N++DLH+HFQ VAGD+LG+  +K+   +M  +DF+F+ E +P
Sbjct  271  NATVHF---NDPFYPVTANNKDLHKHFQNVAGDMLGTQNIKEMPLVMGAEDFSFFAEAIP  327

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYIL  235
            GY Y LG+K+E         H+PY+ VNEDA PYGAAL ASLA  ++ 
Sbjct  328  GYFYYLGMKNETRGQLELG-HTPYYTVNEDALPYGAALHASLATSFVF  374



>gb|KJB54328.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=335

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++G F+GGGAFNVIPDSVTIGGTFR FS+E  VQL++RIEEVI  QA+VQRC
Sbjct  153  DPLDSQVVSIGKFQGGGAFNVIPDSVTIGGTFRTFSKESFVQLKQRIEEVITKQASVQRC  212

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V F   E  S P   N+++LH+HF+KVAG++LG   V +    M G+DFAF+ EV+P
Sbjct  213  NAKVIF--HENSSYPVCFNNKELHEHFRKVAGEMLGVQNVVEAMANMGGEDFAFFSEVIP  270

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            G  + LG+K+E       S HSPY+ VNED FPYGAAL ASLA  Y+ E   +  +    
Sbjct  271  GLFFFLGMKNE-TQGPLQSGHSPYYTVNEDVFPYGAALHASLATTYLSENPPKHTSPPEG  329

Query  210  NKHDEL  193
            + HDEL
Sbjct  330  SFHDEL  335



>ref|XP_003531635.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN11320.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=443

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL+ QVVTV  F+GG AFNVIPD VTIGGTFRAFS E +  L++RIE+VI+GQAAVQRC
Sbjct  260  DPLEPQVVTVSKFQGGAAFNVIPDYVTIGGTFRAFSGETLQHLKQRIEQVIIGQAAVQRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRV-KDHKPLMAGDDFAFYQEVM  382
            NA+VNF + EKP  PPT+N  +LH+ F  VAG+L+G + V  D  P M  +DFAFYQEV+
Sbjct  320  NASVNFFDEEKPLYPPTVNHGELHKLFLDVAGNLIGINNVIIDESPSMGSEDFAFYQEVI  379

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            PGY + LG+K  ++ + + S HSPY K+NE+  PYGA+L ASLAA Y+++ Q
Sbjct  380  PGYYFMLGVK--SSPEPNQSLHSPYLKINENGLPYGASLHASLAANYLIKYQ  429



>gb|KHG25042.1| IAA-amino acid hydrolase ILR1-like 4 [Gossypium arboreum]
Length=437

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 132/176 (75%), Gaps = 4/176 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR+RIEEVI  QA+VQRC
Sbjct  256  DPLDSQVVSIAKFQGGGAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVISKQASVQRC  315

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   E+   P   N+++LH+HF+KVAG++LG   + + +P M G+DFAF+ E +P
Sbjct  316  NATVIF--DERSMYPVNSNNKELHEHFRKVAGEILGFENIIEMQPQMGGEDFAFFSESIP  373

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT  211
            G  + LG+K+   +    S HSPYF+VNED FPYGAAL ASLA  Y+L+   ++ +
Sbjct  374  GLFFFLGMKE--TEGAVHSGHSPYFRVNEDVFPYGAALHASLAITYLLQNPTKYTS  427



>ref|NP_001242296.1| uncharacterized protein LOC100789607 precursor [Glycine max]
 gb|ACU21355.1| unknown [Glycine max]
Length=431

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD +VVTV   +GG AFNVIPD  TIGGT R F+ + M QL+ RI++VI+GQAAVQRC
Sbjct  259  DPLDPRVVTVSKIQGGDAFNVIPDYATIGGTHRGFTNKSMDQLKLRIKQVIIGQAAVQRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVM  382
            NATVNF E+  P+ PPT+N+ DLH+HFQ VA ++LG + V  +  P M  +DFAFYQEV+
Sbjct  319  NATVNFFENVGPANPPTVNNGDLHKHFQNVAENVLGVNNVNLNMPPFMVAEDFAFYQEVI  378

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            PGY + LG+K  + ++   S HSPY ++NED  PYGAAL ASLA  Y+++ Q
Sbjct  379  PGYFFTLGMKYASPNEPFQSLHSPYLRINEDGLPYGAALHASLATSYLIKLQ  430



>ref|XP_006585543.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Glycine 
max]
 gb|KHN11322.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=204

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -2

Query  735  PLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCN  556
            PLD QV+TV   +GG AF+VIPD V IGGTFRA SRE +  L++RIE+VI+GQAAV RCN
Sbjct  20   PLDPQVLTVAKLQGGAAFDVIPDYVIIGGTFRALSREALKHLKQRIEQVIIGQAAVLRCN  79

Query  555  ATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVMP  379
            A+VNFL+ EKP  PPTI + DLH+ F  VAG+L+G   V  D +  MA +DFAFYQE +P
Sbjct  80   ASVNFLDEEKPLYPPTIKNDDLHKVFVDVAGNLIGIYNVNIDMQTDMAAEDFAFYQEAIP  139

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            GY + LG+K+ ++ +  A  HSPY  +NED  PYGAAL ASLA  Y+
Sbjct  140  GYYFTLGMKNASSIETVAPLHSPYLVINEDGLPYGAALHASLATDYL  186



>gb|ACF84306.1| unknown [Zea mays]
 tpg|DAA58584.1| TPA: hypothetical protein ZEAMMB73_870331 [Zea mays]
Length=397

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  211  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  270

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL  ++P  PPTIN  +LH  F  VAG+++GS  V+D +PLM  +DFAFY E +P
Sbjct  271  SAAVDFLSKDRPFFPPTINSPELHDFFVNVAGEMVGSRNVRDRQPLMGAEDFAFYAEAVP  330

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--  208
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA QA+LAARY+LERQ        
Sbjct  331  STYYYFVGMYNETRGPQ-APHHSPYFTINEDALPYGAAGQAALAARYLLERQQPAAATAD  389

Query  207  ---KHDEL  193
                HDEL
Sbjct  390  KAETHDEL  397



>gb|KJB65086.1| hypothetical protein B456_010G080300 [Gossypium raimondii]
Length=488

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++  F+GGGAFNVIPDSVTIGGTFRAFS+E  +QLR+RIEEVI  QA+VQRC
Sbjct  307  DPLDSQVVSIAKFQGGGAFNVIPDSVTIGGTFRAFSKESFLQLRQRIEEVISKQASVQRC  366

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV F   E+   P   N+++LH+HF+KVAG++LG   + + +P M G+DFAF+ E +P
Sbjct  367  NATVIF--DERSMYPVNSNNKELHEHFRKVAGEILGFENIIEMQPQMGGEDFAFFSESIP  424

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G  + LG+K+   +    S HSPYF+VNED FPYGAAL ASLA  Y+L+
Sbjct  425  GLFFFLGMKE--TEGAVHSGHSPYFRVNEDVFPYGAALHASLATTYLLQ  471



>ref|NP_001142151.1| hypothetical protein precursor [Zea mays]
 gb|ACF78304.1| unknown [Zea mays]
 gb|ACF87764.1| unknown [Zea mays]
 gb|ACF87830.1| unknown [Zea mays]
 gb|ACN26345.1| unknown [Zea mays]
 tpg|DAA58585.1| TPA: hypothetical protein ZEAMMB73_870331 [Zea mays]
Length=450

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTVG F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  264  DPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+FL  ++P  PPTIN  +LH  F  VAG+++GS  V+D +PLM  +DFAFY E +P
Sbjct  324  SAAVDFLSKDRPFFPPTINSPELHDFFVNVAGEMVGSRNVRDRQPLMGAEDFAFYAEAVP  383

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN--  208
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA QA+LAARY+LERQ        
Sbjct  384  STYYYFVGMYNETRGPQ-APHHSPYFTINEDALPYGAAGQAALAARYLLERQQPAAATAD  442

Query  207  ---KHDEL  193
                HDEL
Sbjct  443  KAETHDEL  450



>gb|KEH18273.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=327

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 5/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+   +GG AFNVIPD VTIGGTFRAFS+E   QLR+RIEEVI+GQAAV RC
Sbjct  141  DPLDSQVVTIAKIQGGSAFNVIPDHVTIGGTFRAFSKESFNQLRQRIEEVIIGQAAVHRC  200

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
            NATV+FL   KP  PPT+N+ DLH+HF  VA ++LG  +V     P M  +DF+FYQEV+
Sbjct  201  NATVDFLHGVKPFYPPTVNNADLHEHFVNVAVNMLGIDKVDSVMTPYMGSEDFSFYQEVI  260

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---  211
            PGY + LG+K+ +     +  HSPY ++NED  PYGAAL ASLAA Y+L+ Q + V    
Sbjct  261  PGYFFMLGVKNASHKRFESLLHSPYLEINEDGLPYGAALHASLAASYLLKHQRDTVPGVE  320

Query  210  -NKHDEL  193
               HDEL
Sbjct  321  RKYHDEL  327



>ref|NP_001242429.1| uncharacterized protein LOC100790664 precursor [Glycine max]
 gb|ACU20016.1| unknown [Glycine max]
Length=444

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 134/186 (72%), Gaps = 4/186 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QV+T+   +GG AFNVIPD VTIGGTFRAFSRE +  L++RIE+VI+GQAAV R 
Sbjct  259  DPLDPQVLTIAKLQGGDAFNVIPDYVTIGGTFRAFSRETLEHLKQRIEQVIIGQAAVLRY  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRV-KDHKPLMAGDDFAFYQEVM  382
            NA+VNF E E P  PPTIN+ DLH+ F  VAG+LLG ++V  + +  MA +DFAFYQEV+
Sbjct  319  NASVNFFEEENPLYPPTINNGDLHKLFVDVAGNLLGINKVDTNMEQDMAAEDFAFYQEVI  378

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ---LEWVT  211
            PGY + LG+K+ ++ +  A  HSPY  +NED  PYGAAL ASLA  Y+ + Q    + V 
Sbjct  379  PGYYFTLGMKNASSFEPVAPLHSPYLVINEDGLPYGAALHASLATGYLTKYQRGIAKVVG  438

Query  210  NKHDEL  193
              HD+L
Sbjct  439  KYHDQL  444



>gb|KJB54330.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=445

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++G F+GGGAFNVIPDSVTIGGTFR FS+E  VQL++RIEEVI  QA+VQRC
Sbjct  263  DPLDSQVVSIGKFQGGGAFNVIPDSVTIGGTFRTFSKESFVQLKQRIEEVITKQASVQRC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V F   E  S P   N+++LH+HF+KVAG++LG   V +    M G+DFAF+ EV+P
Sbjct  323  NAKVIF--HENSSYPVCFNNKELHEHFRKVAGEMLGVQNVVEAMANMGGEDFAFFSEVIP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            G  + LG+K+E       S HSPY+ VNED FPYGAAL ASLA  Y+ E   +  +    
Sbjct  381  GLFFFLGMKNE-TQGPLQSGHSPYYTVNEDVFPYGAALHASLATTYLSENPPKHTSPPEG  439

Query  210  NKHDEL  193
            + HDEL
Sbjct  440  SFHDEL  445



>gb|KJB54329.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=443

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++G F+GGGAFNVIPDSVTIGGTFR FS+E  VQL++RIEEVI  QA+VQRC
Sbjct  261  DPLDSQVVSIGKFQGGGAFNVIPDSVTIGGTFRTFSKESFVQLKQRIEEVITKQASVQRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V F   E  S P   N+++LH+HF+KVAG++LG   V +    M G+DFAF+ EV+P
Sbjct  321  NAKVIF--HENSSYPVCFNNKELHEHFRKVAGEMLGVQNVVEAMANMGGEDFAFFSEVIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            G  + LG+K+E       S HSPY+ VNED FPYGAAL ASLA  Y+ E   +  +    
Sbjct  379  GLFFFLGMKNE-TQGPLQSGHSPYYTVNEDVFPYGAALHASLATTYLSENPPKHTSPPEG  437

Query  210  NKHDEL  193
            + HDEL
Sbjct  438  SFHDEL  443



>gb|KJB54327.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=444

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV++G F+GGGAFNVIPDSVTIGGTFR FS+E  VQL++RIEEVI  QA+VQRC
Sbjct  262  DPLDSQVVSIGKFQGGGAFNVIPDSVTIGGTFRTFSKESFVQLKQRIEEVITKQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V F   E  S P   N+++LH+HF+KVAG++LG   V +    M G+DFAF+ EV+P
Sbjct  322  NAKVIF--HENSSYPVCFNNKELHEHFRKVAGEMLGVQNVVEAMANMGGEDFAFFSEVIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT----  211
            G  + LG+K+E       S HSPY+ VNED FPYGAAL ASLA  Y+ E   +  +    
Sbjct  380  GLFFFLGMKNE-TQGPLQSGHSPYYTVNEDVFPYGAALHASLATTYLSENPPKHTSPPEG  438

Query  210  NKHDEL  193
            + HDEL
Sbjct  439  SFHDEL  444



>gb|AFK45080.1| unknown [Lotus japonicus]
Length=229

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 130/187 (70%), Gaps = 9/187 (5%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPD VTIGGTFRAFS E    L++RIE+VI+GQAAVQRC
Sbjct  47   DPLDSQVVTVAKFQGGGAFNVIPDYVTIGGTFRAFSTESFGYLKQRIEQVIIGQAAVQRC  106

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVM  382
            NATVNF     P  PPTIND  LH+ F+ VA +LLG  +   D  P+ A +DF+FYQ+VM
Sbjct  107  NATVNFFGEVYPPYPPTINDGGLHEQFRYVAINLLGIDKAHIDMPPMTAAEDFSFYQKVM  166

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI----LERQLEWV  214
            PGY + LG++    D +    HSPY  ++E+ FPYGAAL  SLA  Y+     +R +E  
Sbjct  167  PGYFFFLGMQK---DHRDHFLHSPYLMIDEEGFPYGAALHVSLAINYLQKYHQDRPMEEG  223

Query  213  TNKHDEL  193
             N+ DEL
Sbjct  224  KNR-DEL  229



>ref|XP_007135596.1| hypothetical protein PHAVU_010G142700g [Phaseolus vulgaris]
 gb|ESW07590.1| hypothetical protein PHAVU_010G142700g [Phaseolus vulgaris]
Length=430

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP++ QV+TV  F+GGGAFNVIPD VTIGGTFRAFS+E + QL +RIE+V +GQAAVQRC
Sbjct  258  DPVEPQVLTVTIFQGGGAFNVIPDKVTIGGTFRAFSKERLEQLAQRIEQVAIGQAAVQRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVM  382
            NATV F +      PP +N+ DLH+ F  VAG+LLG ++V  D +P+MA +DFAFYQEV+
Sbjct  318  NATVWFGDETNGFYPPVVNNGDLHKFFVDVAGNLLGINKVNTDVRPIMASEDFAFYQEVI  377

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYIL  235
            PGY  GLG+K  A+ +     HSPY  +NEDA PYGAALQASLA  Y++
Sbjct  378  PGYFTGLGVKS-ASPEPVHELHSPYLTINEDALPYGAALQASLATTYLI  425



>emb|CAA73905.1| JR3 protein [Arabidopsis thaliana]
Length=444

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 136/188 (72%), Gaps = 7/188 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRA---FSREGMVQLRKRIEEVIVGQAAV  568
            DPLDSQVVTV  F GGGAFNVIPDSVTIGGTFRA   FS +  +QL+KRIE+VI  QA+V
Sbjct  258  DPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTFSTKSFMQLKKRIEQVITRQASV  317

Query  567  QRCNATVNFL-ESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQ  391
              CNATV+F+   E    PPT+ND+ LHQ F+ V+GD+LG     + +PLM  +DF+FYQ
Sbjct  318  NMCNATVDFIARGETFFXPPTVNDKALHQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQ  377

Query  390  EVMPGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWV-  214
            + +PG+   +G++++ A    AS HSPYF+VNE+  PYGA+L AS+A RY+LE +   + 
Sbjct  378  QAIPGHFSFVGMQNK-ARSPMASPHSPYFEVNEELLPYGASLHASMATRYLLELKASTLN  436

Query  213  -TNKHDEL  193
             +NK DEL
Sbjct  437  KSNKKDEL  444



>ref|XP_004968975.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Setaria 
italica]
Length=445

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 135/187 (72%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+G F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIEEVIV QA+VQRC
Sbjct  260  DPLDSQVVTIGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATV+FL  ++P  PPTIN  +LH  F  VA +++GS  V+D +PLM  +DFAFY E +P
Sbjct  320  TATVDFLTKDRPFFPPTINSPELHDFFVNVASEMVGSKNVRDRQPLMGAEDFAFYAEAIP  379

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---  211
              Y Y +G+ +E    + A  HSPYF +NEDA PYGAA QA++AARY+ E Q    T   
Sbjct  380  STYYYFVGMYNETRGPQ-APHHSPYFTINEDALPYGAAAQAAMAARYLHEHQQPASTLDK  438

Query  210  -NKHDEL  193
               HDEL
Sbjct  439  AKTHDEL  445



>gb|EPS67015.1| hypothetical protein M569_07761, partial [Genlisea aurea]
Length=418

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV+TV  F GG AFNVIPDSVTI GTFRAFS E M+Q+R+RIE+++ GQA+V RC
Sbjct  253  DPLDSQVITVSVFEGGAAFNVIPDSVTIKGTFRAFSMESMLQIRRRIEQIVRGQASVHRC  312

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA++ F   +KP  PP  ND  LH+ F  VA +++G+ RV++  PLM  +DF+FY+E MP
Sbjct  313  NASLVFETEDKPLFPPLANDGALHEFFVGVAEEVVGAGRVREMPPLMGAEDFSFYREKMP  372

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            GY + LG+KDE   D  A  HSP+F++NE   P+GAAL ASLA +Y+
Sbjct  373  GYFFFLGMKDETV-DPPAPAHSPFFRINESGLPFGAALHASLAVKYL  418



>gb|ABF55222.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|KEH18272.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 5/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+   +GG AFNVIPD VTIGGTFRAFS+E   QLR+RIEEVI+GQAAV RC
Sbjct  261  DPLDSQVVTIAKIQGGSAFNVIPDHVTIGGTFRAFSKESFNQLRQRIEEVIIGQAAVHRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
            NATV+FL   KP  PPT+N+ DLH+HF  VA ++LG  +V     P M  +DF+FYQEV+
Sbjct  321  NATVDFLHGVKPFYPPTVNNADLHEHFVNVAVNMLGIDKVDSVMTPYMGSEDFSFYQEVI  380

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---  211
            PGY + LG+K+ +     +  HSPY ++NED  PYGAAL ASLAA Y+L+ Q + V    
Sbjct  381  PGYFFMLGVKNASHKRFESLLHSPYLEINEDGLPYGAALHASLAASYLLKHQRDTVPGVE  440

Query  210  -NKHDEL  193
               HDEL
Sbjct  441  RKYHDEL  447



>ref|XP_004969012.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Setaria 
italica]
Length=447

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 137/187 (73%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVT+G F+GGGAFNVIPDSVTIGGTFRAF +E   QL++RIE+VIV QA+VQRC
Sbjct  262  DPLDSQVVTIGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEQVIVSQASVQRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FL +  P  PPTIN  +LH  F  +AG+++GS  V+D +PLM  +DFAFY EV+P
Sbjct  322  NATVDFLTNRIPFFPPTINSPELHSFFVNMAGEMVGSKNVRDRQPLMGAEDFAFYAEVIP  381

Query  378  G-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT---  211
              Y Y +G+ ++    + AS HS YF VNEDA PYGAA QA+LAA Y+LE +    T   
Sbjct  382  STYYYFVGMYNKTRGPQ-ASHHSTYFTVNEDALPYGAAAQAALAAHYLLEHEQPAATPDK  440

Query  210  -NKHDEL  193
               H+EL
Sbjct  441  AKAHEEL  447



>ref|XP_008797895.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X2 [Phoenix 
dactylifera]
Length=421

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = -2

Query  720  VVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCNATVNF  541
            VVTV  F+GGG FNVIP+SVTIGGTFRA S+E   QL++RIEEVIV QA+VQRCNAT +F
Sbjct  244  VVTVAKFQGGGLFNVIPNSVTIGGTFRALSKESFSQLKQRIEEVIVAQASVQRCNATTDF  303

Query  540  LESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP-GYIYG  364
            L+ + P  P T+N +DLH+HFQKVA ++LGS+ V + +P+M G+DFAF+   +P  Y Y 
Sbjct  304  LDRKHPFYPTTVNSKDLHEHFQKVAEEMLGSNSVIERQPVMGGEDFAFFAAAVPRAYYYF  363

Query  363  LGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--HDEL  193
            +G+K+++   +    HSPYF +NE+A PYGAAL ASLA RY+ E +    +N   HDEL
Sbjct  364  VGIKNDSRGPQYPV-HSPYFAINEEALPYGAALHASLAVRYLSENRSSSPSNANVHDEL  421



>ref|XP_006305862.1| hypothetical protein CARUB_v10010946mg [Capsella rubella]
 gb|EOA38760.1| hypothetical protein CARUB_v10010946mg [Capsella rubella]
Length=439

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPDSVTIGGTFRA S  G+ QL+ RIE+VI  QA+V  C
Sbjct  258  DPLDSQVVTVAKFEGSDAFNVIPDSVTIGGTFRALSPRGLEQLKIRIEQVITTQASVSMC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE   P  PPT+ND+DLH  ++ ++ D+LG+    +  P+M  +DF+FYQE MP
Sbjct  318  NATVDFLEDVNPPFPPTVNDKDLHLFYESISVDMLGTENYFETLPVMVSEDFSFYQEAMP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   LG++D+      A+ HSP+F+VNE++ PYGA+L ASLA R++LE
Sbjct  378  GHFSFLGMQDK-THSPMANPHSPFFEVNEESLPYGASLLASLATRHLLE  425



>ref|XP_002891662.1| hypothetical protein ARALYDRAFT_892161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67921.1| hypothetical protein ARALYDRAFT_892161 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 123/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPDSVTIGGTFRA S +   QL++RIE+VI  QA+V  C
Sbjct  258  DPLDSQVVTVAKFEGSDAFNVIPDSVTIGGTFRALSPKSFEQLKQRIEQVITTQASVNMC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE E P  PPT+ND+ LH  ++ V+ D+LG     +  P+M  +DFAFYQE MP
Sbjct  318  NATVDFLEDETPPFPPTVNDKALHLFYENVSVDMLGIENYAETLPVMVSEDFAFYQEAMP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G++++ +    A+ HSPYF+VNE+  PYGA+L ASLA RY+LE
Sbjct  378  GHFSFVGMQNK-SHSPMANPHSPYFEVNEELLPYGASLLASLATRYLLE  425



>ref|XP_010451360.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Camelina sativa]
Length=444

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 131/183 (72%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++RI+EVI  QA V RC
Sbjct  266  DPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATVHRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+ND DL++ F+KV GDLLG   V++ +PLM  +DF+ + EV+P
Sbjct  324  NASVNLTPNGKEPLPPTVNDMDLYKQFKKVVGDLLGQEAVEEAQPLMGSEDFSKFAEVIP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE+     AS HSP +++NED FPYGAA+ AS+A +Y+ E+  +   +  H
Sbjct  384  GHFSFLGMQDESKG--YASSHSPLYRINEDVFPYGAAIHASMAMQYLKEKASKGSASGFH  441

Query  201  DEL  193
            DEL
Sbjct  442  DEL  444



>ref|XP_010483143.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Camelina sativa]
Length=442

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++RI+EVI  QA V RC
Sbjct  264  DPLDSKVVTVSKVHGGNAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATVHRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+ND DL++ F+KV GDLLG   V++ +PLM  +DF+ + EV+P
Sbjct  322  NASVNLTPNGKEPLPPTVNDMDLYKQFKKVVGDLLGQEAVEEAQPLMGSEDFSKFAEVIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE      AS HSP +++NED  PYGAA+ AS+A +Y+ E+  +   T  H
Sbjct  382  GHFSFLGMQDETKG--YASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSATGFH  439

Query  201  DEL  193
            DEL
Sbjct  440  DEL  442



>ref|XP_010462020.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=456

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPD VTIGGTFRA S     Q+++RIE+VI  QA+V +C
Sbjct  275  DPLDSQVVTVAKFEGSDAFNVIPDFVTIGGTFRALSPTSFAQIKQRIEQVITTQASVSKC  334

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE   P  PPT+ND+DLH  ++ +A D+LG+    + +P+M  +DFAFYQE +P
Sbjct  335  NATVDFLEDVFPPFPPTVNDKDLHPFYKSIAVDMLGAENFVETQPVMVSEDFAFYQEAIP  394

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G++++       + HSPYF+VNE+  PYGA+L ASLA RY+LE
Sbjct  395  GHFSFVGMQNK-NHPPMPNPHSPYFEVNEEILPYGASLLASLATRYLLE  442



>ref|XP_010479683.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=440

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 123/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPD VTIGGTFRA S +   Q+++RIE+VI  QA+V +C
Sbjct  259  DPLDSQVVTVAKFEGSDAFNVIPDFVTIGGTFRALSPKSFAQIKQRIEQVITTQASVSKC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE   P  PPT+N++DLH  ++ +A D+LG+    + +P+M  +DFAFYQE +P
Sbjct  319  NATVDFLEDVFPPFPPTVNNKDLHPFYKSIAVDMLGAESFIETQPVMVSEDFAFYQEAIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G++++       + HSPYF+VNE+  PYGA+L ASLA RY+LE
Sbjct  379  GHFSFVGMQNK-NHPPMPNPHSPYFEVNEEILPYGASLLASLATRYLLE  426



>gb|KFK28293.1| hypothetical protein AALP_AA8G497500 [Arabis alpina]
Length=443

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPD VTI GTFRA S +   QL++RIE+VI  QA+V  C
Sbjct  262  DPLDSQVVTVAKFEGSDAFNVIPDYVTIAGTFRALSPQSFKQLKERIEQVITSQASVHMC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE   P  PPT ND  LH+ ++ V  D++G+    +  P+M  +DFAFY+E MP
Sbjct  322  NATVDFLEENYPPFPPTENDEALHEFYKNVVVDMVGTENYLETLPVMVSEDFAFYKEEMP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE-RQLEWVTNKH  202
            G+   +G++DE +    AS HSPYF+VNE++ PYGA+L AS+A RY+LE   L   ++++
Sbjct  382  GHFSFVGMQDE-SHLPMASPHSPYFEVNEESLPYGASLLASMATRYLLESSSLPNKSSEN  440

Query  201  DEL  193
            DEL
Sbjct  441  DEL  443



>gb|ABR17898.1| unknown [Picea sitchensis]
Length=487

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVVTV    GG AFNVIPDSVTI GTFRAFS E   +L++RIEE+IVGQ+ VQRC
Sbjct  303  NPLDSQVVTVTTSSGGDAFNVIPDSVTISGTFRAFSNESFYRLKQRIEEIIVGQSLVQRC  362

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATV FLE E P IPPT+N++ +H H  KVA DL+GS  +K   PLMAG+DFAFY EV+P
Sbjct  363  AATVEFLEKEYPFIPPTVNNQIMHDHVCKVAADLVGSHNLKIATPLMAGEDFAFYTEVIP  422

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               +  G+K+E      A  H+  F V+E+  P GAA+ A++A RY+ E
Sbjct  423  ADFFLFGMKNETCGSIHAP-HTSLFTVDENVLPLGAAMHAAIAERYLNE  470



>gb|ABK24715.1| unknown [Picea sitchensis]
Length=476

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GGGA NVIPDSVTIGGTFRAFS E   +LR+RIEEVI+GQAAV RC
Sbjct  301  NPLDSQVVSVAAFNGGGALNVIPDSVTIGGTFRAFSNESFYRLRQRIEEVILGQAAVHRC  360

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+F E E    PPT ND+D+H+H  +VA D++G    K   P+M  +DF FY EV P
Sbjct  361  TAVVDFFEKEDQFYPPTFNDKDMHKHVHRVAADVVGVHNFKIVPPMMGAEDFVFYTEVTP  420

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQL  223
               + +G+++EA    + S HSPYF ++E+  P GAA+ A++A R++ E + 
Sbjct  421  AAFFYIGMRNEAI-GSTRSGHSPYFMIDENVLPTGAAMHAAIAERFLNEHKF  471



>ref|XP_010443315.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Camelina sativa]
Length=444

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP DS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++RI+EVI  QA V  C
Sbjct  266  DPWDSKVVTVSKVHGGNAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATVHLC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN + + K  +PPT+ND DL++ F+KV GDLLG   V++ +PLM  +DF+ + EV+P
Sbjct  324  NASVNLIPNGKEPLPPTVNDMDLYKQFKKVVGDLLGQEAVQEAQPLMGSEDFSKFAEVIP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE      AS HSP +++NED  PYGAA+ AS+A +Y+ E+  +  VT  H
Sbjct  384  GHFSFLGMQDETKG--YASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSVTGFH  441

Query  201  DEL  193
            DEL
Sbjct  442  DEL  444



>ref|XP_010500765.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=456

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPD VTIGGTFRA S     Q+++RIE+VI  QA+V  C
Sbjct  275  DPLDSQVVTVAKFEGSDAFNVIPDFVTIGGTFRALSPTSFAQIKQRIEQVITTQASVSMC  334

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE   P  PPT+N++DLH  ++ +A D+LG+      +P+M  +DFAFYQE +P
Sbjct  335  NATVDFLEDVFPPFPPTVNNKDLHPFYKSIAVDMLGAENFVATQPVMVSEDFAFYQEAIP  394

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G++++       + HSPYF+VNE+  PYGA+L ASLA RY+LE
Sbjct  395  GHFSFVGMQNK-NHPAMPNPHSPYFEVNEEVLPYGASLLASLATRYLLE  442



>emb|CDM83724.1| unnamed protein product [Triticum aestivum]
Length=433

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 130/184 (71%), Gaps = 5/184 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  FRGGGAFNVIPDSVTIGGTFR FS +G ++L++RIEEVIV Q+AV RC
Sbjct  253  DPLDSQVVTVTRFRGGGAFNVIPDSVTIGGTFRCFSNDGFMRLKQRIEEVIVAQSAVHRC  312

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
             A V+F    +P + PTIN   LH HF+ VA D+LG+  V+   +P M  +DFA + E +
Sbjct  313  AAAVDFHAGGRPLLAPTINSPALHAHFEAVATDMLGAGGVRGAMEPCMGSEDFAAFSEAV  372

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK  205
            PG + Y +G+++EAA       HSP+F V+E A PYGAA+ ASLA  Y L+RQ   V + 
Sbjct  373  PGSHFYFIGIRNEAAGSVH-DAHSPHFLVDEGALPYGAAMHASLAMAY-LQRQHGRV-DS  429

Query  204  HDEL  193
            H+EL
Sbjct  430  HEEL  433



>ref|XP_006401299.1| hypothetical protein EUTSA_v10013558mg [Eutrema salsugineum]
 gb|ESQ42752.1| hypothetical protein EUTSA_v10013558mg [Eutrema salsugineum]
Length=442

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 127/185 (69%), Gaps = 7/185 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG A+NVIPDSVTIGGT RAF+  G  QL++RI+EVI  QAAV +C
Sbjct  262  DPLDSKVVTVSKVHGGNAYNVIPDSVTIGGTLRAFT--GFSQLQQRIKEVITKQAAVNQC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+ND+DL++ F+ +  DLLG     +  P+M G+DF+++ E +P
Sbjct  320  NASVNLTPNSKEPVPPTVNDKDLYKQFKNMVRDLLGEESFVEASPIMGGEDFSYFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---VTN  208
            G+   LG++DE      AS HSP ++VNEDA PYGAA+ A++A +Y+  + L+       
Sbjct  380  GHFSFLGMQDET--KSYASAHSPLYRVNEDALPYGAAIHATMAVQYLKNKALKGSDSANG  437

Query  207  KHDEL  193
             HDEL
Sbjct  438  SHDEL  442



>ref|XP_006281445.1| hypothetical protein CARUB_v10027523mg [Capsella rubella]
 gb|EOA14343.1| hypothetical protein CARUB_v10027523mg [Capsella rubella]
Length=441

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 128/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++RI+EVI  QA V RC
Sbjct  263  DPLDSKVVTVSKVLGGNAFNVIPDSITIGGTLRAFT--GFSQLQQRIKEVITKQATVHRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN     K  +PPT+ND DL++ ++KV  DLLG   V++ +PLM  +DF+ + EV+P
Sbjct  321  NASVNLTPDGKEPLPPTVNDIDLYKQYKKVVRDLLGQEAVEEAQPLMGSEDFSKFAEVIP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE      AS HSP ++VNED  PYGAA+ AS+A +Y+ E+  +  ++  H
Sbjct  381  GHFSFLGMQDETKG--YASSHSPLYRVNEDVLPYGAAIHASMAVQYLKEKASKGSISGFH  438

Query  201  DEL  193
            DEL
Sbjct  439  DEL  441



>ref|XP_010500767.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=444

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPD VTIGGTFRA S     Q++KRIE+VI  QA+V  C
Sbjct  263  DPLDSQVVTVAKFEGSDAFNVIPDFVTIGGTFRALSPTSFAQIKKRIEQVITTQASVSMC  322

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE   P  PPT+N++DLH  ++ ++ D++G+    + +P+M  +DFAFYQ+ + 
Sbjct  323  NATVDFLEDVSPPFPPTVNNKDLHLFYKNISVDMVGAENYIEIQPVMVSEDFAFYQQALR  382

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G++++       + HSPYF+VNE+  PYGA+L ASLA RY+LE
Sbjct  383  GHFSAVGMQNK-NHPPMPNPHSPYFEVNEEVLPYGASLLASLATRYLLE  430



>ref|NP_175589.1| IAA-amino acid hydrolase ILR1-like 5 [Arabidopsis thaliana]
 sp|Q9SWX9.1|ILL5_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50869.1|AC025294_7 auxin conjugate hydrolase (ILL5) [Arabidopsis thaliana]
 gb|AAD48152.1| auxin conjugate hydrolase [Arabidopsis thaliana]
 gb|AEE32715.1| IAA-amino acid hydrolase ILR1-like 5 [Arabidopsis thaliana]
Length=435

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F G  AFNVIPDSVTIGGTFRA   +   QL++RI +VI  QA+V  C
Sbjct  258  DPLDSQVVTVATFEGSDAFNVIPDSVTIGGTFRALLPKSFEQLKQRIVQVITTQASVNMC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATV+FLE E P  PPT+N++ LH  ++ V+ D+LG     +  P+M  +DFAFYQ+ +P
Sbjct  318  NATVDFLEDETPPFPPTVNNKTLHLFYKNVSVDMLGIENYVETLPVMVSEDFAFYQQAIP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G+   +G++++ +    A+ HSP+F+VNE+  PYGA+L ASLA RY+L+
Sbjct  378  GHFSFVGMQNK-SHSPMANPHSPFFEVNEELLPYGASLLASLATRYLLD  425



>gb|ABC68429.1| putative auxin conjugate hydrolase [Tragopogon pratensis]
Length=128

 Score =   179 bits (454),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = -2

Query  696  GGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCNATVNFLESEKPSI  517
            GGGAFNVIPDSV IGGTFRAFS+E  +QL++RIEEVI+GQA VQRCNATV F   +KP  
Sbjct  1    GGGAFNVIPDSVIIGGTFRAFSKESFMQLKQRIEEVIIGQATVQRCNATVEFSSKDKPFF  60

Query  516  PPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMPGYIYGLGLKDEAAD  337
            P TIND++LH+HFQ+VA ++LG+S VK+  PLM  +DF+ YQEV+PGY Y LG+K E  D
Sbjct  61   PATINDKELHKHFQEVAREVLGASNVKNMLPLMGSEDFSVYQEVIPGYFYFLGMKGE-LD  119

Query  336  DKSASEHSP  310
             K AS HSP
Sbjct  120  KKPASVHSP  128



>pdb|1XMB|A Chain A, X-ray Structure Of Iaa-aminoacid Hydrolase From Arabidopsis 
Thaliana Gene At5g56660
 pdb|2Q43|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Iaa-Aminoacid Hydrolase From Arabidopsis Thaliana Gene At5g56660
Length=418

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++R++EVI  QAAV RC
Sbjct  240  DPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRVKEVITKQAAVHRC  297

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + +  +PPT+N++DL++ F+KV  DLLG     +  P+M  +DF+++ E +P
Sbjct  298  NASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIP  357

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE   +  AS HSP +++NED  PYGAA+ AS+A +Y+ E+  +  V+  H
Sbjct  358  GHFSLLGMQDET--NGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSVSGFH  415

Query  201  DEL  193
            +EL
Sbjct  416  EEL  418



>gb|AAL59907.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
Length=439

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++R++EVI  QAAV RC
Sbjct  261  DPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRVKEVITKQAAVHRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + +  +PPT+N++DL++ F+KV  DLLG     +  P+M  +DF+++ E +P
Sbjct  319  NASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE   +  AS HSP +++NED  PYGAA+ AS+A +Y+ E+  +  V+  H
Sbjct  379  GHFSLLGMQDET--NGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSVSGFH  436

Query  201  DEL  193
            +EL
Sbjct  437  EEL  439



>ref|NP_200477.1| IAA-amino acid hydrolase ILR1-like 2 [Arabidopsis thaliana]
 sp|P54970.2|ILL2_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC04866.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 dbj|BAB09884.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 gb|AAW38995.1| At5g56660 [Arabidopsis thaliana]
 gb|AED96793.1| IAA-amino acid hydrolase ILR1-like 2 [Arabidopsis thaliana]
Length=439

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++R++EVI  QAAV RC
Sbjct  261  DPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRVKEVITKQAAVHRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + +  +PPT+N++DL++ F+KV  DLLG     +  P+M  +DF+++ E +P
Sbjct  319  NASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE   +  AS HSP +++NED  PYGAA+ AS+A +Y+ E+  +  V+  H
Sbjct  379  GHFSLLGMQDET--NGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSVSGFH  436

Query  201  DEL  193
            +EL
Sbjct  437  EEL  439



>gb|AAC49016.1| ILL2 [Arabidopsis thaliana]
Length=439

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++R++EVI  QAAV RC
Sbjct  261  DPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRVKEVITKQAAVHRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + +  +PPT+N++DL++ F+KV  DLLG     +  P+M  +DF+++ E +P
Sbjct  319  NASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE   +  AS HSP +++NED  PYGAA+ AS+A +Y+ E+  +  V+  H
Sbjct  379  GHFSLLGMQDET--NGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSVSGFH  436

Query  201  DEL  193
            +EL
Sbjct  437  EEL  439



>gb|ABC68430.1| putative auxin conjugate hydrolase [Tragopogon dubius]
Length=128

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -2

Query  696  GGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRCNATVNFLESEKPSI  517
            GGGAFNVIPDSV IGGTFRAFS+E  +QL++RIEEVI+GQA VQRCNATV F   +KP  
Sbjct  1    GGGAFNVIPDSVIIGGTFRAFSKESFMQLKQRIEEVIIGQATVQRCNATVEFSSKDKPFF  60

Query  516  PPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMPGYIYGLGLKDEAAD  337
            P TIND++LH HFQ+VA ++LG+S VK+  PLM  +DF+ YQEV+PGY Y LG+K E  D
Sbjct  61   PATINDKELHTHFQEVAREVLGASNVKNMLPLMGSEDFSVYQEVIPGYFYFLGMKGE-LD  119

Query  336  DKSASEHSP  310
             K AS HSP
Sbjct  120  KKPASVHSP  128



>ref|XP_004969701.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2-like [Setaria 
italica]
Length=458

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 125/185 (68%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  FRGGGAFNVIPDSVTIGGTFR FS EG  +L++RIEEV+V QAAV RC
Sbjct  275  DPLDSQVVTVTRFRGGGAFNVIPDSVTIGGTFRCFSAEGFTRLKRRIEEVVVAQAAVHRC  334

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
             A+V+F     P +PPT+N   LH HF+ VA + +G+  V+   +P M  +DFA + E +
Sbjct  335  AASVDFGVGGSPLLPPTVNTPSLHAHFEAVAAETVGAGNVRGAMEPCMGSEDFAAFSEAV  394

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQL-EWVTN  208
            P  + Y +G+ +E      A+ HSP+F +++DA PYGAA+ A+LA  Y+  R       +
Sbjct  395  PASHFYFVGIGNEEVGSVHAA-HSPHFLIDDDALPYGAAMHANLATGYLRRRAASSGPED  453

Query  207  KHDEL  193
             HDEL
Sbjct  454  SHDEL  458



>ref|XP_002864473.1| hypothetical protein ARALYDRAFT_495757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40732.1| hypothetical protein ARALYDRAFT_495757 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 125/183 (68%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++RI+E+I  QAAV RC
Sbjct  258  DPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRIKEIITKQAAVHRC  315

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN     +  +PPT+N+ DL++ F+KV  DLLG     +  P M  +DF+++ E +P
Sbjct  316  NASVNLTPKGREPMPPTVNNMDLYKQFKKVVRDLLGQEAFVEAAPEMGSEDFSYFAETIP  375

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE   +  AS HSP +++ ED  PYGAA+ A++A +Y+ E+  +  V+  H
Sbjct  376  GHFSLLGMQDET--NAYASSHSPLYRIKEDVLPYGAAIHATMAVQYLKEKASKGSVSGSH  433

Query  201  DEL  193
            DEL
Sbjct  434  DEL  436



>gb|KFK27232.1| hypothetical protein AALP_AA8G354700 [Arabis alpina]
Length=438

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 7/185 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS VVTV   +GG A NVIPDSVTIGGT RAF+  G  QL++RI+EVI  QA V RC
Sbjct  258  DPLDSNVVTVSMVQGGNALNVIPDSVTIGGTLRAFT--GFTQLQQRIKEVITKQATVHRC  315

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN         PPT+N+ DL++ F+ V  DLLG   V++   +M  +DF+F+ E +P
Sbjct  316  NASVNLTPQGIEPYPPTVNNVDLYKQFKSVVRDLLGQEAVEEAAQVMGSEDFSFFAEAIP  375

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---VTN  208
            G+   LG++DE      A  HSP+F++NEDA PYGAA+ AS+A +Y+ E+ L+     T+
Sbjct  376  GHFTLLGMQDET--KSYAMPHSPHFRINEDALPYGAAIHASMAVQYLKEKALKGSASATS  433

Query  207  KHDEL  193
             HDEL
Sbjct  434  FHDEL  438



>gb|EEC71359.1| hypothetical protein OsI_03451 [Oryza sativa Indica Group]
Length=456

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 127/185 (69%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL++QVVTV  F  G A NVIP+S+TIGGTFR FS EG ++L++RIEEVIV Q+AV RC
Sbjct  273  DPLEAQVVTVTRFLAGDALNVIPESITIGGTFRVFSNEGFLRLKRRIEEVIVAQSAVHRC  332

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSR--VKDHKPLMAGDDFAFYQEV  385
             A V+F    +P +PPTIN   LH HFQ VA + LG S   +   +P M  +DFA + E 
Sbjct  333  AAAVDFHAGGRPLLPPTINSAALHAHFQAVAAETLGPSAAVLGAMEPCMGSEDFAVFSEA  392

Query  384  MPG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN  208
            +P  + Y +G+++E A+      HSP+F+V++ A PYGAAL ASLA RY+ ER+ E  ++
Sbjct  393  VPASHFYFVGVRNE-AEGLVHLAHSPHFRVDDAALPYGAALHASLAMRYLDERRREGGSH  451

Query  207  KHDEL  193
             H+EL
Sbjct  452  PHEEL  456



>ref|NP_001044020.1| Os01g0706900 [Oryza sativa Japonica Group]
 sp|Q5N8F2.1|ILL2_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD81927.1| putative auxin conjugate hydrolase (ILL5) [Oryza sativa Japonica 
Group]
 dbj|BAD82256.1| putative auxin conjugate hydrolase (ILL5) [Oryza sativa Japonica 
Group]
 dbj|BAF05934.1| Os01g0706900 [Oryza sativa Japonica Group]
Length=456

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 128/185 (69%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL++QVVTV  F  G A NVIP+S+TIGGTFR FS EG ++L++RIEEVIV Q+AV RC
Sbjct  273  DPLEAQVVTVTRFLAGDALNVIPESITIGGTFRVFSNEGFLRLKRRIEEVIVAQSAVYRC  332

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSR--VKDHKPLMAGDDFAFYQEV  385
             A V+F    +P +PPTIN   LH HFQ VA + LG+S   +   +P M  +DFA + E 
Sbjct  333  AAAVDFHAGGRPLLPPTINSAALHAHFQAVAAETLGASAAVLGAMEPCMGSEDFAVFSEA  392

Query  384  MPG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTN  208
            +P  + Y +G+++E A+      HSP+F+V++ A PYGAAL ASLA RY+ ER+ E  ++
Sbjct  393  VPASHFYFVGVRNE-AEGLVHLAHSPHFRVDDAALPYGAALHASLAMRYLDERRREGGSH  451

Query  207  KHDEL  193
             H+EL
Sbjct  452  PHEEL  456



>ref|NP_001152128.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Zea mays]
 gb|ACG45994.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Zea mays]
 gb|AFW83700.1| IAA-amino acid hydrolase ILR1-like 4 [Zea mays]
Length=442

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 126/187 (67%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSV IGGTFR FS +G ++L++RIEEVIV Q+AV RC
Sbjct  257  DPLDSQVVTVTRFQGGGAFNVIPDSVAIGGTFRCFSSDGFMRLKRRIEEVIVSQSAVHRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVM  382
             A+V+F     P +PPT+N   LH HF+ VA + +G+S V+    P M  +DFA + E +
Sbjct  317  AASVDFGAGGSPLLPPTVNAASLHAHFEAVAAETVGASAVRAAMAPCMGSEDFASFSEAV  376

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---V  214
            P  + Y +G+++E      A+ HSP+F V++DA PYGAA+ A+LA  Y+  R       V
Sbjct  377  PASHFYFVGIRNEGIGAVHAA-HSPHFLVDDDALPYGAAMHANLAIGYLRNRAAANDGPV  435

Query  213  TNKHDEL  193
               HDEL
Sbjct  436  VAPHDEL  442



>ref|XP_008655104.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Zea 
mays]
 gb|ACF85872.1| unknown [Zea mays]
 gb|AFW83701.1| hypothetical protein ZEAMMB73_592458 [Zea mays]
Length=443

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 126/187 (67%), Gaps = 6/187 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSV IGGTFR FS +G ++L++RIEEVIV Q+AV RC
Sbjct  258  DPLDSQVVTVTRFQGGGAFNVIPDSVAIGGTFRCFSSDGFMRLKRRIEEVIVSQSAVHRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEVM  382
             A+V+F     P +PPT+N   LH HF+ VA + +G+S V+    P M  +DFA + E +
Sbjct  318  AASVDFGAGGSPLLPPTVNAASLHAHFEAVAAETVGASAVRAAMAPCMGSEDFASFSEAV  377

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW---V  214
            P  + Y +G+++E      A+ HSP+F V++DA PYGAA+ A+LA  Y+  R       V
Sbjct  378  PASHFYFVGIRNEGIGAVHAA-HSPHFLVDDDALPYGAAMHANLAIGYLRNRAAANDGPV  436

Query  213  TNKHDEL  193
               HDEL
Sbjct  437  VAPHDEL  443



>ref|NP_001288981.1| IAA-amino acid hydrolase ILR1-like 2 precursor [Brassica rapa]
 gb|ABB60092.1| IAA-amino acid hydrolase 2 [Brassica rapa]
Length=444

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 126/186 (68%), Gaps = 8/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDSVTIGGT RAF+     QL +R++EVI  QA VQRC
Sbjct  263  DPLDSKVVTVSKVNGGNAFNVIPDSVTIGGTLRAFTS--FSQLEQRVKEVITKQATVQRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+ND  L++ F+ + GDLLG     +  P+M G+DF+++ E +P
Sbjct  321  NASVNLRPNGKEPLPPTVNDVGLYKQFKNMVGDLLGEESFVEASPIMGGEDFSYFAEAIP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            G+   LG++DE+     AS HS  ++VNEDA PYGAA+ AS+A +Y+ +++    ++   
Sbjct  381  GHFAFLGMQDES--KSYASAHSSLYRVNEDALPYGAAVHASMAVQYLKDKKASKGSDTPK  438

Query  204  --HDEL  193
              HDEL
Sbjct  439  GFHDEL  444



>ref|XP_006646253.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2-like [Oryza brachyantha]
Length=435

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 125/184 (68%), Gaps = 4/184 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V  FR G AFNVIPDSVT+GGTFR FS+EG  +L++RIEEVIV Q+AV RC
Sbjct  254  DPLDSQVVSVTRFRAGNAFNVIPDSVTVGGTFRCFSKEGFSRLKRRIEEVIVAQSAVHRC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDH-KPLMAGDDFAFYQEVM  382
             A V+F     P +PPTIN   LH HF+ VA + LG++ V    +P M  +DFA Y E +
Sbjct  314  GAAVDFNARGTPLLPPTINSPALHAHFEAVATETLGAAHVHGALEPCMGSEDFATYSEAV  373

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK  205
            P  + Y +G+++E  +      HSP+F V++ A P+GAAL ASLA RY+ ER  + V+  
Sbjct  374  PASHFYFVGIRNE-TEGLVHLAHSPHFLVDDGALPFGAALHASLAMRYLDERHRD-VSQS  431

Query  204  HDEL  193
            H+ L
Sbjct  432  HEVL  435



>ref|XP_009132189.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Brassica rapa]
Length=439

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 123/182 (68%), Gaps = 4/182 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAFS  G  QL++RI+EVI  QA V RC
Sbjct  262  DPLDSKVVTVSKLHGGNAFNVIPDSITIGGTLRAFS--GFSQLQERIKEVITKQATVNRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+N+ +L++ F+ +  DLLG     +  P+M G+DF+++ E +P
Sbjct  320  NASVNLKPNGKEPVPPTVNNMNLYKQFKNLVRDLLGEDSFVEVSPIMGGEDFSYFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNKHD  199
            G+   LG++DE      AS HS  + VNEDA PYGAA+ AS+A RY+ ++  +   +  D
Sbjct  380  GHFSFLGMQDET--KSYASPHSSLYTVNEDALPYGAAIHASMAVRYLEDKASKGSDSPKD  437

Query  198  EL  193
            EL
Sbjct  438  EL  439



>emb|CDY32768.1| BnaA10g10810D [Brassica napus]
Length=444

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 127/186 (68%), Gaps = 8/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDSVTIGGT RAF+     QL +R++EVI  QA VQRC
Sbjct  263  DPLDSKVVTVSKVNGGNAFNVIPDSVTIGGTLRAFTS--FSQLEQRVKEVITKQATVQRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+ND  L++ F+ + GDLLG     +  P+M G+DF+++ + +P
Sbjct  321  NASVNLRPNGKEPLPPTVNDVGLYKQFKNMVGDLLGEESFVEASPIMGGEDFSYFADAIP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNK--  205
            G+   LG++DE+     AS HS  ++VNEDA PYGAA+ AS+A +Y+ ++++   ++   
Sbjct  381  GHFAFLGMQDES--KSYASAHSSLYRVNEDALPYGAAVHASMAVQYLKDKKVSKGSDTPK  438

Query  204  --HDEL  193
              HDEL
Sbjct  439  DFHDEL  444



>tpg|DAA57933.1| TPA: hypothetical protein ZEAMMB73_224624 [Zea mays]
Length=264

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 121/185 (65%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNV+P SVTIGGTFR FS EG ++L++RIEEV+V Q+AV RC
Sbjct  81   DPLDSQVVTVTRFLGGGAFNVVPGSVTIGGTFRCFSAEGFLRLKRRIEEVVVAQSAVHRC  140

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
             A+V+F     P +PPT+N   LH HF+ VA D +G   V+   +P M  +DFA +   +
Sbjct  141  AASVDFSAGGSPLLPPTVNAAPLHAHFEAVAADTVGVGAVRGAMEPCMGSEDFASFSAAV  200

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQL-EWVTN  208
            P  + Y +G+ +EA     A+ HSP+F V++ A PYGAA+ A+LA  Y+    +      
Sbjct  201  PASHFYFVGIGNEAIGAVHAA-HSPHFLVDDGALPYGAAMHANLAIEYLRNHAIANRSVG  259

Query  207  KHDEL  193
             HDEL
Sbjct  260  PHDEL  264



>emb|CDX88581.1| BnaA03g10680D [Brassica napus]
Length=439

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 123/182 (68%), Gaps = 4/182 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+TIGGT RAFS  G  Q ++RI+EVI  QA V RC
Sbjct  262  DPLDSKVVTVSKLHGGNAFNVIPDSITIGGTLRAFS--GFSQFQERIKEVITKQATVNRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+N+ +L++ F+ +  DLLG     +  P+M G+DF+++ E +P
Sbjct  320  NASVNLKPNGKEPVPPTVNNMNLYKQFKNLVRDLLGEDSFVEVSPIMGGEDFSYFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVTNKHD  199
            G+   LG++DE    + AS HS  + VNEDA PYGAA+ AS+A RY+ ++  +   +  D
Sbjct  380  GHFSFLGMQDET--KRYASPHSSLYTVNEDALPYGAAIHASMAVRYLEDKASKGSDSPKD  437

Query  198  EL  193
            EL
Sbjct  438  EL  439



>gb|KHF97690.1| IAA-amino acid hydrolase ILR1-like 6 [Gossypium arboreum]
Length=280

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 115/170 (68%), Gaps = 1/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   N+IPD+V IGGTFRAFS      L +RI+EV+V QA+V RC
Sbjct  111  NPLDSQVVSVTSFNGGNNLNMIPDTVVIGGTFRAFSNASFYNLLQRIQEVVVEQASVFRC  170

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E +    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY E++P
Sbjct  171  SATVDFFEKDSTIYPPTVNDDHMYEHVKKVATDLLGPTNFRVVPPMMGAEDFSFYTEIVP  230

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
               Y +G+++E         HSPYF ++ED  P GAA+ AS+A RY+ ER
Sbjct  231  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPMGAAVHASIAERYLNER  279



>emb|CDY11910.1| BnaC03g13360D [Brassica napus]
Length=427

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDS+T+GGT RAF+  G  QL++R++EVI  QA V RC
Sbjct  262  DPLDSKVVTVSMVHGGNAFNVIPDSITLGGTLRAFT--GFSQLQQRVKEVITKQATVHRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA VN     K  +PP +ND DL++ F+ + GDLLG     +  P+M G+DF+++ E +P
Sbjct  320  NAPVNLTPHGKEQVPPLVNDMDLYKQFKNMVGDLLGEESFVEASPVMGGEDFSYFAEAIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G+   LG++DE      AS HS  ++VNEDA PYGAA+ AS+A +Y+
Sbjct  380  GHFSFLGMQDET--KSYASTHSSLYRVNEDALPYGAAMHASMAVQYL  424



>ref|XP_002458379.1| hypothetical protein SORBIDRAFT_03g032500 [Sorghum bicolor]
 gb|EES03499.1| hypothetical protein SORBIDRAFT_03g032500 [Sorghum bicolor]
Length=447

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 124/185 (67%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F+GGGAFNVIPDSVTIGGTFR FS EG ++L++RIEEV+V Q+AV RC
Sbjct  264  DPLDSQVVTVTRFQGGGAFNVIPDSVTIGGTFRCFSSEGFLRLKRRIEEVVVAQSAVHRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
             A+V+F     P +PPT+N   LH HF+ VA + +G+  V+   +P M  +DFA + E +
Sbjct  324  AASVDFGAGGSPLLPPTVNAASLHAHFEAVAAETVGAGAVRGAMEPCMGSEDFASFSEAV  383

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER-QLEWVTN  208
            P  + Y +G+ +EA     A+ HSP+F +++ A PYGAA+ A+LA  Y+           
Sbjct  384  PASHFYFVGIGNEAIGAVHAA-HSPHFFIDDGALPYGAAMHANLAIGYLRNHAAASGPVG  442

Query  207  KHDEL  193
             HDEL
Sbjct  443  PHDEL  447



>ref|NP_200476.1| IAA-amino acid hydrolase ILR1-like 1 [Arabidopsis thaliana]
 sp|P54969.1|ILL1_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC49015.1| ILL1 [Arabidopsis thaliana]
 gb|AAC04865.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 dbj|BAB09883.1| IAA-amino acid hydrolase homolog 1 precursor [Arabidopsis thaliana]
 dbj|BAD44056.1| IAA-amino acid hydrolase homolog 1 precursor [Arabidopsis thaliana]
 dbj|BAD44083.1| IAA-amino acid hydrolase homolog 1 precursor [Arabidopsis thaliana]
 gb|ACE79743.1| At5g56650 [Arabidopsis thaliana]
 gb|AED96792.1| IAA-amino acid hydrolase ILR1-like 1 [Arabidopsis thaliana]
Length=438

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 125/183 (68%), Gaps = 5/183 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP DS+VVTV    GG AFNVIPDS+TIGGT RAF+  G  QL++RI+E+I  QAAV RC
Sbjct  260  DPSDSKVVTVTKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQERIKEIITKQAAVHRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   +    +PPT+N+ DL++ F+KV  DLLG     +  P M  +DF+++ E +P
Sbjct  318  NASVNLAPNGNQPMPPTVNNMDLYKKFKKVVRDLLGQEAFVEAVPEMGSEDFSYFAETIP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW-VTNKH  202
            G+   LG++DE      AS HSP++++NED  PYGAA+ A++A +Y+ ++  +  V+  H
Sbjct  378  GHFSLLGMQDET--QGYASSHSPHYRINEDVLPYGAAIHATMAVQYLKDKASKGSVSGFH  435

Query  201  DEL  193
            DEL
Sbjct  436  DEL  438



>ref|XP_010536843.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Tarenaya hassleriana]
Length=446

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQVVTV    GG AFNVIP SVT+ GT R+FS EG+ QL++RIEEVI  Q+AV RC
Sbjct  262  DPLGSQVVTVASVHGGDAFNVIPGSVTMNGTSRSFSAEGLSQLQRRIEEVITKQSAVHRC  321

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NATVN   + +   PPT+ND  L++  + VA ++LG   V   +PLM G+DF+FY + +P
Sbjct  322  NATVNMKPNGQEVYPPTMNDDHLYERVKNVAREMLGLDGVVVAEPLMGGEDFSFYAQEIP  381

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
            G+   LG++DE      A  HSPY++VNED  PYGAAL A+ A +Y+ ++
Sbjct  382  GHFLFLGMQDET--KSFAMTHSPYYRVNEDVLPYGAALHAATAVQYLTDK  429



>ref|NP_001159338.1| hypothetical protein precursor [Zea mays]
 gb|ACN25828.1| unknown [Zea mays]
 tpg|DAA57932.1| TPA: hypothetical protein ZEAMMB73_224624 [Zea mays]
Length=447

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 121/185 (65%), Gaps = 4/185 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVVTV  F GGGAFNV+P SVTIGGTFR FS EG ++L++RIEEV+V Q+AV RC
Sbjct  264  DPLDSQVVTVTRFLGGGAFNVVPGSVTIGGTFRCFSAEGFLRLKRRIEEVVVAQSAVHRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKD-HKPLMAGDDFAFYQEVM  382
             A+V+F     P +PPT+N   LH HF+ VA D +G   V+   +P M  +DFA +   +
Sbjct  324  AASVDFSAGGSPLLPPTVNAAPLHAHFEAVAADTVGVGAVRGAMEPCMGSEDFASFSAAV  383

Query  381  PG-YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQL-EWVTN  208
            P  + Y +G+ +EA     A+ HSP+F V++ A PYGAA+ A+LA  Y+    +      
Sbjct  384  PASHFYFVGIGNEAIGAVHAA-HSPHFLVDDGALPYGAAMHANLAIEYLRNHAIANRSVG  442

Query  207  KHDEL  193
             HDEL
Sbjct  443  PHDEL  447



>ref|XP_007137440.1| hypothetical protein PHAVU_009G1272001g, partial [Phaseolus vulgaris]
 gb|ESW09434.1| hypothetical protein PHAVU_009G1272001g, partial [Phaseolus vulgaris]
Length=270

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 114/170 (67%), Gaps = 1/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPD V +GGTFRAFS     QL +RIE+VIV QA+V RC
Sbjct  100  NPLDSQVVSVTSFNGGNNLDMIPDKVILGGTFRAFSNTSFYQLLERIEQVIVEQASVYRC  159

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+F E E    PPT+ND  +++H +KV+ DLLG    +   P+M  +DF+FY EV+P
Sbjct  160  SAEVDFFEKEYTIYPPTVNDERMYEHVKKVSIDLLGQKNFRVVPPMMGAEDFSFYSEVVP  219

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
               + +G+++E     + + HSPYF ++ED  P GAA  A++A RY++E 
Sbjct  220  SAFFYIGIRNETL-GSTHTGHSPYFMIDEDVLPIGAATHATIAERYLIEH  268



>emb|CDY32874.1| BnaC09g33210D [Brassica napus]
Length=448

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VVTV    GG AFNVIPDSVTIGGT RAF+     QL +R++EVI  QA V RC
Sbjct  263  DPLDSKVVTVSKVNGGDAFNVIPDSVTIGGTLRAFT--SFSQLEQRVKEVITNQATVHRC  320

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+VN   + K  +PPT+ND  L++ F+ + GDLLG     +  P+M G+DF+++ E +P
Sbjct  321  NASVNLRPNGKEPLPPTVNDVGLYKQFKNMVGDLLGEESFVEASPIMGGEDFSYFAEAIP  380

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE--RQLEWVTN  208
            G+   LG++DE      AS HS  ++VNEDA  YGAA+ AS+A +Y+ +   Q  ++TN
Sbjct  381  GHFAFLGMQDET--KSYASAHSSLYRVNEDALHYGAAVHASMAVQYLKDPINQKAFMTN  437



>gb|KDP21295.1| hypothetical protein JCGZ_21766 [Jatropha curcas]
Length=435

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V    GG AFNVIPDS TI GTFRAFS++G   LR+RIEEVI GQAAV RC
Sbjct  260  DPLDSQVVSVAMINGGTAFNVIPDSTTISGTFRAFSKKGFHALRERIEEVIKGQAAVHRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            ++ ++F  +  P+IPPT+ND  +++H ++V+ D++G    +     M  +DFAFYQE +P
Sbjct  320  SSEIDFTGNGNPTIPPTVNDVKIYEHVRRVSIDVVGEQNTQVAPAFMGSEDFAFYQEKVP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    LG+++E         HSPYF V+ED FP GAA+ A  A  Y+
Sbjct  380  GSFLFLGIRNEKLGCVHPP-HSPYFTVDEDVFPIGAAVHAEFALSYL  425



>gb|KJB59248.1| hypothetical protein B456_009G246300 [Gossypium raimondii]
Length=480

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 1/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   N+IPD+V IGGTFRAFS      L +RI+EV+V QA+V RC
Sbjct  311  NPLDSQVVSVTSFNGGNNLNMIPDTVVIGGTFRAFSNASFYNLLQRIQEVVVEQASVFRC  370

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            + TV+F E +    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY E++P
Sbjct  371  STTVDFFEKDSTIYPPTVNDDHMYEHVKKVATDLLGPTNFRVVPPMMGAEDFSFYTEIVP  430

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
               Y +G+++E         HSPYF ++ED  P GAA+ AS+A RY+ ER
Sbjct  431  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPIGAAVHASIAERYLNER  479



>ref|XP_007019095.1| IAA-leucine resistant-like gene 6 isoform 1 [Theobroma cacao]
 gb|EOY16320.1| IAA-leucine resistant-like gene 6 isoform 1 [Theobroma cacao]
Length=481

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPD+V IGGTFRAFS      L +RIEEVIV QA+V RC
Sbjct  312  NPLDSQVVSVTSFNGGNNLDMIPDTVVIGGTFRAFSNASFYNLLQRIEEVIVEQASVFRC  371

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E E    PPT+ND  +++H +KVA DLLG    +   P+M  +DF+FY +V+P
Sbjct  372  SATVDFFEKEYTIYPPTVNDDRMYEHVKKVATDLLGPPNFRVVPPMMGAEDFSFYSQVVP  431

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA+ A++A RY++E
Sbjct  432  AAFYYIGIRNETLGSVHTG-HSPYFMIDEDVLPIGAAVHATIAERYLIE  479



>ref|XP_008778350.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Phoenix dactylifera]
Length=338

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPDSV I GTFRAFS     QLR+RIEEVI+ Q++V RC
Sbjct  170  NPLDSQVVSVASFNGGDDLDLIPDSVIIAGTFRAFSNASFYQLRQRIEEVIIQQSSVYRC  229

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
              +V+F E E+   PPT+ND  +++H +KVA DLLG    K   P+M  +DF+FY EV+P
Sbjct  230  TTSVDFFEQER-FYPPTVNDEFMNEHVKKVAIDLLGPENYKIVPPMMGAEDFSFYSEVIP  288

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E     + + HSPYF ++ED  P GAA+ A++A RY++E
Sbjct  289  AAFFYIGIRNETL-GSTYTGHSPYFMIDEDVLPIGAAVHAAVAERYLIE  336



>ref|XP_006472793.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Citrus 
sinensis]
Length=486

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 1/174 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V +F GG   ++IPD+V IGGT RAFS     QL +RIEEVIV QA V RC
Sbjct  310  NPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRC  369

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F +      PPT+ND D+++H +KVA DLLG +  +   P+M  +DF+FY EV+P
Sbjct  370  SATVDFFDKGNTVYPPTVNDEDMYEHVKKVAIDLLGPTNYRVVPPMMGAEDFSFYSEVVP  429

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW  217
               Y +G+K+E         HSPYF ++ED  P GAA+ A++A R++ E    W
Sbjct  430  AAFYYIGIKNETLGSIHTG-HSPYFMIDEDVLPVGAAVHATIAERFLNEYGQGW  482



>ref|XP_009391385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Musa acuminata 
subsp. malaccensis]
Length=470

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   +VIP+SVTIGGTFRAFS     QLR+RIEEVIV Q++V RC
Sbjct  302  NPLDSQVVSVASFNGGYNLDVIPESVTIGGTFRAFSNTSFYQLRRRIEEVIVEQSSVYRC  361

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A+V+F E E+   PPT+N+  +++H +KVA ++LG        P+M  +DF+FY EV+P
Sbjct  362  AASVDFFEKER-FYPPTVNEESMYEHLKKVATNMLGFDNFMVVPPMMGAEDFSFYSEVIP  420

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA+ A++A RY++E
Sbjct  421  AAFYYIGVRNETLGSVHTG-HSPYFMIDEDVLPTGAAMHAAIAERYLIE  468



>gb|EYU45331.1| hypothetical protein MIMGU_mgv1a023576mg [Erythranthe guttata]
Length=446

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIPD V +GGT R+ + +G++QL+ R++EVI GQA+V +C
Sbjct  269  DPLHSQVLSVTYVRGGTASNVIPDYVELGGTLRSLTTKGLLQLQHRVKEVIEGQASVHKC  328

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+  E E PS P  +ND+ L++H +KV G LL    VK+ K +MAG+DFAFYQEV+P
Sbjct  329  KAYVSMKEDEYPSYPACVNDKRLNEHVKKVGGLLLDPDNVKEAKMVMAGEDFAFYQEVIP  388

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G ++ +G+++E       S HSPYF ++ED  P GAAL  +LA  Y+
Sbjct  389  GIMFSIGIRNERIGSVH-SPHSPYFFLDEDVLPIGAALHTALAEFYL  434



>ref|XP_003567041.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Brachypodium 
distachyon]
Length=437

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 122/186 (66%), Gaps = 7/186 (4%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGG-AFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQR  562
            DPLD+QVVTV  FRGGG A NVIPDSVTIGGTFR FS EG  +L++RIEEVIV QAAV R
Sbjct  255  DPLDAQVVTVTRFRGGGGALNVIPDSVTIGGTFRCFSNEGFARLKRRIEEVIVAQAAVHR  314

Query  561  CNATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVK-DHKPLMAGDDFAFYQEV  385
            C A V+F    +P + PT N   LH HF  VA   +G+  V+   +P M  +DFA + E 
Sbjct  315  CAAGVDFHAGGRPLLAPTTNSAALHAHFVAVATGTVGAGGVRGGMEPCMGSEDFAAFSEA  374

Query  384  MPG--YIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEWVT  211
            + G  + Y +G+++E+A       HSP F+V+E A PYGAA+ A+LA  Y+ +++     
Sbjct  375  VQGGSHFYFVGIRNESAGSVH-DAHSPLFRVDEGALPYGAAMHATLAMTYLQQQRPR--G  431

Query  210  NKHDEL  193
            + HDEL
Sbjct  432  DSHDEL  437



>gb|KDO80612.1| hypothetical protein CISIN_1g011407mg [Citrus sinensis]
Length=486

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 1/174 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V +F GG   ++IPD+V IGGT RAFS     QL +RIEEVIV QA V RC
Sbjct  310  NPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRC  369

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F +      PPT+ND D+++H +KVA DLLG    +   P+M  +DF+FY EV+P
Sbjct  370  SATVDFFDKGNTVYPPTVNDEDMYEHVKKVAIDLLGPMNYRVVPPMMGAEDFSFYSEVVP  429

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW  217
               Y +G+K+E         HSPYF ++ED  P GAA+ A++A R++ E    W
Sbjct  430  AAFYYIGIKNETLGSIHTG-HSPYFMIDEDVLPVGAAVHATIAERFLNEYGQGW  482



>gb|KDO80611.1| hypothetical protein CISIN_1g011407mg [Citrus sinensis]
Length=478

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 1/174 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V +F GG   ++IPD+V IGGT RAFS     QL +RIEEVIV QA V RC
Sbjct  302  NPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRC  361

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F +      PPT+ND D+++H +KVA DLLG    +   P+M  +DF+FY EV+P
Sbjct  362  SATVDFFDKGNTVYPPTVNDEDMYEHVKKVAIDLLGPMNYRVVPPMMGAEDFSFYSEVVP  421

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW  217
               Y +G+K+E         HSPYF ++ED  P GAA+ A++A R++ E    W
Sbjct  422  AAFYYIGIKNETLGSIHTG-HSPYFMIDEDVLPVGAAVHATIAERFLNEYGQGW  474



>ref|XP_006434209.1| hypothetical protein CICLE_v10000964mg [Citrus clementina]
 gb|ESR47449.1| hypothetical protein CICLE_v10000964mg [Citrus clementina]
Length=486

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 1/174 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V +F GG   ++IPD+V IGGT RAFS     QL +RIEEVIV QA V RC
Sbjct  310  NPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVIVEQARVFRC  369

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F +      PPT+ND D+++H +KVA DLLG    +   P+M  +DF+FY EV+P
Sbjct  370  SATVDFFDKGNTVYPPTVNDEDMYEHVKKVAIDLLGPMNYRVVPPMMGAEDFSFYSEVVP  429

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQLEW  217
               Y +G+K+E         HSPYF ++ED  P GAA+ A++A R++ E    W
Sbjct  430  AAFYYIGIKNETLGSIHTG-HSPYFMIDEDVLPVGAAVHATIAERFLNEYGQGW  482



>ref|XP_009760823.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 isoform X1 [Nicotiana 
sylvestris]
Length=434

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG++QL+KR++EVI GQAAV RC
Sbjct  260  DPLHSQVLSVTYVRGGSASNVIPPYVEFGGTLRSLTTEGLLQLQKRVKEVIEGQAAVHRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P+ P  IND  LHQH  +V   LLGS  +K+ + +MAG+DFAFYQE++P
Sbjct  320  KAYIDMKEEDFPAYPACINDERLHQHVGRVGKLLLGSENIKETEKVMAGEDFAFYQELIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G ++ +G+++E      A  HSP+F ++ED  P GAAL  ++A  Y+ + Q
Sbjct  380  GVMFQIGIRNEKLGSTHAP-HSPHFFLDEDVLPIGAALHTAIAEMYLNDYQ  429



>ref|XP_007039231.1| IAA-leucine-resistant-like 3 [Theobroma cacao]
 gb|EOY23732.1| IAA-leucine-resistant-like 3 [Theobroma cacao]
Length=435

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 114/171 (67%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AFN IP  V  GGT R+ + +G+ +L++R++EVI GQAAV RC
Sbjct  258  DPLHSQVLSVTLIRGGSAFNTIPPYVEFGGTLRSLTTDGLHKLQQRLKEVIKGQAAVHRC  317

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA+++  E E P  P   ND  LHQH QKV   LLG   VK  K +MAG+DF+FYQE++P
Sbjct  318  NASIDMKEEEFPPYPAVFNDDSLHQHVQKVGRLLLGPENVKVGKKVMAGEDFSFYQELIP  377

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++E         HSPYF ++EDA P GAAL  +LA  Y+ E +
Sbjct  378  GFMLSIGIRNEGVGSIHPP-HSPYFFIDEDALPIGAALYTALAELYLNENE  427



>gb|KJB64483.1| hypothetical protein B456_010G051100 [Gossypium raimondii]
Length=475

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 1/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IP++V IGGTFRAFS      L +RIEEVIV QA V RC
Sbjct  306  NPLDSQVVSVTSFNGGNNLDMIPETVVIGGTFRAFSNASFYNLLQRIEEVIVEQANVFRC  365

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             ATV+F E E    PPT+ND  +++H +KVA DLLG    +   P+M  +DF+FY +V+P
Sbjct  366  WATVDFFEKESTIYPPTVNDNRMYEHVKKVATDLLGPPNFRVVPPMMGAEDFSFYSQVVP  425

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
               Y +G+++E     + + HSPYF ++ED  P GAA+ A++A RY+ E+
Sbjct  426  AAFYYIGVRNETLGS-THTGHSPYFMIDEDVLPIGAAVHATIAERYLNEQ  474



>ref|XP_010088388.1| IAA-amino acid hydrolase ILR1-like 5 [Morus notabilis]
 gb|EXB34862.1| IAA-amino acid hydrolase ILR1-like 5 [Morus notabilis]
Length=434

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +P D QVVTV    G  AFNVIP++VTIGG+FRAFS   +  LR+RIEEVIV QAAV +C
Sbjct  256  EPGDPQVVTVAKLEGSDAFNVIPNTVTIGGSFRAFST--IRHLRRRIEEVIVAQAAVSKC  313

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA VNF E  KP  P   N+  L+ HF+ VA  +LG  RV +   +   +DFAFYQE +P
Sbjct  314  NAAVNFFEDVKPLYPAVNNNEKLYDHFKNVATQMLGPQRVLEAPQVTVSEDFAFYQEELP  373

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G  + LG+K+E   ++    HS +F + +DAFPYGAAL ASLA  Y+
Sbjct  374  GLFFFLGIKNETHGEEPV--HSAHFDIAQDAFPYGAALHASLATTYL  418



>ref|XP_004241428.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Solanum lycopersicum]
Length=430

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG+ QL+KR++EVI GQAAV RC
Sbjct  256  DPLHSQVLSVTYVRGGSASNVIPSYVEFGGTLRSLTTEGLFQLQKRVKEVIEGQAAVHRC  315

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+  E + P+ P   ND +LHQH ++V   +LGS  V D + +MAG+DFAFYQ+V+P
Sbjct  316  KAYVDMKEEDFPAYPACTNDENLHQHVERVGKLMLGSENVGDIEKVMAGEDFAFYQQVIP  375

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G I+ +G+++E      A  HSP+F ++ED  P GAA+  ++A  Y+ + Q
Sbjct  376  GVIFQIGIRNEKLGSTHAP-HSPHFFLDEDVLPIGAAMHTAIAEMYLNDYQ  425



>gb|KJB74616.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
 gb|KJB74620.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=258

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AF+VIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  81   DPLHSQVLSVTFIRGGSAFSVIPSYVEFGGTLRSLTTEGLHKLQQRLKEVIKGQAAVHRC  140

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P  P  +ND  LHQH QKV   LLG   VK  K +MAG+DFAFYQE +P
Sbjct  141  KAFIDMKEKDHPVYPAVVNDDGLHQHVQKVGSLLLGPENVKRGKKIMAGEDFAFYQEKIP  200

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++E         HSPYF ++ED    GAAL  +LA  Y+ E +
Sbjct  201  GFMLSIGIRNEELGSIHPP-HSPYFFLDEDVLAIGAALHTALAELYLNEHK  250



>ref|XP_002521309.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF41083.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=431

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 114/171 (67%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL+S V++V + RGG + NVIP  V  GGT R+ + EG+ QL+ R+ EVI GQAAV RC
Sbjct  257  DPLNSNVLSVTYVRGGISLNVIPPYVEFGGTLRSLTTEGLHQLQLRLREVIEGQAAVHRC  316

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+  E E PS P  +ND++L+ H Q+V   LLG   VK  + +MAG+DFAFYQE++P
Sbjct  317  NAYVDLKEDEYPSYPAVVNDKNLNMHVQRVGSLLLGPENVKTGEKVMAGEDFAFYQELIP  376

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G +  +G+++E       S HSPYF ++ED  P GAAL  +LA  Y+ + Q
Sbjct  377  GVMLSIGIRNEKL-GSVYSPHSPYFFIDEDVLPIGAALHTALAETYLDDHQ  426



>ref|XP_004168826.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like, partial 
[Cucumis sativus]
Length=279

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 113/170 (66%), Gaps = 1/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPD V IGGTFRAFS     Q+ +RIE+VIV QA+V RC
Sbjct  109  NPLDSQVVSVTSFNGGSNLDMIPDVVVIGGTFRAFSNSSFYQVLQRIEQVIVEQASVYRC  168

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+F E E    PPT+ND+ +++H +KVA DL GS   +  +P+M  +DF+FY E +P
Sbjct  169  SAMVDFFEKEYTIYPPTVNDKAMYEHVKKVAIDLHGSQNFRIVQPMMGAEDFSFYSEYVP  228

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
               + +G+++E       + HSPYF ++E+  P GAA  A++A RY+ E 
Sbjct  229  AAFFYIGVRNETLGSIH-TGHSPYFMIDENVLPIGAATHATIAERYLYEH  277



>ref|XP_002306640.1| hypothetical protein POPTR_0005s20110g [Populus trichocarpa]
 gb|EEE93636.1| hypothetical protein POPTR_0005s20110g [Populus trichocarpa]
Length=509

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IPD+V +GGTFRAFS     QL +RIEEVIV QA+V RC
Sbjct  340  NPLDSQVVSVTTMDGGNDLDMIPDTVILGGTFRAFSNTSFNQLLQRIEEVIVEQASVFRC  399

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E++    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY +V+P
Sbjct  400  SATVDFFENQSTVYPPTVNDDHMYEHVRKVAIDLLGPANFRVVPPMMGAEDFSFYTQVVP  459

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E     + + HSPYF ++ED  P GAA  A++A RY++E
Sbjct  460  AAFYYIGVRNETLGS-THTGHSPYFMIDEDVLPIGAATHATIAERYLIE  507



>ref|XP_007044501.1| Peptidase M20/M25/M40 family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY00333.1| Peptidase M20/M25/M40 family protein, putative isoform 1 [Theobroma 
cacao]
Length=253

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 108/167 (65%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDS+VV+V    GG AFNVIPDS TI GTFRAFS++    LR R+EEVI  QAAV RC
Sbjct  81   DPLDSKVVSVAMIHGGTAFNVIPDSTTIAGTFRAFSKKSFNALRDRVEEVIKAQAAVHRC  140

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A ++F   E P+IPPT+ND  +H+H  +++ +++G    K     M  +DFAFY + +P
Sbjct  141  SAKIDFSGKEHPTIPPTVNDEKVHEHVMRLSREIVGEENTKLAPTFMGSEDFAFYLDKVP  200

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    LG+ +E         HSPY+ ++ED FP GAA+ A+ A  ++
Sbjct  201  GSFLLLGINNEKT-GAIHPPHSPYYTIDEDVFPIGAAIHAAFAHSFL  246



>ref|XP_008378480.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Malus domestica]
Length=494

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG    +IP++V +GGTFRAFS     ++ +RIEEVIV QA+V RC
Sbjct  319  NPLDSQVVSVTAFNGGDDLGMIPNTVVLGGTFRAFSNTSFYRILQRIEEVIVEQASVYRC  378

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F +++    PPT+ND  +H+H  KVA DLLG +  +   P+M  +DF+FY EV+P
Sbjct  379  SATVDFFKNQNTIYPPTVNDEKMHEHVTKVAVDLLGPTNFRVVPPMMGAEDFSFYSEVIP  438

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
               + +G+++E     + + HSPYF ++ED  P GAA  A++A RY+ ER 
Sbjct  439  AGFFYIGIRNETL-GSTHTGHSPYFFIDEDVLPIGAATHATIAERYLNERS  488



>ref|XP_009596693.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=438

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV+++ + RGG A NVIP  V  GGT R+ + EG++QL+KR++EVI GQAAV RC
Sbjct  264  DPLHSQVLSITYVRGGSASNVIPPYVEFGGTLRSLTTEGLLQLQKRVKEVIEGQAAVHRC  323

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P+ P  IND  LHQH  +V   LLGS  +K+ + +MAG+DFAFYQE++P
Sbjct  324  KAYIDMKEEDFPAYPACINDERLHQHVGRVGKLLLGSENIKEAEKVMAGEDFAFYQELIP  383

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G ++ +G+++E      A  HSP+F ++ED  P G AL  ++A  Y+ + Q
Sbjct  384  GVMFQIGIRNEKVGSTHAP-HSPHFFLDEDVLPIGVALHTAIAEMYLNDYQ  433



>gb|KJB74617.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=305

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AF+VIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  128  DPLHSQVLSVTFIRGGSAFSVIPSYVEFGGTLRSLTTEGLHKLQQRLKEVIKGQAAVHRC  187

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P  P  +ND  LHQH QKV   LLG   VK  K +MAG+DFAFYQE +P
Sbjct  188  KAFIDMKEKDHPVYPAVVNDDGLHQHVQKVGSLLLGPENVKRGKKIMAGEDFAFYQEKIP  247

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++E         HSPYF ++ED    GAAL  +LA  Y+ E +
Sbjct  248  GFMLSIGIRNEELGSIHPP-HSPYFFLDEDVLAIGAALHTALAELYLNEHK  297



>gb|ACZ56435.1| IAA-amino acid hydrolase, partial [Populus tomentosa]
Length=462

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IP++V +GGTFRA+S     QL +RI+EVIV QA+V RC
Sbjct  293  NPLDSQVVSVTTMDGGNNLDMIPETVVLGGTFRAYSNTSFYQLLRRIKEVIVEQASVYRC  352

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E E    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY +V+P
Sbjct  353  SATVDFFEKESTIYPPTVNDDHMYEHVRKVATDLLGPTNFRVVPPMMGAEDFSFYTQVVP  412

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA  A++A RY++E
Sbjct  413  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPIGAATHAAIAERYLIE  460



>gb|KJB74618.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=298

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AF+VIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  121  DPLHSQVLSVTFIRGGSAFSVIPSYVEFGGTLRSLTTEGLHKLQQRLKEVIKGQAAVHRC  180

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P  P  +ND  LHQH QKV   LLG   VK  K +MAG+DFAFYQE +P
Sbjct  181  KAFIDMKEKDHPVYPAVVNDDGLHQHVQKVGSLLLGPENVKRGKKIMAGEDFAFYQEKIP  240

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++E         HSPYF ++ED    GAAL  +LA  Y+ E +
Sbjct  241  GFMLSIGIRNEELGSIHPP-HSPYFFLDEDVLAIGAALHTALAELYLNEHK  290



>ref|XP_011011908.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Populus euphratica]
Length=490

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IPD+V +GGTFRAFS     QL +RIEEVIV QA+V RC
Sbjct  321  NPLDSQVVSVTTMDGGNDLDMIPDTVILGGTFRAFSNTSFNQLLQRIEEVIVEQASVFRC  380

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E++    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY +V+P
Sbjct  381  SATVDFFENQSTVYPPTVNDDLMYEHVRKVAIDLLGPANFRVVPPMMGAEDFSFYTQVVP  440

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA  A++A RY++E
Sbjct  441  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPIGAATHATIAERYLIE  488



>ref|XP_002513747.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF48330.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=474

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IPD+V +GGTFRAFS     QL +RI EVIV QA V RC
Sbjct  305  NPLDSQVVSVTTMDGGNNVDMIPDTVVLGGTFRAFSNTSFYQLLRRINEVIVEQARVFRC  364

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E E    PPT+N+  +++H +KVA DLLG +  K   P+M  +DF+FY +V+P
Sbjct  365  SATVDFFEQEYTIYPPTVNNDKMYEHVRKVAIDLLGPANFKVVPPMMGAEDFSFYSQVVP  424

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E     + + HSPYF ++ED  P GAA  A++A RY++E
Sbjct  425  AAFYYIGIRNETLGS-THTGHSPYFMIDEDVLPIGAAAHATIAERYLIE  472



>ref|XP_008381545.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Malus domestica]
Length=435

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG+  LR+R++EVI GQAAV RC
Sbjct  259  DPLHSQVLSVTYVRGGTASNVIPSYVVFGGTLRSLTTEGLYLLRRRLKEVIEGQAAVHRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+  + E P +P  +ND  LH   Q+V   LLG   VK  K +MAG+DFAFYQ+ +P
Sbjct  319  NAYVDTKDEEYPPLPAVVNDESLHMQAQRVGKLLLGPENVKLCKKVMAGEDFAFYQQFIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G +  +G+ +E       S HSPYF ++ED  P GAAL A+LA  Y+ E Q
Sbjct  379  GIMLSIGIGNEEVGSVH-SPHSPYFFLDEDVLPIGAALHAALAESYLDEHQ  428



>ref|XP_002302231.2| hypothetical protein POPTR_0002s08300g [Populus trichocarpa]
 gb|EEE81504.2| hypothetical protein POPTR_0002s08300g [Populus trichocarpa]
Length=477

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IP++V +GGTFRA+S     QL +RI+EVIV QA+V RC
Sbjct  308  NPLDSQVVSVTTMDGGNNLDMIPETVVLGGTFRAYSNTSFYQLLQRIKEVIVEQASVFRC  367

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E E    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY +V+P
Sbjct  368  SATVDFFEKESTIYPPTVNDDHMYEHVRKVATDLLGPTNFRVVPPMMGAEDFSFYTQVVP  427

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA  A++A RY++E
Sbjct  428  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPIGAATHAAIAERYLIE  475



>gb|KHG23253.1| IAA-amino acid hydrolase ILR1-like 3 [Gossypium arboreum]
Length=468

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 112/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AF VIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  291  DPLHSQVLSVTFIRGGSAFGVIPSYVEFGGTLRSLTTEGLHKLQQRLKEVIKGQAAVHRC  350

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P  P  +ND  LHQH QKV   LLG  +VK  K LMAG+DFAFYQE +P
Sbjct  351  KAFIDMKEKDHPFYPAVVNDDGLHQHVQKVGSLLLGPEKVKRGKKLMAGEDFAFYQEKIP  410

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++EA        HSPYF ++ED    GAAL  +LA  Y+ E +
Sbjct  411  GFMLSIGIRNEALGSIHPL-HSPYFFLDEDVLAIGAALHTALAELYLNEHK  460



>ref|XP_004290879.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IP+SV IGGT RAFS      L +RIEEVIV QA+V RC
Sbjct  309  NPLDSQVVSVTAFNGGDKLDMIPNSVVIGGTLRAFSNTSFYHLLQRIEEVIVEQASVYRC  368

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            + TV+F + +    PPT+ND  +H+H +KVA DLLG +  +   P+M  +DF+FY EV+P
Sbjct  369  SGTVDFFKDKHTIYPPTVNDEKMHEHVRKVAMDLLGPTNFRVVPPMMGAEDFSFYSEVIP  428

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E         HSPYF ++ED  P GAA  A++A RY++E
Sbjct  429  AGFFYIGIRNETLGSFHTG-HSPYFFIDEDVLPIGAATHATIAERYLIE  476



>ref|XP_010999399.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Populus euphratica]
Length=490

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IPD+V +GGTFRAFS     QL +RIEEVIV QA+V RC
Sbjct  321  NPLDSQVVSVTTMDGGNDLDMIPDTVILGGTFRAFSDTSFNQLLQRIEEVIVEQASVFRC  380

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E++    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY +V+P
Sbjct  381  SATVDFFENQSTVYPPTVNDDLMYEHVRKVAIDLLGPANFRVVPPMMGAEDFSFYTQVVP  440

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA  A++A RY++E
Sbjct  441  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPIGAATHATIAERYLIE  488



>gb|KDP37575.1| hypothetical protein JCGZ_08266 [Jatropha curcas]
Length=438

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL S+V++V + RGG A NVIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  256  DPLYSEVLSVTYVRGGTALNVIPPYVQFGGTLRSLTTEGLHRLQRRMKEVIEGQAAVHRC  315

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA ++  E E PS P T+ND  L+ H Q++   LLG+  VK  + +MAG+DFAFYQE++P
Sbjct  316  NAYIDTKEEEYPSYPATVNDEKLNLHVQRIGSLLLGAENVKLGERVMAGEDFAFYQEMIP  375

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G ++ +G+++E       S HSP+F ++EDA P GAAL A+LA  Y+
Sbjct  376  GVMFSVGIRNEKLGSIH-SPHSPHFFLDEDALPVGAALYAALAETYL  421



>ref|XP_002266978.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Vitis vinifera]
Length=445

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLD QVV+V    GG AFNVIPD+ TI GTFRAFS++    LR RIEEVI  QAAV RC
Sbjct  268  DPLDHQVVSVAMIHGGTAFNVIPDAATITGTFRAFSKKSFYALRDRIEEVIKAQAAVHRC  327

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A ++F   E P+IPPTINDR +++H +KV+ +++G    K     M  +DFAFY + +P
Sbjct  328  SAEIDFSGMELPTIPPTINDRRIYEHARKVSSEMVGEENTKTSPVCMGSEDFAFYLDKVP  387

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    LG+++E A   +   HSPY+ ++E+  P GAA+ A+ A  Y+
Sbjct  388  GSFLFLGMRNEKAGS-TYPPHSPYYVLDEEVLPIGAAIHAAFALSYL  433



>ref|XP_004502492.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Cicer arietinum]
Length=484

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG ++++IPD+V IGGTFRAFS     QL  RI++VIV QA+V RC
Sbjct  315  NPLDSQVVSVTSFNGGNSYDMIPDAVVIGGTFRAFSNTSFYQLLDRIQQVIVEQASVYRC  374

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+F E E    PPT+ND  +++H +KV+ DLLG    +   P+M  +DF+FY +V+P
Sbjct  375  FAEVDFFEKEYTIYPPTVNDDQMYEHVKKVSIDLLGKKNFRVVPPMMGAEDFSFYSQVVP  434

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E     + + HSP+F ++EDA P GAA+ A++A RY+ E
Sbjct  435  SAFFYIGIRNETLGS-THTGHSPHFMIDEDALPIGAAVHAAIAERYLNE  482



>ref|XP_003526641.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Glycine 
max]
Length=465

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPDSV + GTFRAFS     QL +RIE+VIV QA+V RC
Sbjct  296  NPLDSQVVSVTSFNGGNNLDMIPDSVVLLGTFRAFSNTSFYQLLERIEQVIVEQASVYRC  355

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+F E E    PPT+ND  +++H +KV+ DLLG    +   P+M  +DF+FY EV+P
Sbjct  356  LAEVDFFEKEYTIYPPTVNDNRMYEHVKKVSIDLLGHKNFRVVPPMMGAEDFSFYSEVVP  415

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E     + + HSPYF ++ED  P GAA  AS+A RY++E
Sbjct  416  SGFFYIGVRNETLGS-THTGHSPYFMIDEDVLPIGAAAHASIAERYLIE  463



>ref|XP_009351899.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Pyrus x bretschneideri]
Length=435

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG+  LR+R++EVI GQAAV RC
Sbjct  259  DPLHSQVLSVTYVRGGTASNVIPSYVVFGGTLRSLTTEGLYLLRRRLKEVIEGQAAVHRC  318

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+  + E P +P  +ND  LH   Q+V   LLG   VK  + +MAG+DFAFYQ+ +P
Sbjct  319  NAYVDTKDEEYPPLPAVVNDESLHMQAQRVGKLLLGPENVKLCEKVMAGEDFAFYQQFIP  378

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G +  +G+ +E       S HSPYF ++ED  P GAAL A+LA  Y+ E Q
Sbjct  379  GIMLSIGIGNEEVGSVH-SPHSPYFFLDEDVLPIGAALHAALAESYLDEHQ  428



>ref|XP_008466723.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Cucumis melo]
Length=470

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPD+V IGGTFRAFS     Q+ +RIE+VIV QA+V RC
Sbjct  302  NPLDSQVVSVTSFNGGSNLDMIPDAVVIGGTFRAFSNSSFYQVLQRIEQVIVEQASVYRC  361

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+F E E    PPT+ND  +++H ++VA DL GS   +  +P+M  +DF+FY E +P
Sbjct  362  SAMVDFFEKEYTIYPPTVNDEAMYEHVKQVAIDLHGSQNFRIVQPMMGAEDFSFYSEFVP  421

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++E+  P GAA  A++A RY+ E
Sbjct  422  AAFYYIGVRNETLGSIHTG-HSPYFMIDENVLPIGAATHATIAERYLYE  469



>ref|XP_002963174.1| hypothetical protein SELMODRAFT_141529 [Selaginella moellendorffii]
 gb|EFJ35045.1| hypothetical protein SELMODRAFT_141529 [Selaginella moellendorffii]
Length=405

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL +QVV+V    GG  FNVIPDSVT+ G+FR+FS+EGM +L++RI+++I  QAAV +C
Sbjct  231  DPLGNQVVSVTSISGGHTFNVIPDSVTLKGSFRSFSKEGMAKLKERIQQIIESQAAVHKC  290

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V F ++++P  P TIND  LH H   VA  L GS  V++ KP+MA +DF+FY E +P
Sbjct  291  TARVVF-DADRPMYPATINDDKLHDHASWVATSLFGSHCVRNIKPVMAAEDFSFYLERIP  349

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G   GLG+  E A   +   HS  F+++ED  P+G A QA++A  YI E Q
Sbjct  350  GMFTGLGIHSE-AKGTTHFVHSGLFRMDEDMLPWGVAFQAAVAEAYINELQ  399



>ref|XP_010928552.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=472

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQV++V  F GG +++ IPDSVT+GGTFRAF++     L++RIEEVI GQ AV RC
Sbjct  288  DPLDSQVISVSSFHGGSSYSTIPDSVTVGGTFRAFTKRSFDVLKQRIEEVIKGQVAVYRC  347

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A + F ES+ P IPPT+ND  ++++ ++V+ +++G++  +    +M  +DFAFY E +P
Sbjct  348  TARLEFFESQHPPIPPTVNDDRIYEYVRQVSKEVVGNTNTQMSPRVMGSEDFAFYLEQIP  407

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
            G +  +G ++E        +HSPY+ ++EDA P GAA+ A+ A  Y+L+
Sbjct  408  GSLLLIGTRNEKIGSIHP-QHSPYYTIDEDALPIGAAIHAAFAHVYLLQ  455



>ref|XP_006347315.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5-like [Solanum 
tuberosum]
Length=430

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG+ QL+KR++EVI GQAAV RC
Sbjct  256  DPLHSQVLSVTYVRGGSASNVIPSYVEFGGTLRSLTTEGLSQLQKRVKEVIEGQAAVHRC  315

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+  + + P+ P   ND +LHQH ++V   +LGS  V + + +MAG+DFAFYQ+V+P
Sbjct  316  KAYVDMKQEDFPAYPACTNDENLHQHVERVGKLVLGSENVGEIEKVMAGEDFAFYQQVIP  375

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G I+ +G+++E      A  HSP+F ++ED  P GAA+  ++A  Y+ + Q
Sbjct  376  GVIFQIGIRNEKLGSTHAP-HSPHFFLDEDVLPIGAAMHTAIAEMYLNDYQ  425



>gb|KJB74615.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=404

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AF+VIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  227  DPLHSQVLSVTFIRGGSAFSVIPSYVEFGGTLRSLTTEGLHKLQQRLKEVIKGQAAVHRC  286

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P  P  +ND  LHQH QKV   LLG   VK  K +MAG+DFAFYQE +P
Sbjct  287  KAFIDMKEKDHPVYPAVVNDDGLHQHVQKVGSLLLGPENVKRGKKIMAGEDFAFYQEKIP  346

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++E         HSPYF ++ED    GAAL  +LA  Y+ E +
Sbjct  347  GFMLSIGIRNEELGSIHPP-HSPYFFLDEDVLAIGAALHTALAELYLNEHK  396



>ref|XP_010100519.1| IAA-amino acid hydrolase ILR1-like 2 [Morus notabilis]
 gb|EXB82653.1| IAA-amino acid hydrolase ILR1-like 2 [Morus notabilis]
Length=445

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 109/167 (65%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V     G  FNVIPDS TI GTFRAFS++    LR+RIEEVI GQAAV RC
Sbjct  269  DPLDSQVVSVAMIHAGTTFNVIPDSATIAGTFRAFSKKSFKALRERIEEVIKGQAAVHRC  328

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++F    + SIPPTIN+  +++H Q+V+ +++G    +    +M  +DFAFY + +P
Sbjct  329  TAEIDFSGEGQTSIPPTINNERIYKHVQRVSSEIVGEENTQLSNTIMGSEDFAFYLDKVP  388

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    LG+++E       S HSPYF V+ED  P GAA+ A+ A  Y+
Sbjct  389  GSFLMLGIRNENM-GAIYSPHSPYFLVDEDVLPVGAAIHAAFAVSYL  434



>ref|XP_002269424.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=477

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V    GG AFNVIPD+ TI GTFRAFS++    LR+RIEEV+  QAAV RC
Sbjct  300  DPLDSQVVSVAMIHGGTAFNVIPDAATITGTFRAFSKKSFYALRERIEEVVKAQAAVHRC  359

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A ++F   E+P+IPPTIND  +++H ++V+ +++G    K     M  +DFAFY + +P
Sbjct  360  SAEIDFAGMEQPTIPPTINDERIYEHVRQVSIEIVGEENTKRSPSFMGSEDFAFYLDKVP  419

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    +G+++E A       HSPYF ++E+  P GAA+ A+ A  Y+
Sbjct  420  GSFLLVGMRNERAGSIYPP-HSPYFSIDEEVLPIGAAIHAAFAYSYL  465



>ref|XP_009351298.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
 ref|XP_011014605.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=456

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 111/168 (66%), Gaps = 1/168 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V    GG AFNVIPDS +I GTFRAFS++    LR+RI+EVI GQAAV RC
Sbjct  280  DPLDSQVVSVAMIHGGTAFNVIPDSASIEGTFRAFSKKSFNALRERIKEVIEGQAAVHRC  339

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
               VNF  +E P IPPT+ND  +++H ++V+ D++G   V+     M  +DFAFY + +P
Sbjct  340  TCEVNFTGTEHPIIPPTVNDARIYEHVRRVSIDIVGEGNVEIAPIFMGSEDFAFYLDKVP  399

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYIL  235
            G    LG+++E         HSPY+ ++ED FP GA++ A  A  Y+L
Sbjct  400  GSFLFLGMRNEKI-GSIYHPHSPYYTIDEDVFPIGASIYAVFAHSYLL  446



>ref|XP_006351275.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Solanum 
tuberosum]
Length=485

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F  G   +VIP++VT+ GTFRAFS     QL KRI EV   QA+V RC
Sbjct  315  NPLDSQVVSVTSFNAGDNLDVIPETVTLSGTFRAFSTTNFYQLLKRIREVFTEQASVFRC  374

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E +    PPT+ND  +++H +KVA DL+G++  K   P+M  +DF+FY EV+P
Sbjct  375  SATVDFFEDKDTIYPPTVNDNTMYEHVKKVASDLVGTTNFKVVPPMMGAEDFSFYSEVIP  434

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E         HSP+F ++ED  P GAA  A++A RY+ E
Sbjct  435  AAFFYIGIRNETLGSIHTG-HSPHFMIDEDVLPIGAATHAAIAERYLYE  482



>gb|KJB74614.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=428

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V   RGG AF+VIP  V  GGT R+ + EG+ +L++R++EVI GQAAV RC
Sbjct  251  DPLHSQVLSVTFIRGGSAFSVIPSYVEFGGTLRSLTTEGLHKLQQRLKEVIKGQAAVHRC  310

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A ++  E + P  P  +ND  LHQH QKV   LLG   VK  K +MAG+DFAFYQE +P
Sbjct  311  KAFIDMKEKDHPVYPAVVNDDGLHQHVQKVGSLLLGPENVKRGKKIMAGEDFAFYQEKIP  370

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G++  +G+++E         HSPYF ++ED    GAAL  +LA  Y+ E +
Sbjct  371  GFMLSIGIRNEELGSIHPP-HSPYFFLDEDVLAIGAALHTALAELYLNEHK  420



>ref|XP_011009011.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=456

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 111/168 (66%), Gaps = 1/168 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V    GG AFNVIPDS +I GTFRAFS++    LR+RI+EVI GQAAV RC
Sbjct  280  DPLDSQVVSVAMIHGGTAFNVIPDSASIEGTFRAFSKKSFNALRERIKEVIEGQAAVHRC  339

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
               VNF  +E P IPPT+ND  +++H ++V+ D++G   V+     M  +DFAFY + +P
Sbjct  340  TCEVNFTGTEHPIIPPTVNDARIYEHVRRVSIDIVGEGNVEIAPIFMGSEDFAFYLDKVP  399

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYIL  235
            G    LG+++E         HSPY+ ++ED FP GA++ A  A  Y+L
Sbjct  400  GSFLFLGMRNEKI-GSIYHPHSPYYTIDEDVFPIGASIYAVFAHSYLL  446



>ref|XP_006378179.1| hypothetical protein POPTR_0010s04530g [Populus trichocarpa]
 gb|ERP55976.1| hypothetical protein POPTR_0010s04530g [Populus trichocarpa]
Length=469

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPLDSQVV+V    GG AFNVIPDS TI GTFRAFS++    LR+RI+EVI GQAAV RC
Sbjct  293  DPLDSQVVSVAMIHGGTAFNVIPDSATIEGTFRAFSKKSFNALRERIKEVIEGQAAVHRC  352

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
               VNF  +E P IPPT+ND  +++H ++V+ D++G   V+     M  +DFAFY + +P
Sbjct  353  TCEVNFTGTEHPIIPPTVNDARIYEHVRRVSIDIVGEGNVELAPIFMGSEDFAFYLDKVP  412

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    LG+++E         HSPY+ ++ED FP GA++ A  A  Y+
Sbjct  413  GSFLFLGMRNEKIGSIYLP-HSPYYTIDEDVFPIGASIYAVFAHSYL  458



>ref|XP_003602066.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|ABF55223.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|AES72317.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=476

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG + ++IPDSV IGGTFRAFS     QL +RIE+VIV QA+V  C
Sbjct  307  NPLDSQVVSVTSFNGGNSHDMIPDSVVIGGTFRAFSNTSFYQLLERIEQVIVQQASVYSC  366

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+F E E    PPT+ND  +++H +KV+ DLLG    +   P+M  +D++FY +V+P
Sbjct  367  FAEVDFFEKEYTIYPPTVNDDQMYEHVKKVSIDLLGQKNFRVVPPMMGAEDYSFYSQVIP  426

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E     + + HSP+F ++EDA P GAA+ A++A RY+ E
Sbjct  427  SAFFYIGIRNETLGS-THTGHSPHFTIDEDALPIGAAVHATIAERYLNE  474



>ref|XP_011027512.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Populus euphratica]
Length=476

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V    GG   ++IP++V +GGTFRA+S     QL +RI+EVIV QA+V RC
Sbjct  307  NPLDSQVVSVTTMDGGNNLDMIPETVVLGGTFRAYSNTSFYQLLQRIKEVIVEQASVFRC  366

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E E    PPT+ND  +++H +KVA DLLG +  +   P+M  +DF+FY +V+P
Sbjct  367  SATVDFFEKESTIYPPTVNDDHMYEHVRKVATDLLGPTNFRVVPPMMGAEDFSFYTQVVP  426

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               Y +G+++E         HSPYF ++ED  P GAA  A++A RY+ E
Sbjct  427  AAFYYIGVRNETLGSIHTG-HSPYFMIDEDVLPIGAATHAAIAERYLNE  474



>ref|XP_002981614.1| hypothetical protein SELMODRAFT_421067 [Selaginella moellendorffii]
 gb|EFJ17429.1| hypothetical protein SELMODRAFT_421067 [Selaginella moellendorffii]
Length=405

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 114/171 (67%), Gaps = 2/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL +QVV+V    GG  FNVIPDSVT+ G+FR+FS+EGM +L++RI+++I  QAAV +C
Sbjct  231  DPLGNQVVSVTSISGGHTFNVIPDSVTLKGSFRSFSKEGMAKLKERIQQIIESQAAVHKC  290

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V F + ++P  P TIND  LH H   VA  L GS  V++ KP+MA +DF+FY E +P
Sbjct  291  TARVVF-DGDRPMYPATINDDKLHDHASWVATSLFGSHCVRNIKPVMAAEDFSFYLERIP  349

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G   GLG+  E A   +   HS  F+++ED  P+G A QA++A  YI E Q
Sbjct  350  GMFTGLGIHSE-AKGTTHFVHSGLFRMDEDMLPWGVAFQAAVAEAYINELQ  399



>ref|XP_007222851.1| hypothetical protein PRUPE_ppa008809mg [Prunus persica]
 gb|EMJ24050.1| hypothetical protein PRUPE_ppa008809mg [Prunus persica]
Length=318

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%), Gaps = 1/170 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG    +IP++V +GGT RAFS     +L +RIEEVIV QA+V RC
Sbjct  149  NPLDSQVVSVTAFNGGDDLGMIPNTVVLGGTLRAFSNTSFYRLLQRIEEVIVEQASVYRC  208

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F +++    PPT+ND ++H+H +KVA  LLG +  +   P+M  +DF+FY EV+P
Sbjct  209  SATVDFFKNQSTIYPPTVNDDNMHEHVRKVAMGLLGPANFRVVPPMMGAEDFSFYSEVIP  268

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILER  229
               + +G+++E     + + HSPYF ++ED  P GA   A++A RY+ E 
Sbjct  269  AGFFYIGIRNETL-GSTHTGHSPYFFIDEDVLPIGAVTHATIAERYLNEH  317



>ref|XP_009762344.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nicotiana sylvestris]
Length=484

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F  G   +VIPD+VT+ GTFRAFS     QL KRI EV   QA+V RC
Sbjct  314  NPLDSQVVSVTSFNAGDKLDVIPDAVTLSGTFRAFSSTNFYQLLKRIREVFEEQASVFRC  373

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV+F E +    PPT+ND  +++H +KVAGDL+G +  K   P+M  +DF+FY EV+P
Sbjct  374  SATVDFFEDKDTIYPPTVNDDRMYEHVKKVAGDLVGPANFKVVPPIMGAEDFSFYSEVIP  433

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E         HSP+F ++ED  P GAA  A++A RY+ E
Sbjct  434  AAFFYIGIRNETLGSYHTG-HSPHFMIDEDVLPIGAATHAAIAERYLYE  481



>ref|XP_009592954.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6 [Nicotiana tomentosiformis]
Length=484

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F  G  F+VIP++VT+ GTFRAFS     QL +RI EV   QA+V RC
Sbjct  314  NPLDSQVVSVTSFNAGDKFDVIPEAVTLSGTFRAFSSTNFYQLLRRIREVFTEQASVFRC  373

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +ATV F E +    PPT+ND  +++H +KVAGDL+G +  K   P+M  +DF+FY E++P
Sbjct  374  SATVEFFEDKDTIYPPTVNDDRMYEHVKKVAGDLVGPTNFKVVPPMMGAEDFSFYSELIP  433

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E         HSP+F ++ED  P GAA  A++A RY+ E
Sbjct  434  AAFFYIGIRNETLGSYHTG-HSPHFMIDEDVLPIGAATHAAIAERYLYE  481



>ref|XP_004149796.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Cucumis 
sativus]
Length=472

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPD V IGGTFRAFS     Q+ +RIE+VIV QA+V RC
Sbjct  302  NPLDSQVVSVTSFNGGSNLDMIPDVVVIGGTFRAFSNSSFYQVLQRIEQVIVEQASVYRC  361

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+F E E    PPT+ND+ +++H +KVA DL GS   +  +P+M  +DF+FY E +P
Sbjct  362  SAMVDFFEKEYTIYPPTVNDKAMYEHVKKVAIDLHGSQNFRIVQPMMGAEDFSFYSEYVP  421

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E         HSPYF ++E+  P GAA  A++A RY+ E
Sbjct  422  AAFFYIGVRNETLGSIHTG-HSPYFMIDENVLPIGAATHATIAERYLYE  469



>ref|XP_010104509.1| IAA-amino acid hydrolase ILR1-like 6 [Morus notabilis]
 gb|EXC01110.1| IAA-amino acid hydrolase ILR1-like 6 [Morus notabilis]
Length=478

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 112/171 (65%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   + IP +V IGGTFRAFS     QL +RIEEVIV QA V RC
Sbjct  308  NPLDSQVVSVTTFNGGSNLDEIPHTVVIGGTFRAFSNTSFYQLLQRIEEVIVKQARVYRC  367

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            +A V+F E E    PPT+ND  +++H +KVA DL+G +  +   P+M  +DF+F+ EV+P
Sbjct  368  SAEVDFFEKEYTIYPPTVNDEKMYEHVRKVAVDLVGPANFRVVPPMMGAEDFSFFSEVVP  427

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
               + +G+++E         HSP+F ++ED  P GAA  A+++ RY+ ERQ
Sbjct  428  AAFFYIGVRNETLGSIHTG-HSPHFMIDEDVLPVGAATHATISERYLNERQ  477



>ref|XP_007044502.1| Peptidase M20/M25/M40 family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY00334.1| Peptidase M20/M25/M40 family protein, putative isoform 2 [Theobroma 
cacao]
Length=255

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 108/168 (64%), Gaps = 2/168 (1%)
 Frame = -2

Query  738  DPLDSQVV-TVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQR  562
            DPLDS+VV +V    GG AFNVIPDS TI GTFRAFS++    LR R+EEVI  QAAV R
Sbjct  81   DPLDSKVVVSVAMIHGGTAFNVIPDSTTIAGTFRAFSKKSFNALRDRVEEVIKAQAAVHR  140

Query  561  CNATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVM  382
            C+A ++F   E P+IPPT+ND  +H+H  +++ +++G    K     M  +DFAFY + +
Sbjct  141  CSAKIDFSGKEHPTIPPTVNDEKVHEHVMRLSREIVGEENTKLAPTFMGSEDFAFYLDKV  200

Query  381  PGYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            PG    LG+ +E         HSPY+ ++ED FP GAA+ A+ A  ++
Sbjct  201  PGSFLLLGINNEKTGAIH-PPHSPYYTIDEDVFPIGAAIHAAFAHSFL  247



>ref|XP_002520216.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF42271.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=454

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DP DSQVV+V    GG AFNVIPDS TI GT+RAFS++    LR+RIEE+I GQAAV RC
Sbjct  279  DPFDSQVVSVAMINGGTAFNVIPDSATIAGTYRAFSKKSFNALRERIEEIIKGQAAVHRC  338

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            ++ ++F     P++PPTIND ++++H Q+V+ D++G   ++     M  +DFAFY E +P
Sbjct  339  SSEIDFTGKGSPTLPPTINDAEIYEHAQRVSIDVVGVKNIEVAPTFMGSEDFAFYLEKVP  398

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYI  238
            G    LG+++E         HSPYF ++E+ FP GAAL A  A  Y+
Sbjct  399  GSFSFLGIRNEKL-GYIHPPHSPYFMIDENVFPIGAALYAGFAHSYL  444



>gb|KHN35503.1| IAA-amino acid hydrolase ILR1-like 6, partial [Glycine soja]
Length=388

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            +PLDSQVV+V  F GG   ++IPD+V + GTFRAFS     QL +RIE+VIV Q +V RC
Sbjct  219  NPLDSQVVSVTSFNGGNKLDMIPDTVVLLGTFRAFSNTSFYQLLERIEQVIVEQTSVYRC  278

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
             A V+F E E    PPT+ND  +++H +KV+ DLLG    +   P+M  +DF+FY E++P
Sbjct  279  LAEVDFFEKEYTIYPPTVNDDRMYEHVKKVSIDLLGHKNFRVVPPMMGAEDFSFYSEMVP  338

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILE  232
               + +G+++E     + + HSPYF ++ED  P GAA  AS+A RY++E
Sbjct  339  SAFFYIGVRNETLGS-THTGHSPYFMIDEDVLPIGAAAHASIAERYLIE  386



>ref|XP_007217993.1| hypothetical protein PRUPE_ppa005643mg [Prunus persica]
 gb|EMJ19192.1| hypothetical protein PRUPE_ppa005643mg [Prunus persica]
Length=408

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 109/171 (64%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG+ +LR+R++EVI  QA V RC
Sbjct  234  DPLHSQVLSVTYVRGGSASNVIPSHVEFGGTLRSLTTEGLWKLRRRLKEVIESQAVVHRC  293

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+  + E P +P   ND  LH H ++V    LG   VK  + LMAG+DFAFYQE++P
Sbjct  294  NAYVDMKDEEFPPLPAVFNDESLHLHVKRVGELTLGPENVKVCEKLMAGEDFAFYQELIP  353

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G ++ +G+++E       S HSPYF ++ED  P G AL  +L   Y+  RQ
Sbjct  354  GVMFSIGIRNEEVGS-VYSPHSPYFFLDEDVLPIGVALHVALVEIYLESRQ  403



>ref|XP_008234625.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Prunus mume]
Length=434

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 110/171 (64%), Gaps = 1/171 (1%)
 Frame = -2

Query  738  DPLDSQVVTVGHFRGGGAFNVIPDSVTIGGTFRAFSREGMVQLRKRIEEVIVGQAAVQRC  559
            DPL SQV++V + RGG A NVIP  V  GGT R+ + EG+ +LR+R++EVI  QA V RC
Sbjct  260  DPLHSQVLSVTYVRGGSASNVIPSHVEFGGTLRSLTTEGLWKLRRRLKEVIESQAVVHRC  319

Query  558  NATVNFLESEKPSIPPTINDRDLHQHFQKVAGDLLGSSRVKDHKPLMAGDDFAFYQEVMP  379
            NA V+  + E P +P   ND  LH H ++V   +LG   V   + LMAG+DFAFYQEV+P
Sbjct  320  NAYVDMKDEEFPPLPAVFNDESLHLHVKRVGELMLGPENVMACEKLMAGEDFAFYQEVIP  379

Query  378  GYIYGLGLKDEAADDKSASEHSPYFKVNEDAFPYGAALQASLAARYILERQ  226
            G ++ +G+++E         HSPYF ++ED  P GAAL A+LA  Y+   Q
Sbjct  380  GVMFSIGIRNEEVGSVHFP-HSPYFFLDEDVLPIGAALHAALAEIYLDSHQ  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515