BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015E07

Length=804
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     328   1e-107   Nicotiana sylvestris
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     328   3e-107   Solanum tuberosum [potatoes]
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     327   7e-107   Nicotiana tomentosiformis
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     323   2e-105   Solanum lycopersicum
emb|CDP21061.1|  unnamed protein product                                320   3e-104   Coffea canephora [robusta coffee]
emb|CDO96753.1|  unnamed protein product                                306   9e-99    Coffea canephora [robusta coffee]
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          305   1e-98    Vitis vinifera
emb|CDO96754.1|  unnamed protein product                                301   7e-97    Coffea canephora [robusta coffee]
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     294   7e-94    Nicotiana sylvestris
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    291   4e-93    Solanum lycopersicum
emb|CBI30663.3|  unnamed protein product                                307   9e-93    Vitis vinifera
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     291   9e-93    Eucalyptus grandis [rose gum]
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     291   1e-92    Nicotiana tomentosiformis
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     290   2e-92    Solanum tuberosum [potatoes]
gb|KCW45467.1|  hypothetical protein EUGRSUZ_L00816                     290   2e-92    Eucalyptus grandis [rose gum]
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     285   2e-90    Nelumbo nucifera [Indian lotus]
gb|KJB62810.1|  hypothetical protein B456_009G437600                    284   3e-90    Gossypium raimondii
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             283   5e-90    
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    295   5e-90    
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    280   5e-89    Tarenaya hassleriana [spider flower]
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    280   1e-88    Tarenaya hassleriana [spider flower]
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     280   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890    290   7e-88    
emb|CDO96752.1|  unnamed protein product                                278   8e-88    Coffea canephora [robusta coffee]
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                     278   1e-87    Eucalyptus grandis [rose gum]
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     277   1e-87    Prunus mume [ume]
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     277   1e-87    Nicotiana sylvestris
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    290   2e-87    
ref|XP_010057069.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     276   6e-87    Eucalyptus grandis [rose gum]
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     276   7e-87    Phoenix dactylifera
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252    290   8e-87    
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          276   9e-87    Glycine max [soybeans]
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     275   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     272   2e-86    
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     274   2e-86    Fragaria vesca subsp. vesca
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    274   4e-86    Elaeis guineensis
ref|XP_003593737.1|  GDSL esterase/lipase                               273   4e-86    Medicago truncatula
emb|CDX94634.1|  BnaC07g10240D                                          274   5e-86    
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     273   7e-86    Brassica rapa
emb|CDY15655.1|  BnaA07g08260D                                          272   2e-85    Brassica napus [oilseed rape]
ref|XP_008358656.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     265   3e-85    
emb|CDO96750.1|  unnamed protein product                                271   3e-85    Coffea canephora [robusta coffee]
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                    271   4e-85    Arabis alpina [alpine rockcress]
gb|AFK42362.1|  unknown                                                 271   5e-85    Medicago truncatula
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg             271   5e-85    
ref|XP_007020867.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    264   1e-84    
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     269   3e-84    Nicotiana tomentosiformis
ref|NP_174182.1|  GDSL esterase/lipase                                  269   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     268   4e-84    
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          268   8e-84    Solanum lycopersicum
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     268   8e-84    Phoenix dactylifera
dbj|BAD95190.1|  hypothetical protein                                   268   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031122.1|  GDSL esterase/lipase                               268   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     268   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_973932.1|  GDSL esterase/lipase                                  267   1e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65183.1|  lipase, putative                                        267   2e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KHN08454.1|  GDSL esterase/lipase                                    275   2e-83    Glycine soja [wild soybean]
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     267   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     266   5e-83    Elaeis guineensis
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     265   7e-83    Phoenix dactylifera
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    265   1e-82    
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    265   1e-82    Elaeis guineensis
ref|XP_010540491.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    262   2e-82    Tarenaya hassleriana [spider flower]
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     264   2e-82    Cicer arietinum [garbanzo]
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     264   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     264   4e-82    
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    263   5e-82    Solanum lycopersicum
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     263   6e-82    
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     262   8e-82    
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 263   1e-81    Arabidopsis lyrata subsp. lyrata
emb|CDY30822.1|  BnaC05g21980D                                          263   1e-81    Brassica napus [oilseed rape]
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     262   1e-81    
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    262   1e-81    Camelina sativa [gold-of-pleasure]
gb|EEE55084.1|  hypothetical protein OsJ_02825                          257   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|NP_174181.1|  GDSL esterase/lipase                                  262   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174179.3|  GDSL esterase/lipase                                  261   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280          261   4e-81    Amborella trichopoda
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     261   4e-81    
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    261   5e-81    
ref|XP_007025435.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    259   5e-81    
ref|NP_973931.1|  GDSL esterase/lipase                                  258   8e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001172483.1|  Os01g0649400                                       257   9e-81    
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     260   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645    273   1e-80    
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     259   1e-80    Camelina sativa [gold-of-pleasure]
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg                259   1e-80    Erythranthe guttata [common monkey flower]
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     259   1e-80    Elaeis guineensis
emb|CDY30819.1|  BnaC05g21950D                                          259   2e-80    Brassica napus [oilseed rape]
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     261   2e-80    
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          259   2e-80    Camelina sativa [gold-of-pleasure]
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    259   2e-80    
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    259   2e-80    Camelina sativa [gold-of-pleasure]
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             259   2e-80    
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    259   3e-80    Brassica rapa
ref|XP_002893538.1|  predicted protein                                  269   4e-80    
gb|AAG60153.1|AC074360_18  lipase, putative                             258   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          258   4e-80    Sorghum bicolor [broomcorn]
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     258   5e-80    Brassica rapa
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    258   5e-80    Elaeis guineensis
gb|AAF24548.2|AC007508_11  F1K23.17                                     268   6e-80    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174440.2|  GDSL esterase/lipase                                  258   7e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     258   7e-80    
ref|NP_174180.1|  GDSL esterase/lipase                                  258   8e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925    268   9e-80    
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     256   1e-79    
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     257   1e-79    Camelina sativa [gold-of-pleasure]
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                    272   1e-79    Arabis alpina [alpine rockcress]
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     256   2e-79    Phoenix dactylifera
ref|NP_001042396.1|  Os01g0215700                                       256   2e-79    
gb|AFW80395.1|  esterase                                                256   2e-79    
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     256   2e-79    Phoenix dactylifera
dbj|BAA94228.1|  putative esterase                                      256   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EEE54111.1|  hypothetical protein OsJ_00875                          256   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     256   2e-79    Phoenix dactylifera
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     256   3e-79    Brachypodium distachyon [annual false brome]
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     258   3e-79    
ref|NP_001149156.1|  esterase precursor                                 255   3e-79    
gb|AAL86351.1|  putative lipase                                         251   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             256   5e-79    
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     255   6e-79    Populus euphratica
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    255   7e-79    Camelina sativa [gold-of-pleasure]
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     254   9e-79    Setaria italica
emb|CDO99485.1|  unnamed protein product                                254   2e-78    Coffea canephora [robusta coffee]
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    264   2e-78    
gb|KJB63193.1|  hypothetical protein B456_009G437100                    254   3e-78    Gossypium raimondii
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g             253   3e-78    Phaseolus vulgaris [French bean]
dbj|BAD44668.1|  putative lipase                                        253   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180304.1|  GDSL esterase/lipase                                  253   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     253   5e-78    Camelina sativa [gold-of-pleasure]
emb|CDM83549.1|  unnamed protein product                                253   5e-78    Triticum aestivum [Canadian hard winter wheat]
gb|EAY75182.1|  hypothetical protein OsI_03072                          250   7e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970          252   1e-77    
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    251   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    251   2e-77    
ref|XP_007020872.1|  SGNH hydrolase-type esterase superfamily pro...    250   2e-77    
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     251   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580          252   2e-77    
ref|NP_001241470.1|  uncharacterized protein LOC100816865               251   2e-77    Glycine max [soybeans]
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     251   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     250   5e-77    
gb|KCW76151.1|  hypothetical protein EUGRSUZ_D00528                     246   5e-77    Eucalyptus grandis [rose gum]
ref|XP_002879083.1|  predicted protein                                  250   6e-77    
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg             259   6e-77    
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like     250   6e-77    Glycine max [soybeans]
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     251   6e-77    Camelina sativa [gold-of-pleasure]
gb|EMT27195.1|  GDSL esterase/lipase                                    250   9e-77    
ref|NP_973930.1|  GDSL esterase/lipase                                  247   9e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     249   9e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001149094.1|  LOC100282715 precursor                             249   1e-76    Zea mays [maize]
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     249   2e-76    Camelina sativa [gold-of-pleasure]
emb|CDO96755.1|  unnamed protein product                                248   2e-76    Coffea canephora [robusta coffee]
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             248   3e-76    Eutrema salsugineum [saltwater cress]
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             248   3e-76    
ref|XP_010911731.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     243   3e-76    Elaeis guineensis
dbj|BAJ86481.1|  predicted protein                                      248   3e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592    258   4e-76    
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     247   5e-76    Eucalyptus grandis [rose gum]
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910          247   7e-76    Nicotiana sylvestris
gb|EMT22154.1|  GDSL esterase/lipase                                    247   7e-76    
ref|NP_001130974.1|  uncharacterized protein LOC100192079               248   8e-76    Zea mays [maize]
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   1e-75    Oryza brachyantha
gb|KHG23842.1|  hypothetical protein F383_29871                         246   2e-75    Gossypium arboreum [tree cotton]
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    246   2e-75    Camelina sativa [gold-of-pleasure]
emb|CDX90163.1|  BnaA08g18210D                                          246   2e-75    
emb|CDM83548.1|  unnamed protein product                                247   3e-75    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     245   3e-75    Eucalyptus grandis [rose gum]
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          245   3e-75    Prunus mume [ume]
dbj|BAK06933.1|  predicted protein                                      246   3e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN49290.1|  hypothetical protein Csa_6G519430                       244   3e-75    
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   3e-75    Eucalyptus grandis [rose gum]
emb|CDY43309.1|  BnaC03g58810D                                          246   3e-75    Brassica napus [oilseed rape]
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3       245   4e-75    
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     246   5e-75    Setaria italica
ref|XP_010232088.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    245   6e-75    
ref|XP_006646093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     244   7e-75    
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650          244   8e-75    
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    254   8e-75    
dbj|BAJ93079.1|  predicted protein                                      246   9e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569457.2|  PREDICTED: GDSL esterase/lipase At1g28600-li...    245   1e-74    
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     243   1e-74    Populus euphratica
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670          244   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     244   2e-74    Camelina sativa [gold-of-pleasure]
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     244   2e-74    Cucumis melo [Oriental melon]
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     244   2e-74    Brassica rapa
gb|KDO77812.1|  hypothetical protein CISIN_1g018031mg                   240   2e-74    Citrus sinensis [apfelsine]
dbj|BAJ98364.1|  predicted protein                                      243   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     243   3e-74    Glycine max [soybeans]
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g             243   3e-74    Phaseolus vulgaris [French bean]
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     242   4e-74    Citrus sinensis [apfelsine]
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     243   4e-74    Eucalyptus grandis [rose gum]
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             241   6e-74    Citrus clementina [clementine]
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     242   6e-74    Eucalyptus grandis [rose gum]
emb|CDY64716.1|  BnaCnng44670D                                          242   6e-74    Brassica napus [oilseed rape]
gb|KHN08453.1|  GDSL esterase/lipase                                    239   9e-74    Glycine soja [wild soybean]
ref|XP_003593740.1|  GDSL esterase/lipase                               242   9e-74    Medicago truncatula
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     242   1e-73    Cucumis melo [Oriental melon]
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    241   1e-73    Nicotiana tomentosiformis
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     242   1e-73    Cucumis sativus [cucumbers]
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   241   1e-73    Citrus sinensis [apfelsine]
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     240   1e-73    Eucalyptus grandis [rose gum]
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    242   1e-73    Sesamum indicum [beniseed]
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     241   2e-73    
gb|KJB62806.1|  hypothetical protein B456_009G437200                    241   2e-73    Gossypium raimondii
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     241   2e-73    Brachypodium distachyon [annual false brome]
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     240   2e-73    
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     240   2e-73    Eucalyptus grandis [rose gum]
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     241   2e-73    Camelina sativa [gold-of-pleasure]
gb|EEC71081.1|  hypothetical protein OsI_02841                          241   2e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     241   3e-73    Brachypodium distachyon [annual false brome]
ref|XP_006644441.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     236   3e-73    
emb|CDO96749.1|  unnamed protein product                                241   3e-73    Coffea canephora [robusta coffee]
emb|CDY63998.1|  BnaA07g36520D                                          241   3e-73    Brassica napus [oilseed rape]
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200          249   3e-73    
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             240   3e-73    Phaseolus vulgaris [French bean]
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          241   4e-73    Oryza sativa Japonica Group [Japonica rice]
dbj|BAF02148.1|  putative lipase                                        239   4e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174186.1|  GDSL esterase/lipase                                  240   5e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     240   5e-73    Cicer arietinum [garbanzo]
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...    240   5e-73    Brassica napus [oilseed rape]
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     239   6e-73    Glycine max [soybeans]
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    239   6e-73    Camelina sativa [gold-of-pleasure]
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     239   6e-73    Brassica rapa
ref|NP_001140937.1|  hypothetical protein                               241   7e-73    Zea mays [maize]
gb|AAX62802.1|  lipase 2                                                239   7e-73    Brassica napus [oilseed rape]
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          241   7e-73    Sorghum bicolor [broomcorn]
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     238   9e-73    Eucalyptus grandis [rose gum]
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     239   1e-72    Eucalyptus grandis [rose gum]
tpg|DAA58330.1|  TPA: hypothetical protein ZEAMMB73_195608              234   1e-72    
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     238   2e-72    Nelumbo nucifera [Indian lotus]
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     238   2e-72    Eucalyptus grandis [rose gum]
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     239   2e-72    Oryza brachyantha
ref|XP_003593736.1|  GDSL esterase/lipase                               238   3e-72    Medicago truncatula
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                     238   3e-72    
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    238   3e-72    Camelina sativa [gold-of-pleasure]
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910          237   3e-72    Solanum lycopersicum
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     237   4e-72    
gb|EEE55085.1|  hypothetical protein OsJ_02827                          238   5e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     238   5e-72    Tarenaya hassleriana [spider flower]
gb|ACL53525.1|  unknown                                                 239   5e-72    Zea mays [maize]
gb|ACN28025.1|  unknown                                                 238   6e-72    Zea mays [maize]
ref|XP_008654982.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1         238   6e-72    
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     237   6e-72    
ref|NP_174185.2|  GDSL esterase/lipase                                  237   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438721.1|  hypothetical protein SORBIDRAFT_10g025020          232   1e-71    
ref|NP_174188.1|  lipase ARAB-1                                         236   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     236   1e-71    Cicer arietinum [garbanzo]
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     236   1e-71    Camelina sativa [gold-of-pleasure]
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   236   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043721.1|  Os01g0649900                                       236   2e-71    
gb|KJB57433.1|  hypothetical protein B456_009G164000                    235   3e-71    Gossypium raimondii
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    236   3e-71    Brassica rapa
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    235   3e-71    
emb|CDP21060.1|  unnamed protein product                                230   3e-71    Coffea canephora [robusta coffee]
ref|XP_003593742.1|  GDSL esterase/lipase                               235   3e-71    Medicago truncatula
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    235   4e-71    Camelina sativa [gold-of-pleasure]
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    235   4e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009608032.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    233   5e-71    
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880          234   5e-71    
ref|XP_004971993.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     234   6e-71    Setaria italica
gb|KJB62807.1|  hypothetical protein B456_009G437300                    235   7e-71    Gossypium raimondii
emb|CDX90162.1|  BnaA08g18220D                                          234   8e-71    
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         234   1e-70    
dbj|BAJ86410.1|  predicted protein                                      234   1e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97312.1|  predicted protein                                      234   2e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY43308.1|  BnaC03g58800D                                          234   2e-70    Brassica napus [oilseed rape]
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910          232   3e-70    Fragaria vesca subsp. vesca
gb|KDP21068.1|  hypothetical protein JCGZ_21539                         232   3e-70    Jatropha curcas
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     232   4e-70    Eucalyptus grandis [rose gum]
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     232   4e-70    Eucalyptus grandis [rose gum]
ref|XP_006415634.1|  hypothetical protein EUTSA_v10009717mg             232   5e-70    
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     233   5e-70    Oryza brachyantha
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          231   6e-70    Vitis vinifera
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     231   1e-69    
gb|KHG11244.1|  hypothetical protein F383_11796                         229   1e-69    Gossypium arboreum [tree cotton]
emb|CDX94632.1|  BnaC07g10260D                                          231   2e-69    
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    230   2e-69    
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     230   2e-69    Elaeis guineensis
gb|KGN49292.1|  hypothetical protein Csa_6G519450                       229   2e-69    
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    231   2e-69    
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    230   3e-69    
ref|XP_008675274.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    231   3e-69    
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     229   4e-69    
tpg|DAA58335.1|  TPA: hypothetical protein ZEAMMB73_102185              231   5e-69    
ref|XP_008675273.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    230   7e-69    
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    229   7e-69    
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940          229   8e-69    
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     228   1e-68    
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320          228   1e-68    
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     228   2e-68    
ref|XP_002893540.1|  predicted protein                                  241   2e-68    
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     228   2e-68    
emb|CDY15658.1|  BnaA07g08290D                                          228   2e-68    
ref|NP_199403.1|  GDSL esterase/lipase                                  228   2e-68    
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    226   3e-68    
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     227   3e-68    
dbj|BAJ90990.1|  predicted protein                                      228   3e-68    
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    227   5e-68    
ref|XP_002317430.2|  hypothetical protein POPTR_0011s07610g             221   5e-68    
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     226   5e-68    
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein         226   5e-68    
gb|EAY75181.1|  hypothetical protein OsI_03071                          227   6e-68    
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    226   7e-68    
emb|CDM83418.1|  unnamed protein product                                227   8e-68    
gb|AAX59709.1|  lipase 1                                                226   1e-67    
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     226   1e-67    
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     225   1e-67    
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    226   1e-67    
ref|XP_009383158.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     225   1e-67    
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          226   2e-67    
ref|NP_001057786.1|  Os06g0531900                                       226   2e-67    
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein                225   2e-67    
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     226   2e-67    
ref|XP_010231604.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     224   3e-67    
gb|EAY75193.1|  hypothetical protein OsI_03085                          225   3e-67    
ref|XP_004969325.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     225   4e-67    
ref|XP_002456053.1|  hypothetical protein SORBIDRAFT_03g029590          225   4e-67    
emb|CDY15657.1|  BnaA07g08280D                                          224   5e-67    
gb|KHG30334.1|  hypothetical protein F383_10781                         224   5e-67    
gb|KJB66737.1|  hypothetical protein B456_010G156100                    223   6e-67    
gb|EAZ01210.1|  hypothetical protein OsI_23235                          224   6e-67    
gb|KJB66736.1|  hypothetical protein B456_010G156100                    223   6e-67    
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     224   6e-67    
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     224   8e-67    
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     223   9e-67    
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     223   9e-67    
gb|KJB66739.1|  hypothetical protein B456_010G156100                    223   1e-66    
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     224   1e-66    
gb|AAF24544.2|AC007508_7  F1K23.13                                      236   1e-66    
dbj|BAB89203.1|  lipase-like                                            223   1e-66    
gb|EEE55083.1|  hypothetical protein OsJ_02823                          224   2e-66    
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          223   2e-66    
ref|XP_010316801.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    221   2e-66    
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910          223   2e-66    
gb|EMT19408.1|  GDSL esterase/lipase                                    220   4e-66    
ref|NP_001150078.1|  esterase                                           222   4e-66    
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     221   4e-66    
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     223   4e-66    
ref|XP_010316802.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    219   5e-66    
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     221   6e-66    
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          222   6e-66    
ref|XP_006646152.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     221   8e-66    
gb|EMT22799.1|  GDSL esterase/lipase                                    223   1e-65    
gb|EPS71267.1|  hypothetical protein M569_03493                         221   1e-65    
gb|ACG38031.1|  alpha-L-fucosidase 2 precursor                          221   1e-65    
ref|NP_001141565.1|  uncharacterized protein LOC100273681               221   1e-65    
dbj|BAD68794.1|  lipase-like                                            220   2e-65    
ref|XP_006844515.1|  hypothetical protein AMTR_s00016p00147040          215   2e-65    
emb|CDX94633.1|  BnaC07g10250D                                          220   2e-65    
gb|ACF85857.1|  unknown                                                 220   2e-65    
ref|NP_001054913.1|  Os05g0210100                                       219   4e-65    
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570          219   4e-65    
ref|XP_008812182.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     217   5e-65    
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     219   5e-65    
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910          218   9e-65    
emb|CDM80951.1|  unnamed protein product                                213   1e-64    
gb|KJB66738.1|  hypothetical protein B456_010G156100                    217   2e-64    
gb|EAY96951.1|  hypothetical protein OsI_18870                          217   2e-64    
gb|AAS91011.1|  putative lipase                                         217   2e-64    
ref|NP_001054912.2|  Os05g0209600                                       217   3e-64    
ref|NP_001042399.1|  Os01g0216400                                       217   3e-64    
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     216   4e-64    
ref|XP_003593744.1|  GDSL esterase/lipase                               216   4e-64    
ref|XP_008783973.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     216   4e-64    
gb|KJB62808.1|  hypothetical protein B456_009G437400                    216   4e-64    
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     216   4e-64    
gb|EEE59101.1|  hypothetical protein OsJ_10956                          216   5e-64    
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100          216   5e-64    
dbj|BAJ97605.1|  predicted protein                                      216   5e-64    
ref|NP_001050175.1|  Os03g0365800                                       216   6e-64    
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     216   7e-64    
ref|XP_006655809.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     214   8e-64    
ref|XP_006655093.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     215   1e-63    
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     215   1e-63    
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    215   1e-63    
dbj|BAJ92568.1|  predicted protein                                      215   1e-63    
ref|XP_008675276.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     215   2e-63    
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     215   2e-63    
ref|XP_004958488.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     216   2e-63    
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     214   2e-63    
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     214   4e-63    
gb|EAZ11035.1|  hypothetical protein OsJ_00879                          214   5e-63    
ref|XP_002456055.1|  hypothetical protein SORBIDRAFT_03g029610          213   5e-63    
ref|NP_001176564.1|  Os11g0521000                                       213   8e-63    
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     213   8e-63    
gb|ABL11233.1|  UCW116, putative lipase                                 213   8e-63    
gb|EMT32479.1|  GDSL esterase/lipase                                    211   8e-63    
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          214   9e-63    
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     213   1e-62    
dbj|BAJ90380.1|  predicted protein                                      213   1e-62    
ref|XP_004971499.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     213   1e-62    
gb|EMT08653.1|  GDSL esterase/lipase                                    214   1e-62    
tpg|DAA58326.1|  TPA: hypothetical protein ZEAMMB73_004372              209   1e-62    
dbj|BAK01308.1|  predicted protein                                      213   1e-62    
ref|XP_004960620.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     213   1e-62    
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    212   1e-62    
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    212   2e-62    
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    213   2e-62    
gb|EAY90131.1|  hypothetical protein OsI_11697                          213   2e-62    
ref|XP_009382515.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     212   2e-62    
ref|XP_008673015.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2         210   2e-62    
ref|XP_006651409.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     211   3e-62    
emb|CDY48195.1|  BnaA04g15590D                                          212   3e-62    
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     211   5e-62    
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136    219   5e-62    
ref|XP_010918534.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    211   7e-62    
ref|NP_564314.1|  GDSL esterase/lipase                                  211   7e-62    
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    211   8e-62    
ref|XP_008675275.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     210   8e-62    
dbj|BAK05475.1|  predicted protein                                      211   1e-61    
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...    209   2e-61    
ref|XP_004959853.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     210   2e-61    
ref|XP_010929733.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     209   2e-61    
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                     209   2e-61    
ref|XP_008791125.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     209   2e-61    
ref|NP_001056858.1|  Os06g0157000                                       208   2e-61    
dbj|BAD69424.1|  putative lipase                                        208   2e-61    
ref|XP_010918533.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    211   3e-61    
dbj|BAK05815.1|  predicted protein                                      209   3e-61    
emb|CDX77066.1|  BnaC04g38610D                                          210   3e-61    
ref|XP_010918532.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    211   3e-61    
ref|NP_001043727.1|  Os01g0650900                                       209   4e-61    
ref|XP_009409411.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     208   4e-61    
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     208   7e-61    
ref|XP_007020868.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    201   7e-61    
gb|EEE65121.1|  hypothetical protein OsJ_20187                          207   9e-61    
ref|XP_004971762.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     207   9e-61    
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650          208   1e-60    
ref|XP_003577537.1|  PREDICTED: acetylajmalan esterase                  207   1e-60    
ref|XP_004963464.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     207   2e-60    
ref|NP_001172233.1|  Os01g0216900                                       207   2e-60    
gb|ACF87885.1|  unknown                                                 207   2e-60    
ref|NP_849723.1|  GDSL esterase/lipase                                  207   2e-60    
ref|XP_004980345.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     207   2e-60    
dbj|BAJ90120.1|  predicted protein                                      207   2e-60    
ref|NP_001149411.1|  esterase precursor                                 207   2e-60    
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1                 206   3e-60    
ref|XP_004979339.1|  PREDICTED: acetylajmalan esterase-like             206   4e-60    
ref|XP_004491864.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     206   4e-60    
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    206   5e-60    
ref|XP_009397450.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     205   5e-60    
gb|EMT15617.1|  GDSL esterase/lipase                                    206   5e-60    
dbj|BAK06902.1|  predicted protein                                      206   5e-60    
gb|ACF83155.1|  unknown                                                 206   6e-60    
ref|NP_001151215.1|  LOC100284848 precursor                             206   6e-60    
ref|XP_006663479.1|  PREDICTED: acetylajmalan esterase-like             206   6e-60    
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor     206   6e-60    
dbj|BAK01569.1|  predicted protein                                      205   7e-60    
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     206   8e-60    
ref|XP_009409412.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     205   8e-60    
ref|NP_001168581.1|  hypothetical protein precursor                     205   9e-60    
gb|EMT23216.1|  GDSL esterase/lipase                                    206   9e-60    
ref|XP_004964800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     205   1e-59    
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          205   1e-59    
ref|XP_002450809.1|  hypothetical protein SORBIDRAFT_05g018910          205   1e-59    
ref|XP_009414901.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     204   1e-59    
gb|KEH34273.1|  GDSL-like lipase/acylhydrolase                          205   2e-59    
gb|KHN31271.1|  GDSL esterase/lipase                                    204   2e-59    
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                    204   2e-59    
tpg|DAA58339.1|  TPA: hypothetical protein ZEAMMB73_636863              199   2e-59    
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     204   2e-59    
gb|EAZ18532.1|  hypothetical protein OsJ_34061                          204   3e-59    
gb|EAY81107.1|  hypothetical protein OsI_36286                          203   3e-59    
ref|XP_008673524.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     203   3e-59    
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    204   4e-59    
gb|EAZ27028.1|  hypothetical protein OsJ_10957                          204   4e-59    
ref|XP_002457140.1|  hypothetical protein SORBIDRAFT_03g001880          203   5e-59    
ref|XP_002439450.1|  hypothetical protein SORBIDRAFT_09g006590          203   6e-59    
ref|XP_003566944.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     202   7e-59    
gb|EEE54108.1|  hypothetical protein OsJ_00868                          202   7e-59    
ref|XP_002457134.1|  hypothetical protein SORBIDRAFT_03g001820          203   7e-59    
ref|XP_009383572.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     202   7e-59    
ref|XP_003564307.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     202   8e-59    
ref|NP_001042391.1|  Os01g0214800                                       202   8e-59    
ref|XP_006643906.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     202   9e-59    
ref|XP_009380501.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     202   9e-59    
ref|XP_002454932.1|  hypothetical protein SORBIDRAFT_03g001650          202   9e-59    
dbj|BAK05007.1|  predicted protein                                      202   1e-58    
ref|XP_004963669.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     202   2e-58    
ref|XP_009390675.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     203   2e-58    
emb|CDP09073.1|  unnamed protein product                                201   2e-58    
gb|EMT23758.1|  GDSL esterase/lipase                                    202   2e-58    
ref|XP_007138118.1|  hypothetical protein PHAVU_009G181700g             201   3e-58    
ref|XP_004971763.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     201   4e-58    
gb|KHN18921.1|  GDSL esterase/lipase                                    196   4e-58    
ref|XP_003566943.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     201   4e-58    
ref|NP_001168439.1|  uncharacterized protein LOC100382211               199   4e-58    
ref|NP_001152155.1|  esterase precursor                                 201   4e-58    
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     201   4e-58    
gb|EEC70166.1|  hypothetical protein OsI_00887                          201   5e-58    
gb|EAY90132.1|  hypothetical protein OsI_11698                          201   5e-58    
ref|XP_006286793.1|  hypothetical protein CARUB_v10003448mg             198   6e-58    
ref|XP_004961580.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    200   8e-58    
ref|XP_006643907.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     199   9e-58    
ref|XP_008364168.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     198   1e-57    
ref|XP_006603997.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     199   1e-57    
gb|ABK24921.1|  unknown                                                 200   1e-57    
ref|XP_010557579.1|  PREDICTED: GDSL esterase/lipase At5g03980          199   2e-57    
gb|EMT30303.1|  GDSL esterase/lipase                                    199   2e-57    
gb|AFW80390.1|  esterase                                                199   2e-57    
ref|XP_010241274.1|  PREDICTED: acetylajmalan esterase-like             199   2e-57    



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G EL+WFKQML   C +P+ C+E+L +S++LMGEIGGNDYN+ F QG  +EEV ++VP+V
Sbjct  140  GTELEWFKQMLPILCNSPTSCREFLGNSLVLMGEIGGNDYNHPFSQGRSREEVQTYVPEV  199

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I   I+ELI+ GAQ LIVPGNLPIGCS SYL+ F  SN  EYD +TGCINWLN+F E
Sbjct  200  VKAIGLAIHELIELGAQTLIVPGNLPIGCSASYLNTFENSNKDEYDAETGCINWLNNFAE  259

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN+LLQ+E++ +RELHP   IIYADYYNAAM++Y+SP  +GF +T+ ACCGGGGPYN +
Sbjct  260  YHNQLLQEEIHRIRELHPQANIIYADYYNAAMQIYQSPKKFGFTSTIVACCGGGGPYNYD  319

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              A CGS LS VC++PSS++SWDG+HLTEAAY+WI  GLL GP+T PKIN  C
Sbjct  320  SLASCGSPLSNVCNNPSSHVSWDGVHLTEAAYRWIAKGLLQGPYTIPKINELC  372



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 181/230 (79%), Gaps = 0/230 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+WFKQML   C +P+ CKE+LE+S+ LMGEIGGNDYN+ F QG   E+V SFVP V
Sbjct  143  GTQLEWFKQMLPILCDSPTSCKEFLENSLFLMGEIGGNDYNHPFSQGKSGEDVQSFVPAV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I   INELI+ GAQ LIVPGNLPIGCS SYL+ F  SN  EYD  TGCINWLNDF E
Sbjct  203  ISAIGLAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKEYDDSTGCINWLNDFAE  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN+LLQ+E++ LRE+HPH  IIYADYYNAAM++Y+SP  +GF +T+ ACCGGGGPYN +
Sbjct  263  YHNQLLQQEIHKLREIHPHANIIYADYYNAAMQIYKSPKKFGFTSTIVACCGGGGPYNYD  322

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
                CGS  S  CD+PSSY+SWDG+HLTEAAY+ I +GLL GP+T P++N
Sbjct  323  SKRPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAEGLLQGPYTIPQMN  372



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G EL+WFKQML   C +P+ C+E+L +S++LMGEIGGNDYN+ F QG P+EEV ++VP+V
Sbjct  141  GTELEWFKQMLPILCNSPTSCREFLGNSLVLMGEIGGNDYNHPFSQGKPREEVQTYVPEV  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I   I+ELI+ GAQ LIVPGNLPIGCS SYL+ F  SN +EYD +TGCINWLN+F E
Sbjct  201  VKAIGLAIHELIELGAQTLIVPGNLPIGCSASYLTNFKNSNKNEYDSETGCINWLNNFAE  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN+LLQ+E++ +RELHP   +IYADYYNAAM++Y+SP  +GF +T+ ACCGGGGPYN +
Sbjct  261  YHNQLLQEEIHRIRELHPQANVIYADYYNAAMQIYKSPKKFGFTSTIVACCGGGGPYNYD  320

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              A CGS LS VC++PSSY+SWDG+HLTEAAY+ I  GLL GP+  P++N  C
Sbjct  321  SLAICGSPLSNVCNNPSSYVSWDGVHLTEAAYRLIAKGLLQGPYAIPRMNELC  373



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+WFKQML   C +P+ CKEYLE+S+ LMGEIGGNDYN+ F QG   EEV SFVP V
Sbjct  140  GTQLEWFKQMLPILCDSPTSCKEYLENSLFLMGEIGGNDYNHPFSQGKSGEEVKSFVPAV  199

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I   INELI+ GAQ LIVPGNLPIGCS SYL+ F  SN  +YD  TGCI WLN+F E
Sbjct  200  ISAIGQAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKDYDNSTGCIIWLNEFAE  259

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN+LLQ+E++ LRE+HPH  IIYADYYNAAM++YRSP  +GF +T+ ACCGGGG YN +
Sbjct  260  YHNQLLQQEIHKLREIHPHANIIYADYYNAAMQIYRSPKKFGFTSTIVACCGGGGVYNYD  319

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             +  CGS  S  CD+PSSY+SWDG+HLTEAAY+ I  GLL GP+T P++N
Sbjct  320  SNRPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAKGLLQGPYTIPQMN  369



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 178/237 (75%), Gaps = 1/237 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK ++ SFC   S C+E+L +S++LMGEIGGNDYN+A +QG   +++ SFVP V
Sbjct  148  GTQLRWFKDVMPSFCSNSSDCREFLRTSLVLMGEIGGNDYNHALVQGIKIDQIKSFVPAV  207

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S I E+IK GA  LIVPGN PIGCS  YL+YF  SN  +YD  TGCINWLNDF++
Sbjct  208  ISEISSAIEEVIKLGAVTLIVPGNFPIGCSAVYLTYFQGSNQQDYDKATGCINWLNDFSK  267

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHN LLQKELN +R+LHPH  IIYADYYNAAMRLYRSPN YGF    L+ACCGGGGPYN 
Sbjct  268  YHNRLLQKELNRIRKLHPHATIIYADYYNAAMRLYRSPNKYGFRGGALKACCGGGGPYNY  327

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
            N    CG   +T CD PS Y+ WDG+HLTEAAYQ I  GLL GPF++P +N  C L+
Sbjct  328  NSSVECGYPPATSCDDPSLYVCWDGLHLTEAAYQLIAGGLLQGPFSTPPMNTICALA  384



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 177/234 (76%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK+ML+SFC+  S CKE LESS++LMGEIGGNDYN+A  QG   +EV SFVP V
Sbjct  160  GTQLGWFKEMLASFCKESSDCKELLESSLVLMGEIGGNDYNHALFQGLKIKEVESFVPLV  219

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S I ELI  GA+ L+VPGNLPIGCS SYL+YF +SN  +YD +TGCI WLN+F +
Sbjct  220  VQTISSAIQELIDLGAETLVVPGNLPIGCSSSYLTYFQSSNKHDYDMETGCIKWLNEFAK  279

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHN+LL  E+N +REL+PH  I+YADYYNAAM LYRSP  YGF+   L+ACCG GGPYN 
Sbjct  280  YHNKLLLTEINRIRELNPHALIVYADYYNAAMTLYRSPQKYGFKAGALKACCGAGGPYNY  339

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  A CG   +T CD PS Y++WDG+HLTEAAY++I   LL GP++  +IN  C
Sbjct  340  NASAPCGYPPATSCDDPSLYVAWDGLHLTEAAYRFIARRLLQGPYSGLRINRFC  393



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 170/235 (72%), Gaps = 1/235 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK  L S C T S C E   SS+ LMGEIGGNDY Y F QG   EE+ ++VP V
Sbjct  128  GIQLGWFKDKLLSLCPTFSNCNELFNSSLFLMGEIGGNDYGYPFFQGRSLEEIRTYVPPV  187

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  IAS I ELI+ GA  L+VPG LP GCS SYL+ F T N  +YDP TGC+NWLN+F E
Sbjct  188  IHAIASAITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIEDYDPVTGCLNWLNEFAE  247

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNS  207
            YHNE L+ ELN +REL+PHT IIYADYYNAAMR+YRSPN +GF+   L ACCGGGGPYN 
Sbjct  248  YHNEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTACCGGGGPYNY  307

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
            N    CG+  +T CD PS Y+SWDG+HLTEAAY+WI +GLL  P+T P +N  CI
Sbjct  308  NSSVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 168/234 (72%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
              EL WF  +    C     CK++L+SS++LMGEIGGNDYNY  LQG   EEV SFVP V
Sbjct  151  ATELGWFIDIFFYICHVIPDCKDFLQSSLVLMGEIGGNDYNYPLLQGRNIEEVQSFVPLV  210

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S I ELI+ GA  L+VPGN PIGCS SYL+Y+ +S   +YD  TGCI WLN+F +
Sbjct  211  VQTISSAIQELIELGAVTLVVPGNFPIGCSASYLTYYQSSKKQDYDTDTGCIKWLNNFAK  270

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNS  207
            YHN++LQ E+N +REL+PH  IIYADYYNAAMRLYR PN YGF+   L+ACCG GGPYN 
Sbjct  271  YHNQVLQSEINRIRELNPHATIIYADYYNAAMRLYRFPNKYGFKGEVLKACCGAGGPYNY  330

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    CG Q +  CD P  Y+SWDG+HLTEAAY+WI  GLL GPF++P IN  C
Sbjct  331  NSTVPCGYQPAASCDDPPLYVSWDGLHLTEAAYRWIARGLLEGPFSTPPINTVC  384



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score =   294 bits (752),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 170/238 (71%), Gaps = 2/238 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK+MLSS C+ PS CKE+L+ S+IL+GEIGGND+NY FL    KEEV S+VP V
Sbjct  143  GTQLSWFKEMLSSLCKFPSECKEFLQKSLILVGEIGGNDFNYGFLGNSTKEEVESYVPAV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI+ GA  L+VPG LPIGCS +YL+ F  SN   YDP+TGCINWLN F++
Sbjct  203  INTISSAIQELIELGASTLVVPGELPIGCSTAYLTKFTHSNKEHYDPKTGCINWLNHFSQ  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            ++NELLQKEL+ LRELHP   IIYADYYNAAM+ Y SP ++GF +  L+ACCG GGPYN 
Sbjct  263  HYNELLQKELHLLRELHPSVTIIYADYYNAAMQFYVSPTSHGFRKGALDACCGAGGPYNF  322

Query  206  NPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
               A CG      +C   S Y SWDGMH TEAAY+WI  GLL G FT P +   C  +
Sbjct  323  KFSAVCGDPPARNICSDTSQYASWDGMHFTEAAYKWIARGLLEGTFTFPPLAKICTFN  380



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 172/235 (73%), Gaps = 2/235 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++DWFK M++SFC+ PS C+E+L++S+ILMGEIGGND+NY FL    KEEV S+VP V
Sbjct  142  GTQMDWFKDMMTSFCKFPSECEEFLQNSLILMGEIGGNDFNYGFLGNSTKEEVESYVPAV  201

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S I ELI+ GA  L+VPG+LPIGCS +YL+ FM S+  +YDP+TGCINWLN F++
Sbjct  202  VKTISSAIQELIELGASTLLVPGDLPIGCSTAYLTKFMHSDKGQYDPKTGCINWLNKFSQ  261

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
             +NELLQKEL+ LR+L+P   IIYADYYNAAM+ Y SP ++GF +  L ACCG GGPYN 
Sbjct  262  QYNELLQKELHLLRDLNPAATIIYADYYNAAMQFYASPKSHGFRKGALVACCGAGGPYNF  321

Query  206  NPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               A CG      +C   S Y SWDGMH TEAAY+WI  GLL G FT P +   C
Sbjct  322  KFSALCGDPSARDICSDTSVYASWDGMHFTEAAYKWIATGLLQGTFTFPPVPKIC  376



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score =   307 bits (787),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 170/235 (72%), Gaps = 1/235 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK  L S C T S C E   SS+ LMGEIGGNDY Y F QG   EE+ ++VP V
Sbjct  128  GIQLGWFKDKLLSLCPTFSNCNELFNSSLFLMGEIGGNDYGYPFFQGRSLEEIRTYVPPV  187

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  IAS I ELI+ GA  L+VPG LP GCS SYL+ F T N  +YDP TGC+NWLN+F E
Sbjct  188  IHAIASAITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIEDYDPVTGCLNWLNEFAE  247

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNS  207
            YHNE L+ ELN +REL+PHT IIYADYYNAAMR+YRSPN +GF+   L ACCGGGGPYN 
Sbjct  248  YHNEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTACCGGGGPYNY  307

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
            N    CG+  +T CD PS Y+SWDG+HLTEAAY+WI +GLL  P+T P +N  CI
Sbjct  308  NSSVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362


 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 140/219 (64%), Gaps = 1/219 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  +   S+ L+GEIGGNDYNY F  G   ++V + VP V+ 
Sbjct  484  QLGWFKKLKPSICTTKKGCDNFFRKSIFLVGEIGGNDYNYPFFVGGSIKQVQALVPLVVE  543

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I    + LI+ GA  L+VPGN PIGCS  YL+ F + N ++YD   GC+   N F +YH
Sbjct  544  AITKAASMLIEEGAVTLMVPGNFPIGCSAVYLTIFRSPNKADYDENNGCLKAFNAFAQYH  603

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N  L+  L+ L   +PH +IIYADYYNAAM L+++P ++GF N  L ACCGGGGPYN N 
Sbjct  604  NTHLKLALDKLGLKYPHAKIIYADYYNAAMPLFQAPRSFGFYNGALRACCGGGGPYNFNN  663

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLL  84
             A CG   S  C+ PSSY +WDG+HLTE AY+ I   L+
Sbjct  664  SARCGHIGSKACNDPSSYANWDGIHLTEGAYKIIATCLI  702



>ref|XP_010057068.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Eucalyptus grandis]
 gb|KCW74054.1| hypothetical protein EUGRSUZ_E02674 [Eucalyptus grandis]
Length=402

 Score =   291 bits (745),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 169/234 (72%), Gaps = 2/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C T S CK++L +S++LMGEIGGNDYN+ F  G   EE+  FVP V
Sbjct  145  GVQLGLFKELLPSLCYTSSDCKDFLGNSLVLMGEIGGNDYNHPFFMGKDLEEIQDFVPLV  204

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I S I+ELI  GA  ++VPGN PIGC P+YL+ F +S+   YDP TGC+NWLN+F++
Sbjct  205  IEEIVSAISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQ  264

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNE LQ +L+HLRELHP T+IIY DYYNAA+R ++SPN +GFE     ACCGGGG +N 
Sbjct  265  YHNEQLQLKLDHLRELHPRTKIIYVDYYNAAIRFFQSPNKFGFEGQVFRACCGGGGTHNY  324

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  A C S  + VCD PSSY SWDG+H TEAAY+WI   +  GPFT PK++  C
Sbjct  325  NSSALCSSN-TKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGPFTVPKLDISC  377



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 171/235 (73%), Gaps = 2/235 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK+MLSS C+ PS CKE+L++S+IL+GEIGGND+NY FL    KEEV S+VP V
Sbjct  143  GTQLIWFKEMLSSLCKFPSECKEFLQNSLILVGEIGGNDFNYGFLGNSTKEEVESYVPAV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI+ GA  L+VPG+LPIGCS +YL+ FM S+   YDP+TGCINWLN F +
Sbjct  203  INTISSAIQELIELGASTLVVPGDLPIGCSTAYLTKFMHSDKENYDPKTGCINWLNHFAQ  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            ++NELLQKEL+ LR+LHP   IIYADYYNAAM+ Y SP ++GF +  L+ACCG GGPYN 
Sbjct  263  HYNELLQKELHLLRKLHPSATIIYADYYNAAMQFYVSPMSHGFTKGALDACCGAGGPYNF  322

Query  206  NPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               A CG      +C   S Y SWDGMH TEAAY+WI  GLL G FT P +   C
Sbjct  323  KFSAVCGDPPARNICSDTSLYASWDGMHFTEAAYKWIARGLLEGTFTFPPLAKIC  377



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 173/235 (74%), Gaps = 2/235 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +LDWFK M+SSFC+ PS CKE+L++S+ILMGEIGGND+NY FL    KEEV S+VP V
Sbjct  143  GTQLDWFKDMMSSFCKFPSECKEFLQNSLILMGEIGGNDFNYGFLGNSTKEEVESYVPAV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  ++S I ELI+ GA  L+VPG+LPIGCS +YL+ +M S+  +YDP+TGC+NWLN+F++
Sbjct  203  IKTLSSAIQELIELGASTLLVPGDLPIGCSTAYLTKYMHSDKGQYDPKTGCLNWLNNFSQ  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
             +NELLQKEL+ LR+L+P   IIYADYYNAAM+ Y SP ++GF +  L ACCG GGPYN 
Sbjct  263  QYNELLQKELHLLRDLYPAATIIYADYYNAAMQFYASPKSHGFRKGALVACCGAGGPYNF  322

Query  206  NPHAYCGSQLS-TVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
                 CG   +  +C   S Y SWDGMH TEAAY+WI  GLL G FT P +   C
Sbjct  323  MFSTICGDPAARNICSDTSVYASWDGMHFTEAAYKWIATGLLKGTFTFPPLPKIC  377



>gb|KCW45467.1| hypothetical protein EUGRSUZ_L00816 [Eucalyptus grandis]
Length=402

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 168/234 (72%), Gaps = 2/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C T S CKE+L +S++LMGEIGGNDYN+ F  G   EE+  FVP V
Sbjct  145  GVQLGLFKELLPSLCYTSSDCKEFLGNSLVLMGEIGGNDYNHPFFMGKDLEEIKDFVPLV  204

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I S I+ELI  GA  ++VPGN PIGC P+YL+ F +S+   YDP TGC+NWLN+F++
Sbjct  205  IEEIVSAISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQ  264

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNE LQ +L+HLRELHP T+IIY DYYNAA+R Y+SPN +GFE     ACCGGGG +N 
Sbjct  265  YHNEQLQLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNY  324

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  A C S  + VCD PSSY SWDG+H TEAAY+WI   +  G FT PK++  C
Sbjct  325  NSSALCSSN-TKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  377



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 171/248 (69%), Gaps = 2/248 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +  WFKQ+L S C   + C+E L  S++L GEIGGND+N+AF +G    ++   VP V
Sbjct  143  GIQFQWFKQVLPSLCDPSTNCRELLARSLVLAGEIGGNDFNHAFFEGKSFHDIRPLVPLV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  + ST+  LI+ GA  L+VPGNLPIGCS +YL+ F + N  +YDP+TGC+ WLN+F +
Sbjct  203  INAVTSTVQMLIEQGAVTLLVPGNLPIGCSAAYLTQFQSPNKDDYDPETGCLKWLNEFAQ  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNS  207
              N+ L KEL+ +REL+PH  IIYADYYNAAMR+YRSP+ YGF N  L ACCGGGGPYN 
Sbjct  263  KFNDHLVKELDGMRELYPHATIIYADYYNAAMRIYRSPSQYGFTNGALTACCGGGGPYNY  322

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            +  A CG   S  C+ PSSY+SWDG+HLTEAAY+ I +GL+ GP+  P I   C  S P+
Sbjct  323  DRTAMCGDAGSRTCEDPSSYVSWDGIHLTEAAYRLIAEGLIRGPYAVPSIKHSCA-SLPQ  381

Query  26   TKIPDS*R  3
                D+ R
Sbjct  382  IPFADTRR  389



>gb|KJB62810.1| hypothetical protein B456_009G437600 [Gossypium raimondii]
Length=391

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 172/243 (71%), Gaps = 1/243 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L +FK +L SFC + S CK++L+ S+I+MGEIGGNDYNYAFLQG    E++ FVP V
Sbjct  148  GVQLGYFKDVLPSFCSSSSDCKDFLKKSLIVMGEIGGNDYNYAFLQGKNTVEILHFVPVV  207

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  IAS I ELI  GA  ++VPGNLPIGCSP+YL+YF  S+ ++YDP TGCI WLN F+E
Sbjct  208  VDTIASAIAELIGLGAVTILVPGNLPIGCSPAYLTYFQGSDMADYDPLTGCITWLNQFSE  267

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            +HNE LQ++L+ +R+LH +  IIYADYYN AMR Y S N +GF  TL ACCGGGG YN +
Sbjct  268  FHNEQLQEKLDQVRKLHRNVNIIYADYYNTAMRFYHSLNQFGFTETLRACCGGGGRYNYS  327

Query  203  PHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                CG   L+T C+ PSS++SWDG+H TEA Y+WI  G+L   +  P  N  C  S   
Sbjct  328  SSMACGDLPLTTSCNDPSSHVSWDGLHYTEATYRWISKGVLEELYAIPYTNSLCFPSTVN  387

Query  26   TKI  18
             +I
Sbjct  388  KQI  390



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   283 bits (725),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFKQML S C T S C + L +S+ILMGEIGGNDYN A L G   E+V ++VP VI 
Sbjct  142  QLEWFKQMLPSLCNTSSDCNKVLSTSLILMGEIGGNDYNDALLAGKSIEKVQAYVPLVIE  201

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IASTINELI+ GA  L+VPGN PIGC P+YL+ + +S+ ++YDP TGC+NWLN F+ YH
Sbjct  202  TIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYH  261

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N+ LQ  L+ +R LHP   IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N 
Sbjct  262  NDQLQIALSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNA  321

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             A CG   ++ C++P+ +ISWDG+H TEAA++WI   +L G +T P+++  C
Sbjct  322  SALCGDAGASACENPAQFISWDGLHSTEAAHRWITKAILQGNYTVPRVSTLC  373



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G EL  FK++L S C + S CKE L  S+I+MGEIGGNDYNYAF +G   EE+  FVP V
Sbjct  177  GVELGLFKEVLPSLCSSSSDCKELLRESLIVMGEIGGNDYNYAFEEGKNPEEIREFVPLV  236

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S INELI+ GA   +VPGNLPIGCSP+YL+YF  S+  EYDP TGC+ WLN F+E
Sbjct  237  VHTISSAINELIELGAVTFLVPGNLPIGCSPAYLTYFQGSDKGEYDPLTGCLTWLNQFSE  296

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHNELLQ+EL+ +RELHPH  IIYADYYN AMR Y  P+ +GF  T+ ACCG G PYN +
Sbjct  297  YHNELLQQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGKGVPYNYS  356

Query  203  PHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG   L T CD PSSY+SWDG+H TEA Y+WI   +L   FT P IN  C+
Sbjct  357  SSMACGDPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  411


 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 164/233 (70%), Gaps = 3/233 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G EL +F+ +LSS C + S C++ L +S+I+MGEIGGNDYN+AF +G   EE    VP V
Sbjct  541  GVELGFFRDVLSSLCSSSSDCRKLLINSLIVMGEIGGNDYNFAFEEGKSNEETRELVPLV  600

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  IAS I+ELI+ GA   +VPGNLPIGC PSYL+ +  S+  EYDP TGC+ WLN F+E
Sbjct  601  IDTIASAIHELIELGAVTFLVPGNLPIGCLPSYLTNYQGSDEEEYDPLTGCLTWLNQFSE  660

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYN  210
            YHN+LLQ+EL  ++E+HPH  I YADYY+AA+R Y SP  +GF  E   +ACCGGGGPYN
Sbjct  661  YHNQLLQEELARIQEIHPHVNIFYADYYSAAIRFYLSPKQFGFRKETQRKACCGGGGPYN  720

Query  209  SNPHAYCGSQLST-VCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             N  A CG  L T  CD PSSY+SWDG+H TEAA + +   +L G  T+  I+
Sbjct  721  FNLSAVCGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAILDGLHTNFPIS  773



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 164/245 (67%), Gaps = 2/245 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+ FK++L S C  PS C E+L  S+ILMGEIGGNDYNY F  G   +E+   VP V
Sbjct  116  GVQLNIFKEILPSLCSPPSDCSEFLSRSLILMGEIGGNDYNYPFFAGKNVDEIREMVPLV  175

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I VI+S I EL+  G +  +VPGN PIGCS +YL+ + T N  +YDP TGC+ WLN+F E
Sbjct  176  INVISSAIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKYDPLTGCLKWLNEFAE  235

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            +HNE LQ ELN LR+L+PH  I+YADYYN  +RL++ P  +GF N  L  CCG GGPYN 
Sbjct  236  HHNERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNY  295

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            +P   CG  +   CD+PS Y++WDG HLTE AY+WI  GLL GP+  P  N  C  S+ +
Sbjct  296  SPSRLCGDGV-PYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCFDSKLQ  354

Query  26   TKIPD  12
               PD
Sbjct  355  NSSPD  359



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 164/245 (67%), Gaps = 2/245 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+ FK++L S C  PS C E+L  S+ILMGEIGGNDYNY F  G   +E+   VP V
Sbjct  143  GVQLNIFKEILPSLCSPPSDCSEFLSRSLILMGEIGGNDYNYPFFAGKNVDEIREMVPLV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I VI+S I EL+  G +  +VPGN PIGCS +YL+ + T N  +YDP TGC+ WLN+F E
Sbjct  203  INVISSAIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKYDPLTGCLKWLNEFAE  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            +HNE LQ ELN LR+L+PH  I+YADYYN  +RL++ P  +GF N  L  CCG GGPYN 
Sbjct  263  HHNERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNY  322

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            +P   CG  +   CD+PS Y++WDG HLTE AY+WI  GLL GP+  P  N  C  S+ +
Sbjct  323  SPSRLCGDGV-PYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCFDSKLQ  381

Query  26   TKIPD  12
               PD
Sbjct  382  NSSPD  386



>ref|XP_009347996.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Pyrus x bretschneideri]
Length=376

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 165/235 (70%), Gaps = 1/235 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++DWFK++L  FC   S C E+L  S+ILMGEIGGNDYN A L G   E+V  +VP V
Sbjct  139  GIQMDWFKEILPYFCNISSNCSEFLSGSLILMGEIGGNDYNDALLGGKSIEQVQEYVPLV  198

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I  +INELI+ GA  L+VPGN+PIGC P YL+ +  S+ S+YDP TGC+NWLN F E
Sbjct  199  IEEIGLSINELIELGAATLLVPGNVPIGCLPIYLTNYEGSDKSDYDPSTGCLNWLNKFVE  258

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            Y+NE LQ ELN +R LHPH  IIYADYYNA M LY SP  +GF   T +ACCGGGG YN 
Sbjct  259  YYNEQLQTELNRIRSLHPHVNIIYADYYNAMMYLYHSPEQFGFIGGTPKACCGGGGTYNY  318

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
            N  A CG + ++ C +P  +ISWDG+H TEAAY+WI + LL G +T P I+  C+
Sbjct  319  NSSAQCGMRQASACQNPEEFISWDGIHFTEAAYKWITNALLKGNYTDPCISSLCV  373



>ref|XP_010040115.1| PREDICTED: uncharacterized protein LOC104428890 [Eucalyptus grandis]
Length=814

 Score =   290 bits (741),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 168/234 (72%), Gaps = 2/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C T S CKE+L +S++LMGEIGGNDYN+ F  G   EE+  FVP V
Sbjct  557  GVQLGLFKELLPSLCYTSSDCKEFLGNSLVLMGEIGGNDYNHPFFMGKDLEEIKDFVPLV  616

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I S I+ELI  GA  ++VPGN PIGC P+YL+ F +S+   YDP TGC+NWLN+F++
Sbjct  617  IEEIVSAISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQ  676

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNE LQ +L+HLRELHP T+IIY DYYNAA+R Y+SPN +GFE     ACCGGGG +N 
Sbjct  677  YHNEQLQLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNY  736

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  A C S  + VCD PSSY SWDG+H TEAAY+WI   +  G FT PK++  C
Sbjct  737  NSSALCSSN-TKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  789


 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C T S CK++L +S++LMGEIGGNDYNY F  G   EE+   VP V
Sbjct  152  GVQLGLFKELLPSVCSTSSDCKQFLGNSLVLMGEIGGNDYNYHFFVGRDLEEIQGIVPLV  211

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I S I+ELI  GA +++VPGN PIGC P YL+ F  S+   YD  TGC+NWLN+F++
Sbjct  212  IEGIVSAISELIDLGAVMILVPGNFPIGCLPIYLTEFQGSDKEAYDSSTGCLNWLNEFSQ  271

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNE LQ++LNHLRELHP   IIY DYYNAA+R Y+SP+ +GF+   L ACCGG G YN 
Sbjct  272  YHNEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNY  331

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    C S  + VCD PSSY SWDG+H TEAAY+WI  G+  G FT PK++  C
Sbjct  332  NILEPCNSN-ARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 165/235 (70%), Gaps = 4/235 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWF+ +L S C T + C +YL+SS+ +MGEIGGNDYN+A LQG   EEV +FVP V+ 
Sbjct  138  QLDWFRDLLPSLCGTKANCMQYLQSSLTVMGEIGGNDYNHALLQGRSIEEVKTFVPAVVG  197

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNAS---EYDPQTGCINWLNDFT  387
             I+S I ++I+ GA   IVPGNLP+GC  +YL+YF  SN     +YD   GCINWLNDF 
Sbjct  198  AISSAITDMIRLGAANFIVPGNLPLGCLAAYLTYFQNSNRDYDYDYDEAPGCINWLNDFA  257

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYN  210
            ++HNE+LQ ELN +RELHPH  IIYADYYN+A+R YR P  +GF   TL ACCG GGPYN
Sbjct  258  KHHNEVLQIELNRIRELHPHVTIIYADYYNSAIRFYRWPKEFGFTGGTLSACCGAGGPYN  317

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             +    CG   +T C  PS+Y+ WDG+HLTEAA + IV GL  G +++P I   C
Sbjct  318  FDSSVGCGDPPTTGCADPSAYVCWDGLHLTEAANRLIVKGLFEGSYSAPPIKLIC  372



>gb|KCW45468.1| hypothetical protein EUGRSUZ_L00817 [Eucalyptus grandis]
Length=398

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C T S CK++L +S++LMGEIGGNDYNY F  G   EE+   VP V
Sbjct  152  GVQLGLFKELLPSVCSTSSDCKQFLGNSLVLMGEIGGNDYNYHFFVGRDLEEIQGIVPLV  211

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I S I+ELI  GA +++VPGN PIGC P YL+ F  S+   YD  TGC+NWLN+F++
Sbjct  212  IEGIVSAISELIDLGAVMILVPGNFPIGCLPIYLTEFQGSDKEAYDSSTGCLNWLNEFSQ  271

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNE LQ++LNHLRELHP   IIY DYYNAA+R Y+SP+ +GF+   L ACCGG G YN 
Sbjct  272  YHNEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNY  331

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    C S  + VCD PSSY SWDG+H TEAAY+WI  G+  G FT PK++  C
Sbjct  332  NILEPCNSN-ARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 167/233 (72%), Gaps = 1/233 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFKQML S C T   CK++L +S+ILMG IG NDYN   L G   E V S++P VI 
Sbjct  145  QLEWFKQMLPSLCNTSLDCKKFLSTSLILMGSIGCNDYNDGLLGGKSIELVRSYLPLVIE  204

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IASTINELI+ GA  ++VPGN PIGC PSYLS F +S+ S+YD  TGC+ WLN+F +YH
Sbjct  205  AIASTINELIELGAATILVPGNNPIGCLPSYLSKFESSDKSQYDASTGCLKWLNEFAQYH  264

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            NE LQ EL+ +R LHP   I+YADYYNA ++LY+SP  +GF   T +ACCGGGGPYN N 
Sbjct  265  NEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQSPRQFGFTGETSKACCGGGGPYNFNS  324

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
               CG+  +TVC++PS +I+WDGMH TEAAY+ +   LL G +T P++   C+
Sbjct  325  SVQCGNAGATVCENPSQFINWDGMHCTEAAYRLMTKALLQGNYTFPRLASLCV  377



>ref|XP_009774388.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana sylvestris]
Length=385

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 168/233 (72%), Gaps = 2/233 (1%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            ++LDWFKQML   C  PS C ++LESS+ L+GE GGNDY +A L G    E++  +P V+
Sbjct  142  DQLDWFKQMLPYLCHNPSGCSKFLESSLFLLGEFGGNDYTHALLSGKNINEILPIIPSVV  201

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              IAS  +EL++ GA+ ++VP  LP+GC+ SYL+Y+ + N  +YD + GC+ W N F  +
Sbjct  202  HTIASGAHELVELGAKTIMVPSVLPLGCASSYLTYYQSWNEEDYD-ELGCLIWPNHFASH  260

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSN  204
            HN+LLQ+EL+ LRE+HPH  IIYADYYNAAM+LYRSP+ YGF +  L  CCGGGGPYN N
Sbjct  261  HNQLLQRELHRLREIHPHVNIIYADYYNAAMQLYRSPSKYGFLKGGLVTCCGGGGPYNFN  320

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            P A CG   +T C+ P+ YI+WDG HLTEAAY+W+   LL GPFT+P IN  C
Sbjct  321  PFAPCGDYPATSCEDPNQYINWDGYHLTEAAYRWMTKSLLEGPFTNPPINSVC  373



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 173/232 (75%), Gaps = 1/232 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFKQML S C T S C + L +S+ILMGEIGGNDYN A L G   E+V ++VP VI 
Sbjct  650  QLEWFKQMLPSLCNTSSDCNKLLSTSLILMGEIGGNDYNNALLAGKSIEKVQAYVPLVIE  709

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IASTINELI+ GA  L+VPGN PIGC P+YL+ + +S+ ++YDP TGC+NWLN F+ YH
Sbjct  710  TIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYH  769

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N+ LQ EL+ +R LHP   IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N 
Sbjct  770  NDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNA  829

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             A CG   ++VC++P+ +ISWDG+H TEAAY+WI   +L G +T P+++  C
Sbjct  830  SALCGDAGASVCENPAQFISWDGLHSTEAAYRWITKAILQGNYTVPRVSTLC  881


 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 170/246 (69%), Gaps = 5/246 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFKQML S C T S  K+ L +S+ILMGEIGGNDYN   L G   E+V ++VP VI 
Sbjct  148  QLEWFKQMLPSLCNTSSDRKKLLSTSLILMGEIGGNDYNNPLLAGKSIEKVQAYVPLVIE  207

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IASTINELI+ GA  L+VPGN PIGC P+YL+ + +S+ ++YDP TGC+NWLN F+ YH
Sbjct  208  TIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYH  267

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N+ LQ EL+ +R LHP   IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N 
Sbjct  268  NDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNT  327

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQW----IVDGLLIGPFTSPKINGECILSR  33
             A CG   ++VC++P+ +ISWDG+H TEAAY +      D  L G    P +     +  
Sbjct  328  SALCGDAGASVCENPAQFISWDGLHSTEAAYSYAGAIFADACLKGLNGVPDVVECSFVQS  387

Query  32   PKTKIP  15
              T++P
Sbjct  388  SVTELP  393



>ref|XP_010057069.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Eucalyptus grandis]
 gb|KCW74053.1| hypothetical protein EUGRSUZ_E02673 [Eucalyptus grandis]
Length=400

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 163/234 (70%), Gaps = 2/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C T S CK++L +S++LMGEIGGNDYNY F  G   +E+   VP V
Sbjct  154  GVQLGLFKELLPSVCSTSSDCKQFLGNSLVLMGEIGGNDYNYHFFMGRDLKEIQGIVPLV  213

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I S I+ELI  GA  ++VPGN PIGC P YL+ F  S+   YD  TGC+NWLN+F++
Sbjct  214  IEEIVSAISELIDLGAVTILVPGNFPIGCLPIYLTEFQGSDMEAYDSSTGCLNWLNEFSQ  273

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNE LQ++LNHLRELHP   IIY DYYNAA+R Y+SP+ +GF+   L ACCGG G YN 
Sbjct  274  YHNEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNY  333

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    C S  + VCD PSSY SWDG+H TEAAY+WI  G+  G FT PK++  C
Sbjct  334  NILEPCNSN-ARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  386



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score =   276 bits (705),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 162/238 (68%), Gaps = 0/238 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
              ++ WFK++L S C + S C+ +   S++LMGEIGGNDYN+ F Q    +E+ ++VP V
Sbjct  150  ATQIQWFKKLLPSLCSSKSDCESFFSKSLVLMGEIGGNDYNHPFAQLKAIDEIRTYVPSV  209

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            + + +  IN LI+ GA+ L+VPG  P+GC  +YL+   +    +YDPQTGCI WLN+F+E
Sbjct  210  VNITSWAINSLIELGAKTLVVPGIFPLGCVSAYLTVHQSGRREDYDPQTGCIKWLNEFSE  269

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN LLQ EL+ LR LHP   IIYA+YY+AAM +YR P  YGF+  L ACCGGGGPYN N
Sbjct  270  YHNSLLQTELDRLRRLHPRITIIYANYYDAAMDIYRHPLKYGFDAPLAACCGGGGPYNFN  329

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRP  30
              A CG++  TVC  PS ++ WDGMHLT+AAY+ I  GLL G + S  I   C+L  P
Sbjct  330  LTAMCGAREDTVCSDPSKHVCWDGMHLTDAAYEIIARGLLQGSYASAPITQACLLLEP  387



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score =   290 bits (741),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 173/229 (76%), Gaps = 7/229 (3%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWF++MLS  C T S C + L SS++LMGEIGGNDYN A L G   E+V  +VP VI 
Sbjct  135  QLDWFQEMLSFLCNTSSDCNKLLSSSLVLMGEIGGNDYNNALLGGKSIEKVEKYVPLVIE  194

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IASTINELI +GA  L+VPGN PIGC P+YL     +N SEYDP TGC+NWLN F+EYH
Sbjct  195  AIASTINELIAFGASTLVVPGNFPIGCIPAYL-----TNESEYDPLTGCLNWLNKFSEYH  249

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            NELLQ+EL+ +R LHP+  IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N 
Sbjct  250  NELLQRELSRIRILHPYVNIIYADYYNAMLQLYQSPDQFGFTGETTKACCGGGGPYNYNS  309

Query  200  HAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CGS + + +C++P+ +ISWDG+H TEAAY+WI  GLL G +T P+I
Sbjct  310  SALCGSPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQI  358


 Score =   281 bits (719),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 167/234 (71%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWF++MLS  C T S C + L  S++LMGEIGGNDY  A   G   E+V  +VP VI 
Sbjct  595  QLDWFQEMLSLLCNTSSDCNKLLSGSLVLMGEIGGNDYYNALFSGKSTEQVEKYVPFVIE  654

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IAS INELI  GA  L+VPG  P GC P++L+ + TS+  EYDP TGC+NWLN FTEYH
Sbjct  655  AIASAINELIALGASTLLVPGVFPFGCVPAFLTRYQTSDEDEYDPSTGCLNWLNKFTEYH  714

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            NELLQ EL  ++ LHPH  IIYADYYNA + L++SP+ +GF   T +ACCGGGGPYN N 
Sbjct  715  NELLQIELRRIQSLHPHVNIIYADYYNAMLELHQSPDQFGFTGETTKACCGGGGPYNYNS  774

Query  200  HAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
             A CG+ + + +C++P+ +ISWDG+H TEAAY+WI  GLL   +T P+I+  C+
Sbjct  775  SALCGTPEANVLCENPAQFISWDGLHSTEAAYRWIAKGLLNRNYTVPQISALCV  828


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -2

Query  245  LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF-T  69
            L ACCGGG PYN N  A CG   ST C  PSSY++WDG+HLTEAAY++I  GL+ G    
Sbjct  365  LRACCGGGEPYNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHGFIGG  424

Query  68   SPKI  57
            +PK+
Sbjct  425  TPKV  428



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +LDWFK++L S C + S CK+ + SS+ ++GEIGGNDY Y   +     ++++++P+V
Sbjct  149  GVQLDWFKELLPSLCNSSSSCKKVIGSSLFIVGEIGGNDYGYPLSETTAFGDLVTYIPQV  208

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+VI S I ELI  GA   +VPG+LP+GC+P+YL+ F T +  EYD Q GC+ WLN F E
Sbjct  209  ISVITSAIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYD-QAGCLKWLNTFYE  267

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHNELLQ E+N LR L+P T IIYADY+NAA+  Y SP  +GF  N L+ CCGGGGPYN 
Sbjct  268  YHNELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNY  327

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECIL  39
            N  A CG      CD PS Y+SWDG HLTEAAY+W+  GLL GP+T PK N  C +
Sbjct  328  NETAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCFI  383



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 160/231 (69%), Gaps = 3/231 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +++ FKQ+LSS     S  KE L SS+ILMGEIGGNDYN+ F QG   +EV +FVP VI 
Sbjct  141  QIESFKQLLSSLS---SDTKEVLNSSLILMGEIGGNDYNHPFFQGINADEVRTFVPSVIG  197

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S IN+LI+ G + L+VPGN PIGC P+YL  F + N  +YD QTGCI WLN+F+EYH
Sbjct  198  AISSAINDLIELGVKTLLVPGNFPIGCIPAYLDVFQSKNVEDYDSQTGCIKWLNEFSEYH  257

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N LLQ EL+ LR+LHPH  IIYA+YY+A +  +R+P  +GF+  L ACCG  GPY  N  
Sbjct  258  NRLLQDELDRLRKLHPHVTIIYANYYDATISFFRAPQLFGFKAPLHACCGSDGPYGVNRF  317

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG + +TVC  PSS ISWDG+HLTEAAY+ I   LL GP   P I   C
Sbjct  318  VQCGHKDATVCSDPSSSISWDGIHLTEAAYETIARSLLEGPHAKPPITRAC  368



>ref|XP_006361073.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Solanum tuberosum]
Length=310

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 164/223 (74%), Gaps = 1/223 (0%)
 Frame = -2

Query  683  CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILI  504
            CKE+L++S+IL+GEIGGND+ Y F   + KE+V S+VP VI  I+S I E+I++GA  ++
Sbjct  85   CKEFLQNSLILVGEIGGNDFIYGFFGNNTKEKVESYVPAVINSISSAIQEVIEFGASRVV  144

Query  503  VPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHT  324
            VPG++P+GCS + L+ FM SN  +YDP TGC+ W N+F  YHNELLQKEL+ LRELHPH 
Sbjct  145  VPGSMPLGCSTALLTIFMDSNKEDYDPITGCLIWPNEFASYHNELLQKELHRLRELHPHV  204

Query  323  RIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSY  147
             IIYADYYNA+M+LYR+P  YGF +  L ACCGGGGPYN N  A CG+  +T C+ P+ Y
Sbjct  205  NIIYADYYNASMKLYRAPRKYGFLKGVLIACCGGGGPYNFNISAQCGTSQATSCEDPNQY  264

Query  146  ISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKI  18
            ++WDG H TEAAY+W+   LL GPFT P +   C+    + +I
Sbjct  265  VNWDGYHFTEAAYRWMTKSLLEGPFTYPPMKNLCLFDVIEAQI  307



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 165/231 (71%), Gaps = 1/231 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WFK++L S C T S C + L SS++L+GEIG NDYN A L G   E+V ++VP V
Sbjct  146  GTQLHWFKELLPSLCNTSSNCNKLLSSSLVLVGEIGSNDYNDALLAGKNIEQVQTYVPLV  205

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S INELI+ GA  L+VPGN PIGC P YL+ F TS+  +Y+  TGC+NWLN F E
Sbjct  206  ITEISSAINELIELGAVTLVVPGNFPIGCLPIYLTKFQTSDKGQYNSSTGCLNWLNKFAE  265

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHN+ LQ EL+ ++ LHP+  IIYADYYNA M  Y SP+ +GF   T++ACCGGGGPYN 
Sbjct  266  YHNDQLQIELSRIQRLHPNINIIYADYYNAVMHFYHSPDQFGFIGGTVKACCGGGGPYNY  325

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            N  A CGS  ++ C++P+ +I+WDG+H TEAAY+WIV  L  G +  P I+
Sbjct  326  NSSAQCGSIEASACENPAEFINWDGIHFTEAAYRWIVKVLFKGKYNVPGIS  376



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 166/234 (71%), Gaps = 3/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++WFKQ+L S C + S CK  L SS+ LMGEIGGNDYN+ F QG   +E+ +FVP +
Sbjct  141  GTQIEWFKQLLPSLCSSGSDCKGILSSSLFLMGEIGGNDYNHPFFQGKTVDEIRTFVPSI  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI WLN+F E
Sbjct  201  ISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAE  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHN LL  EL+HL++LHPH  IIYADYY A + ++RSP  +GF+   L ACCGGGGPYN 
Sbjct  261  YHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNI  320

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            +    CG + +TVC+ PS+Y+ WDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  321  S--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  372



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 169/236 (72%), Gaps = 2/236 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LD FK++L S C + S CK  L SS+ ++GEIGGNDY +   Q     +++++VP+V++
Sbjct  141  QLDGFKELLPSICNSTSSCKGVLHSSLFIVGEIGGNDYGFPLFQTSVFGDLITYVPRVVS  200

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
            VI S+I ELI  GA  ++VPG+LP+GC+P+YL+ F T +  EYD Q GC+ WLN F EYH
Sbjct  201  VITSSIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYD-QAGCLKWLNKFFEYH  259

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNP  201
            NELLQ EL+ LR L+P T IIYADY+NAA++LY+SP  YGF+ N  + CCGGGGPYN N 
Sbjct  260  NELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCCGGGGPYNYND  319

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
             A CG+     CD PS Y+SWDG HLTEAA++W+ + LL GP+T PK +  C+ S 
Sbjct  320  SALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSFSCLSSE  375



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 162/240 (68%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK +L + C +PS C++ +E+++ILMGE+GGND NYAF  G P EE+   VP V
Sbjct  145  GVQLQSFKGLLPNLCDSPSECRDMIENALILMGEVGGNDLNYAFFVGKPIEEIRELVPLV  204

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPGN P+GCS +YL+ + TSN  EYDP TGC+ WLN F E
Sbjct  205  ITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDPVTGCLKWLNKFAE  264

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            Y NE LQ EL+ LR+L+PH  IIYADYYNA  RL++ P  YGF N  L ACCG GG YN 
Sbjct  265  YFNEQLQAELDRLRKLYPHVNIIYADYYNALARLFQEPAKYGFMNRPLPACCGFGGQYNY  324

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
             P   CG +    C  PS Y++WDG+H+TEAAY+ I +GLL GP+  P  N  C+ S  K
Sbjct  325  TPGKKCGFEGVDYCKDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCLSSEIK  384



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 162/240 (68%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK +L + C +PS C++ +E ++ILMGE+GGND NYAF  G P EE+   +P V
Sbjct  139  GVQLQSFKNLLPNLCDSPSECRDMIEDALILMGEVGGNDLNYAFFVGKPIEEIKELIPLV  198

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPGN P+GCS +YL+ + TSN  EYDP TGC+ WLN F E
Sbjct  199  ITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDPVTGCLKWLNKFAE  258

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            Y NE LQ EL+ LR+L+PH  IIYADYYNA  R+++ P  +GF N  L ACCG GG YN 
Sbjct  259  YFNEQLQAELDRLRKLYPHVNIIYADYYNALSRIFQEPAKFGFMNRPLPACCGLGGQYNY  318

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
             P   CG +    CD PS Y++WDG+H+TEAAY+ I +GLL GP+  P  N  C+ S  K
Sbjct  319  TPGKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCLSSELK  378



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 162/240 (68%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK +L + C +PS C++ +E ++ILMGE+GGND NYAF  G P EE+   +P V
Sbjct  139  GVQLQSFKGLLPNLCDSPSECRDMIEDALILMGEVGGNDLNYAFFVGKPIEEIKELIPLV  198

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPGN P+GCS +YL+ + TSN  EYDP TGC+ WLN F E
Sbjct  199  ITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNVEEYDPVTGCLKWLNKFAE  258

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            Y NE LQ EL+ LR+++PH  IIYADYYNA  R+++ P  +GF N  L ACCG GG YN 
Sbjct  259  YFNEQLQAELDRLRKMYPHVNIIYADYYNALSRIFQEPAKFGFMNRPLPACCGLGGQYNY  318

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
             P   CG +    CD PS Y++WDG+H+TEAAY+ I +GLL GP+  P  N  C+ S  K
Sbjct  319  TPGKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCLSSELK  378



>ref|XP_008358656.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Malus domestica]
Length=208

 Score =   265 bits (677),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = -2

Query  650  MGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSP  471
            MGEIGGNDYN A L+G   E+V  +VP VI  IAS+INELI +GA  L+VPGN PIGC P
Sbjct  1    MGEIGGNDYNNALLRGKSIEKVEKYVPLVIEAIASSINELIAFGASXLVVPGNFPIGCIP  60

Query  470  SYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAA  291
            +YL+ + TS+ SEYDP TGC+NWLN F+EYHNELLQ+EL+ +R LHPH  I YADYYNA 
Sbjct  61   AYLTTYETSDESEYDPSTGCLNWLNKFSEYHNELLQRELSRIRSLHPHVNIXYADYYNAM  120

Query  290  MRLYRSPNNYGFE-NTLEACCGGGGPYNSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTE  117
            ++LY+SP+ +GF   T +ACCGGGGPYN N  A CG+ + + +C++P+ +ISWDG+H TE
Sbjct  121  LQLYQSPDQFGFTGETTKACCGGGGPYNYNSSALCGTPEANVLCENPAQFISWDGVHSTE  180

Query  116  AAYQWIVDGLLIGPFTSPKINGECI  42
            AAY+WI  GLL G +T P+I+  C+
Sbjct  181  AAYRWIAKGLLNGNYTVPQISTLCV  205



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 156/221 (71%), Gaps = 3/221 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVP  570
            G +L WFK +L S C + S    +E+L+SS +LMGEIGG+DYN A L G   +EV  +VP
Sbjct  146  GTQLRWFKDILPSLCSSNSSDCSREFLQSSFVLMGEIGGDDYNAALLGGIKPDEVKPYVP  205

Query  569  KVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDF  390
             V+  IAS I ELIK GA  L+VPGN PIGC  SYL+YF +S+  +YD  TGCINWLND 
Sbjct  206  GVVREIASAIEELIKLGAVTLVVPGNFPIGCLASYLTYFQSSSQHDYDTDTGCINWLNDL  265

Query  389  TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPY  213
             +YHN LLQKELN +R+L PH  IIYADYYNAAMRLYRSPN YGF    L ACCG GGPY
Sbjct  266  AKYHNRLLQKELNRIRKLLPHATIIYADYYNAAMRLYRSPNKYGFRGEALRACCGTGGPY  325

Query  212  NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDG  90
            N N    CG   +T C  PS Y++WDG+HLTEAAYQ+   G
Sbjct  326  NCNTSIPCGYLPATPCKDPSLYVTWDGLHLTEAAYQFGSSG  366



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 166/240 (69%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ML   C +PS C++ + +++ILMGEIGGNDYNY F      EE+   VP V
Sbjct  140  GVQLQSFKEMLPKLCASPSDCRDMIGNALILMGEIGGNDYNYPFFGLQTIEEIKELVPLV  199

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            ++ I+S I EL++ G +  +VPG+ P+GCS +YL+ + TSN  EYDP TGC+ WLN+F+E
Sbjct  200  VSTISSAITELVEMGGRTFLVPGDFPLGCSVAYLTLYQTSNRVEYDPLTGCLTWLNEFSE  259

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHNE LQ EL+ LR L+PH  IIY DYYNA +R++  P  +G  N  L ACCG GGPYN 
Sbjct  260  YHNEHLQAELDKLRNLYPHVTIIYGDYYNALLRIFEDPAKFGLMNRPLPACCGLGGPYNF  319

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CG++ S  C  PS Y++WDG+HLTEAAY+WI +GLL GP+  P ++  CI S+ K
Sbjct  320  NFSIKCGTRGSEYCSDPSKYVNWDGVHLTEAAYRWISEGLLKGPYAIPHLDMSCISSKVK  379



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LD FK++L S C + S CK  L SS+ ++GEIGGNDY +   Q     +++++VP+V++
Sbjct  141  QLDGFKELLPSICNSTSSCKGVLHSSLFIVGEIGGNDYGFPLFQTSVFGDLITYVPRVVS  200

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
            VI S+I ELI  GA  ++VPG+LP+GC+P+YL+ F T +  EYD Q GC+ WLN F EY 
Sbjct  201  VITSSIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYD-QAGCLKWLNKFFEYR  259

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNP  201
            NELLQ EL+ LR L+P T IIYADY+NAA++LY+SP  YGF+ N  + CCGGGGPYN N 
Sbjct  260  NELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCCGGGGPYNYND  319

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
             A CG+     CD PS Y+SWDG HLTEAA++W+ + LL GP+T PK +  C+ S 
Sbjct  320  SALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSFSCLSSE  375



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 170/246 (69%), Gaps = 14/246 (6%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFKQML S C T   CK++L +S+ILMG IG NDYN   L G   E V S++P VI 
Sbjct  145  QLEWFKQMLPSLCNTSLDCKKFLSTSLILMGSIGCNDYNDGLLGGKSIELVRSYLPLVIE  204

Query  557  VIASTIN-------------ELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  417
             IASTIN             ELI+ GA  ++VPGN PIGC P+YLS F TS+ ++YDP T
Sbjct  205  AIASTINSFFLNFLWLHGLQELIELGAATILVPGNNPIGCLPAYLSKFETSDKNQYDPST  264

Query  416  GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLE  240
            GC+ WLN+F +YHNE LQ EL+ +R LHP   I+YADYYNA ++LY+SP+ +GF   T +
Sbjct  265  GCLKWLNEFAQYHNEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQSPHQFGFTGETSK  324

Query  239  ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  60
            ACCGGGGPYN NP   CG+  +TVC++PS +I+WDGMH TEAAY+ +   LL G +T P+
Sbjct  325  ACCGGGGPYNFNPSLQCGNAGATVCENPSQFINWDGMHSTEAAYRLMTKALLQGNYTFPR  384

Query  59   INGECI  42
            +   C+
Sbjct  385  LASLCV  390



>ref|XP_007020867.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY12392.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=215

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  650  MGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSP  471
            MGEIGGNDYNYAF +G   EE+  FVP V+  I+S INELI+ GA   +VPGNLPIGCSP
Sbjct  1    MGEIGGNDYNYAFEEGKNPEEIREFVPLVVHTISSAINELIELGAVTFLVPGNLPIGCSP  60

Query  470  SYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAA  291
            +YL+YF  S+  EYDP TGC+ WLN F+EYHNELLQ+EL+ +RELHPH  IIYADYYN A
Sbjct  61   AYLTYFQGSDKGEYDPLTGCLTWLNQFSEYHNELLQQELDQIRELHPHVNIIYADYYNIA  120

Query  290  MRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTEA  114
            MR Y  P+ +GF  T+ ACCG G PYN +    CG   L T CD PSSY+SWDG+H TEA
Sbjct  121  MRFYHFPDQFGFTKTIVACCGRGVPYNYSSSMACGDPPLRTSCDDPSSYVSWDGVHFTEA  180

Query  113  AYQWIVDGLLIGPFTSPKINGECI  42
             Y+WI   +L   FT P IN  C+
Sbjct  181  TYRWISKAVLKELFTIPYINSLCL  204



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 166/233 (71%), Gaps = 2/233 (1%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            ++LDWFKQML   C  PS C ++LE S+ L+GE GGNDY +A L G    E++  +P V+
Sbjct  145  DQLDWFKQMLPYLCHNPSGCSKFLERSLFLLGEFGGNDYTHALLSGKNINEILPIIPSVV  204

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I S  +EL++ GA+ ++VP  LP+GC+ SYL+Y+ + N  +YD + GC+ W N F  +
Sbjct  205  HTIVSGAHELVELGAKTIMVPSVLPLGCTSSYLTYYQSWNEEDYD-ELGCLIWPNHFATH  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSN  204
            HN+LLQ+EL+ LRE++PH  IIYADYYNAAM+LYR+P+ YGF +  L  CCG GGPYN N
Sbjct  264  HNQLLQRELHRLREINPHVNIIYADYYNAAMQLYRAPSKYGFLKGGLVTCCGAGGPYNFN  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            P A CG+  +T C+ P+ YI+WDG HLTEAAY+W+   LL GPFT+P IN  C
Sbjct  324  PFAQCGNYPATSCEDPNQYINWDGYHLTEAAYKWMTKSLLEGPFTNPPINSFC  376



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 162/242 (67%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F    P +EV   VP V
Sbjct  137  GVQLKSFKKSLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRKPVKEVEELVPFV  196

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+STI ELI  G +  +VPG  PIGCS  YL+ + TSN  EYDP TGC+ WLN F E
Sbjct  197  IASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGE  256

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH+E L+ ELN LR+L+PH  IIYADYYN+ +R+++ P  +GF E    ACCG GGPYN 
Sbjct  257  YHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNF  316

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CGS     C  PS Y+ WDG+H+TEAAY+WI DG+L GP+ +P  +  C+ S  K
Sbjct  317  NFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCLRSEIK  376

Query  26   TK  21
             +
Sbjct  377  KE  378



>ref|XP_009352806.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Pyrus x bretschneideri]
Length=373

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++DWFK MLS  C T S C+  L SS+I+MG IGGNDYN     G   E V ++VP VI 
Sbjct  138  QVDWFKGMLSPLCNTSSDCRNVLSSSLIVMGPIGGNDYNCPLFAGESFEIVETYVPFVIE  197

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +AS INELI++GA  L+VPGN PIGC+ +YL+ +  S+ SEYDP TGC+ WLN F+EYH
Sbjct  198  AMASAINELIQHGASTLLVPGNFPIGCTSAYLTLYEGSDESEYDPSTGCLTWLNKFSEYH  257

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            NELL+ +L+ +R LHPH  IIY D YNA ++LY+SP  +GF ENT  ACCGGGG YN N 
Sbjct  258  NELLKTKLSQIRSLHPHVNIIYGDVYNAELQLYQSPEQFGFTENTSRACCGGGGTYNYNL  317

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
             A CG + ++ C +P+  I+WDG H TEAA QWI   LL G +T P I+  C+
Sbjct  318  SAPCGLRGASACANPAKSINWDGRHTTEAANQWITKALLNGIYTIPHISTSCV  370



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 164/233 (70%), Gaps = 2/233 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L W K+MLSS C+ PS CKE+L++S+I +GEIGGND+ Y F   + KE+V S+VP VI 
Sbjct  143  QLGWLKEMLSSHCKFPSECKEFLKNSLIFVGEIGGNDFIYGFFGNNTKEKVESYVPAVIN  202

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I E+IK+GA  ++VPG++P+GCS + L+ FM SN  +YDP TGCINWLN F++ +
Sbjct  203  TISSVIKEVIKFGASRVVVPGSMPLGCSTALLTIFMDSNKEDYDPITGCINWLNQFSKNY  262

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N+LLQ EL+ +R+LHP   IIYAD+YNAAM+ Y SPN YGF +  L ACCG GGPYN   
Sbjct  263  NKLLQMELHLVRQLHPSVTIIYADHYNAAMQFYLSPNTYGFTKGALVACCGAGGPYNYKL  322

Query  200  HAYCGSQLS-TVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               CG   +  +C  PS Y SWDGMH TEAAY+ I   LL G FT P +   C
Sbjct  323  FELCGDPTARNICSDPSIYASWDGMHFTEAAYKLIATSLLEGNFTFPSLPKIC  375



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 162/234 (69%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G + +WFKQ+L S C T S CK  + +S+ L+GEIG ND++++F QG   +E+ +F+P +
Sbjct  154  GVQFNWFKQLLPSLCSTDSDCKGIMSNSLFLVGEIGWNDHSHSFEQGRTTDEIRTFIPNI  213

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            + VI+S I++LIK GA+  +VPG  P GC  +YL+ F + +A +YDP TGCI W+N+F+ 
Sbjct  214  VEVISSVIDDLIKLGAKTFVVPGIFPSGCVSTYLTAFQSEDAEDYDPDTGCIRWVNEFSA  273

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHN LLQ EL+ LR LHPH  IIYADYY A M ++ SP  +GF+   L+ACCGGGGPYN 
Sbjct  274  YHNHLLQNELDRLRRLHPHVTIIYADYYEALMSIFHSPQKFGFKKAPLDACCGGGGPYNV  333

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    CG+ ++TVC  PS ++ WDG HLT+AA + +  GLL GP+  P I   C
Sbjct  334  NFSLLCGAPMTTVCRDPSMFVFWDGTHLTDAASEIVARGLLEGPYADPPIIQTC  387



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 167/254 (66%), Gaps = 1/254 (0%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            E+ Y   H    G +L  FKQ L + C  PS C++ + +++ILMGEIG NDYN+ F Q  
Sbjct  130  EKGYHCPHNFSLGVQLKIFKQSLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFQLR  189

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP 
Sbjct  190  PLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPL  249

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
            TGC+ WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P+ YGF N  L
Sbjct  250  TGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHL  309

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P
Sbjct  310  SACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIP  369

Query  62   KINGECILSRPKTK  21
              +  C+ S  K K
Sbjct  370  PFDWSCLSSMIKKK  383



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 167/254 (66%), Gaps = 1/254 (0%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            E+ Y   H    G +L  FKQ L + C  PS C++ + +++ILMGEIG NDYN+ F Q  
Sbjct  130  EKGYHCPHNFSLGVQLKIFKQSLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFQLR  189

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP 
Sbjct  190  PLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPL  249

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
            TGC+ WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P+ YGF N  L
Sbjct  250  TGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHL  309

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P
Sbjct  310  SACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIP  369

Query  62   KINGECILSRPKTK  21
              +  C+ S  K K
Sbjct  370  PFDWSCLSSMIKKK  383



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 167/234 (71%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G+++ WF+Q+L S C + S C++ L  S++LMG IGGNDYN  F++G    E+ SFVP+V
Sbjct  161  GDQIHWFRQLLPSLCSSSSACEDMLHKSLVLMGAIGGNDYNDPFMEGRSLREIKSFVPRV  220

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            ++ I+S I+ELI+ GA+ L+VPG  P+GC+ +YL+Y+ T  A +YD  TGC+ WLN+F+ 
Sbjct  221  VSTISSAIDELIELGARTLLVPGITPLGCNSAYLTYYRTHQAEDYDSTTGCLKWLNEFSM  280

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHN  LQ EL  L++LHPH  IIYADYY A+M ++ +PN +GF E  L ACCGGGGPYN 
Sbjct  281  YHNGRLQAELRRLQQLHPHATIIYADYYGASMSIFSNPNAFGFGEEPLVACCGGGGPYNY  340

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    CGS+ STVC  PS Y+ WDG+H+TEA Y+ I  GLL GPF +P I   C
Sbjct  341  NFSRQCGSEGSTVCGDPSRYVHWDGLHMTEATYRSIASGLLHGPFAAPAIGSTC  394



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 170/248 (69%), Gaps = 3/248 (1%)
 Frame = -2

Query  758  HKCIS-GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVM  582
            H  IS G +L  FK+ L + C +P+ C++ + ++ I+MGEIGGND+N+AF   +   EV 
Sbjct  132  HSNISLGIQLKTFKESLPNLCGSPTDCRDMIGNAFIIMGEIGGNDFNFAFFV-NKTSEVK  190

Query  581  SFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINW  402
              VP VIT I+S I EL+  G +  +VPGN P+GCS +YL+ + TSN  EYDP TGC+ W
Sbjct  191  ELVPLVITKISSAIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEEYDPLTGCLTW  250

Query  401  LNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGG  225
            LNDF+EY+NE LQ ELN L +L+PH  IIY DY+NA +RLY+ P+ +GF +  L ACCG 
Sbjct  251  LNDFSEYYNEKLQAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFMDRPLPACCGL  310

Query  224  GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            GGPYN      CGS     C  PS Y++WDG+H+TEAAY+WI DGLL GP+T P  +  C
Sbjct  311  GGPYNFTLSKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLLKGPYTIPSFHWLC  370

Query  44   ILSRPKTK  21
            + S+ K+K
Sbjct  371  LGSKIKSK  378



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 161/240 (67%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F    P +EV   VP VI 
Sbjct  139  QLKSFKKSLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRKPVKEVEELVPFVIA  198

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+STI ELI  G +  +VPG  PIGCS  YL+ + TSN  EYDP TGC+ WLN F EYH
Sbjct  199  SISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPTTGCLKWLNKFGEYH  258

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            +E L+ ELN LR+L+PH  IIYADYYN+ +R+++ P  +GF +    ACCG GGPYN N 
Sbjct  259  SEKLKAELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMDRPFPACCGIGGPYNFNF  318

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CGS     C  PS Y+ WDG+H+TEAAY+WI DG+L GP+ +P  +  C+ S  K +
Sbjct  319  TRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCLRSEIKKE  378



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +LDWFK++L S C + S CK+ + SS+ ++GEIGGNDY Y   +     ++++++P+V
Sbjct  458  GVQLDWFKELLPSLCNSSSSCKKVIGSSLFIVGEIGGNDYGYPLSETTAFGDLVTYIPQV  517

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+VI S I ELI  GA   +VPG+LP+GC+P+YL+ F T +  EYD Q GC+ WLN F E
Sbjct  518  ISVITSAIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYD-QAGCLKWLNTFYE  576

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHNELLQ E+N LR L+P T IIYADY+NAA+  Y SP  +GF  N L+ CCGGGGPYN 
Sbjct  577  YHNELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNY  636

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECIL  39
            N  A CG      CD PS Y+SWDG HLTEAAY+W+  GLL GP+T PK N  C +
Sbjct  637  NETAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCFI  692


 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 157/237 (66%), Gaps = 6/237 (3%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L S C + + C E + +S+ LMGEIGGND+NY   Q     EV +FVP VI 
Sbjct  139  QLNWFKELLPSLCNSSADCHEVVGNSLFLMGEIGGNDFNYLLFQQRSIAEVKTFVPYVIK  198

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S +NELI  GA+ LIVPGN+P+GCS +YL+ + T + ++YD Q GC+ WLN F EY+
Sbjct  199  AITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQYD-QYGCLKWLNKFAEYY  257

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N+ LQ EL+ L+ LH H  IIYADYYNA + LYR P  +GF N L+ CCG GGPYN N  
Sbjct  258  NQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCGMGGPYNYNAS  316

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP----FTSPKINGECIL  39
            A CG      CD PS +I WDG+HLTEAAY+ I    L       F SP+ + +C+L
Sbjct  317  ADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQDSLTDTGNLYFISPRQSPDCLL  373



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 163/246 (66%), Gaps = 1/246 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F Q  P +EV   VP V
Sbjct  152  GVQLKSFKESLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFQRKPVKEVEELVPLV  211

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S + ELI  G +  +VPGN PIGCS  YL+ + TSN  EYDP TGC+ WLN+F E
Sbjct  212  INTISSAVTELIAMGGRTFLVPGNFPIGCSVIYLTLYQTSNKEEYDPLTGCLKWLNNFGE  271

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YH E L  ELN LR+L+PH  IIYADYYNA +RL++ P  +GF N    ACCG GGPYN 
Sbjct  272  YHEEQLHAELNRLRKLNPHVNIIYADYYNALLRLFQEPAKFGFGNRPFPACCGIGGPYNF  331

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            + +  CGS     C+ PS Y+ WDG+H+TEAAY+ I DG+L GP+  P  N  C+ S   
Sbjct  332  SLNRNCGSVGVKSCNDPSKYVGWDGIHMTEAAYKLIADGILQGPYAIPPFNWSCLNSETN  391

Query  26   TKIPDS  9
             K  D+
Sbjct  392  KKSLDT  397



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 161/238 (68%), Gaps = 3/238 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++WFKQ+L S C + S CK  L SS+ LMGEIGGNDYN+ F QG   +E+ +FVP V
Sbjct  141  GTQIEWFKQLLPSLCSSSSDCKGILSSSLFLMGEIGGNDYNHPFFQGRTVDEIRTFVPSV  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S IN LI+ GA+ ++VPGN PIGC   YL  F +    +YD +TGCI WLN+F E
Sbjct  201  ISAISSAINVLIQLGAKTMVVPGNFPIGCVSRYLQTFQSQRKEDYDSETGCIKWLNEFAE  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHN LL  EL+HLR+LHPH  IIYADYY A + ++R P  +GF E  L ACCG GGPYN 
Sbjct  261  YHNRLLVDELDHLRQLHPHVTIIYADYYEALLHIFRFPTQFGFKEPPLAACCGAGGPYNV  320

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
                 CG + +TVC+ PS Y+ WDG+HLTEAAY  I  GLL G + +P I   C   R
Sbjct  321  --FVACGDRAATVCNDPSKYVCWDGIHLTEAAYGTIAQGLLEGSYATPPITQACAHIR  376



>ref|XP_008777733.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Phoenix dactylifera]
Length=375

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 159/233 (68%), Gaps = 0/233 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++WFKQ+L S C   S C ++L +++ LMGEIGGNDYN  F+QG   EE+ ++VP V
Sbjct  141  GIQIEWFKQLLPSLCSLDSGCHDFLNNTLFLMGEIGGNDYNDPFIQGRTVEEITTYVPSV  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S+I  LI  GA+ L+VPGN PIGC P YL+ F  S+  +YDPQTGCINWLN F+E
Sbjct  201  ISAISSSIKVLIDLGAKTLVVPGNFPIGCVPLYLALFQNSSKGDYDPQTGCINWLNKFSE  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN LL  ELN LR+LHP   IIYA+YY A + + RSP  YG E T  ACCG  GP N  
Sbjct  261  YHNRLLMDELNKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVT  320

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
                CG   +TVC  PS YISWDG+HLTEAAY  I  GLL GP+ +P I   C
Sbjct  321  SPVLCGDPAATVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYATPPIARAC  373



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 159/231 (69%), Gaps = 2/231 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            + +WFKQ+L S C T S CK  + +S+ L+GEIG ND+ Y+F +G   +E+ +F+P +I 
Sbjct  156  QFNWFKQLLPSLCSTDSDCKGIISNSLFLVGEIGWNDHGYSFNEGRTADEIRTFIPNIIE  215

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
            VI+S I++LIK GA+ L+VPG  P GC P YL++  +    +YDP TGCI W+N+F+ YH
Sbjct  216  VISSVIDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYH  275

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N+LLQ EL+ +R LHPH  IIYADYY A M ++RSP  +GFE   +ACCGGGGP N    
Sbjct  276  NQLLQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFEKPFDACCGGGGPNNCAIQ  335

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG    TVC  PS Y+SWDG HLTEAAY+ I  GLL G +T+P ++  C
Sbjct  336  --CGDPGFTVCSDPSKYVSWDGSHLTEAAYRAIALGLLQGSYTTPSMSRAC  384



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 166/246 (67%), Gaps = 15/246 (6%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPS------------RCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            G +++WFKQ+L S C + S             CK  L SS+ LMGEIGGNDYN+ F QG 
Sbjct  141  GTQIEWFKQLLPSLCSSGSGYPFTHVMFTMVDCKGILSSSLFLMGEIGGNDYNHPFFQGK  200

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
              +E+ +FVP +I+ I+S IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD Q
Sbjct  201  TVDEIRTFVPSIISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQ  260

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
            TGCI WLN+F EYHN LL  EL+HL++LHPH  IIYADYY A + ++RSP  +GF+   L
Sbjct  261  TGCIKWLNEFAEYHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPL  320

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCGGGGPYN +    CG + +TVC+ PS+Y+ WDGMHLTEAAY+ I  GLL GP T+P
Sbjct  321  AACCGGGGPYNIS--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAP  378

Query  62   KINGEC  45
             I   C
Sbjct  379  PITQAC  384



>ref|XP_010540491.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X3 [Tarenaya 
hassleriana]
Length=321

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 151/226 (67%), Gaps = 2/226 (1%)
 Frame = -2

Query  683  CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILI  504
            C E+L  S+ILMGEIGGNDYNY F  G   +E+   VP VI VI+S I EL+  G +  +
Sbjct  91   CSEFLSRSLILMGEIGGNDYNYPFFAGKNVDEIREMVPLVINVISSAIRELVDMGGRTFL  150

Query  503  VPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHT  324
            VPGN PIGCS +YL+ + T N  +YDP TGC+ WLN+F E+HNE LQ ELN LR+L+PH 
Sbjct  151  VPGNFPIGCSAAYLTMYQTENMEKYDPLTGCLKWLNEFAEHHNERLQIELNRLRKLYPHV  210

Query  323  RIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSY  147
             I+YADYYN  +RL++ P  +GF N  L  CCG GGPYN +P   CG  +   CD+PS Y
Sbjct  211  NIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSPSRLCGDGVP-YCDNPSKY  269

Query  146  ISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKIPDS  9
            ++WDG HLTE AY+WI  GLL GP+  P  N  C  S+ +   PD 
Sbjct  270  VNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCFDSKLQNSSPDK  315



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 168/237 (71%), Gaps = 4/237 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            ++DWFK++L S C + S   CK+ L SS+ ++GEIGGNDY++   + +  E+++++VP+V
Sbjct  136  QIDWFKELLPSICNSSSTEGCKDVLHSSLFIVGEIGGNDYSFPLFETNAFEDLITYVPQV  195

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+VI S I +LI  GA  ++VPG+LP+GC+P+ L+ F T N  EYD Q GC+  LN F E
Sbjct  196  ISVITSAIKDLIDLGAVTILVPGSLPLGCNPALLTKFATINEEEYD-QAGCLKLLNMFFE  254

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            YHNELLQ ELN LR L+P T IIYADY+NAA++ Y+SP  +GFE N L+ CCGGGGPYN 
Sbjct  255  YHNELLQFELNRLRVLYPFTNIIYADYFNAALQFYKSPEQFGFERNALQVCCGGGGPYNF  314

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
            N  A CG+     CD  S Y+SWDG HLTEAAY+W+   LL G +T PK +  C+ S
Sbjct  315  NDTALCGNLEVIACDDTSKYVSWDGYHLTEAAYRWMAMSLLDGQYTIPKFSLSCLTS  371



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 163/248 (66%), Gaps = 1/248 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C +PS C++ +E+++ILMGEIGG DYNYAFL G   EEV   +P V
Sbjct  146  GVQLSSFKESLPKLCGSPSDCRDMIENALILMGEIGGTDYNYAFLVGKSIEEVKELIPMV  205

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S+I ELI  G +  +VPG+ P+GCS  YL+ + TSN   YDP TGC+ WLN F E
Sbjct  206  ITAISSSITELIGMGGRTFLVPGDFPLGCSAIYLTSYQTSNMEAYDPLTGCLTWLNKFGE  265

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             H+  LQ ELN L++L+PH  IIYADYYNA +R+Y+ P  +GF N  L ACCG GGPYN 
Sbjct  266  NHDAQLQAELNRLQKLYPHVNIIYADYYNALLRIYQEPTKFGFMNRPLSACCGVGGPYNF  325

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+ +   C  PS Y++WDG+H+TEAAY  I +G+L GP+ +P  +  C+ S  K
Sbjct  326  TSFWQCGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAAPPFDWSCLSSEIK  385

Query  26   TKIPDS*R  3
               P   R
Sbjct  386  DNGPSEKR  393



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 163/234 (70%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++ WFKQ+L S C + S CK  + +S+ LMGEIG NDYN+ F+QG   +E+ +FVP +
Sbjct  159  GAQIKWFKQLLPSLCSSDSDCKGLMSNSLFLMGEIGWNDYNHPFVQGMTIDEIRTFVPDI  218

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I +I+S I +LI+ GA+ ++VPG +P GC   YL+ F +    +YDPQTGCI W N+F+E
Sbjct  219  IHIISSAITDLIELGAKTVVVPGIVPSGCVSLYLTVFQSQKREDYDPQTGCIKWANEFSE  278

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            +H  LL +EL+ LR LHPH  II+A+YY+A M ++RSP  +GF+ + L+ACCGG GPYN 
Sbjct  279  HHGRLLSEELDRLRRLHPHAIIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNL  338

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    CG  ++TVC  PS Y+ WDG HLTEAAY+ I  GLL GP+ +P I   C
Sbjct  339  NISLRCGDPMTTVCHDPSKYVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  392



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 165/242 (68%), Gaps = 2/242 (1%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            ++L+WFKQML   C   S CKE+LESS+ L+GE GGNDY +A L      +++  +P V 
Sbjct  135  DQLNWFKQMLPHLCHNSSGCKEFLESSLFLLGEFGGNDYTHALLSHKTLNDILPIIPLVA  194

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              IAS  +EL++ GA+ +IVP  LP+GCS SYL+ F + N  +YD + GC+ W N+   Y
Sbjct  195  QSIASGAHELVELGARTIIVPSVLPLGCSSSYLTNFESLNEEDYD-ELGCLIWPNELASY  253

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSN  204
            HNELLQKEL+ LRELHPH  IIYADYYNA+M++YR+P  YGF ++ L ACCGGGGPYN N
Sbjct  254  HNELLQKELHRLRELHPHVNIIYADYYNASMKIYRAPRKYGFLKSVLVACCGGGGPYNFN  313

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKT  24
              A CG+  +T C+ P  Y++WDG H +EAAY+WI   LL G F+ P +   C+    + 
Sbjct  314  VSAQCGTSQATSCEDPKQYVNWDGYHFSEAAYKWITKSLLEGLFSYPPMKNLCLFDVVEA  373

Query  23   KI  18
            ++
Sbjct  374  QV  375



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++ WFKQ+L S C + S CK ++ +S+ L+GEIG NDYN+ F+QG   EE+   VP +
Sbjct  156  GIQIKWFKQLLPSLCSSDSDCKSFMSNSLFLVGEIGWNDYNHPFVQGMTIEEIRKLVPDI  215

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I VI+S I +LI+ GA+ L+VPG +P GC   YL+ F +    +YDP+TGCI W N+F+E
Sbjct  216  IHVISSAITDLIQLGAKTLVVPGIVPSGCVSLYLTVFQSQKGEDYDPRTGCIKWANEFSE  275

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             HN L+ +EL+ LR LHPH  II+A+YY+A M ++RSP  +GF+ + L+ACCGG GPYN 
Sbjct  276  EHNRLISEELDRLRRLHPHATIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNM  335

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N    CG   +TVC  P+ ++ WDG HLTEAAY+ I  GLL GP+ +P I   C
Sbjct  336  NISLRCGDPKTTVCRDPAKFVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  389



>ref|XP_008812188.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=377

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 160/233 (69%), Gaps = 0/233 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++ FKQ+L S C + S C ++L +++ LMGEIGGNDYN+ F+QG   EE+ ++VP V
Sbjct  119  GIQIEQFKQLLPSLCSSDSGCHDFLNNTLFLMGEIGGNDYNHPFIQGRTVEEITTYVPSV  178

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S+I  LI  GA+ L+VPGN PIGC P YL+ F  S+   YDPQTGCINWLN F+E
Sbjct  179  ISAISSSIKVLIDLGAKTLVVPGNFPIGCVPLYLALFQNSSKGNYDPQTGCINWLNKFSE  238

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN LL  ELN LR+LHP   IIYA+YY A + + RSP  YG E T  ACCG  GP N  
Sbjct  239  YHNRLLMDELNKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVT  298

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
                CG   +TVC  PS YISWDG+HLTEAAY  I  GLL GP+T+P +   C
Sbjct  299  SPVLCGDPAATVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYTAPPMIRAC  351



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 167/254 (66%), Gaps = 1/254 (0%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G +L  FK+ L + C  PS C+E + +++ILMGEIG NDYN+ F +  
Sbjct  130  ERGYHCPHNISLGIQLKSFKESLPNICGLPSDCREMIGNALILMGEIGANDYNFPFFELR  189

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+ + TSN  EYDP 
Sbjct  190  PLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLYQTSNVEEYDPL  249

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
            TGC+ WLN F EYH+E L++EL  LR+L+PH  IIYADYYNA++RL + P  YGF N  L
Sbjct  250  TGCLIWLNKFGEYHSEQLKEELKRLRQLNPHVNIIYADYYNASLRLGQEPTKYGFINRHL  309

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN N    CGS     C+ PS Y++WDG+H+TEAA++ + DGLL GP+  P
Sbjct  310  SACCGVGRPYNFNFSRSCGSVGVESCNDPSKYVAWDGLHMTEAAHKSMADGLLNGPYAIP  369

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  370  PFNWSCLSSKIKKK  383



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 161/240 (67%), Gaps = 2/240 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK  L   C +PS C+E +++++ILMGEIGGNDYNY F  G   EEV  FVP V
Sbjct  149  GVQLKSFKDALPKLCGSPSDCREMIKNALILMGEIGGNDYNYVFFVGKTIEEVREFVPLV  208

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP +GC+ WLN F +
Sbjct  209  ISTISSAITELIGMGGRTFLVPGEFPIGCSVTYLTLYQTSNKEEYDP-SGCLKWLNKFAK  267

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH++ LQ ELN LREL+PH  IIYADYYNA +RL++ P N+GF +  L ACCG GGPYN 
Sbjct  268  YHSDQLQAELNKLRELYPHVNIIYADYYNALLRLFQEPGNFGFIDRPLHACCGFGGPYNF  327

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG +    C  PS YI WDG+H+TEA Y+ + +G+L GP+  P  +  C+ S+ K
Sbjct  328  TFGRKCGFKGVESCSDPSKYICWDGVHMTEATYRLMAEGILKGPYAIPPFDWSCLSSKIK  387



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 162/232 (70%), Gaps = 2/232 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L++ C + + C E +E+S+ LMGEIGGND+NY F Q     E+ S+VP VI 
Sbjct  137  QLNWFKELLTALCNSSTNCHEIVENSLFLMGEIGGNDFNYLFFQQKSIAEIKSYVPYVIN  196

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IAS INELI  GA+ L+VPGNLPIGCS  YL+ + T + ++YD Q GC+ WLN+F EY+
Sbjct  197  AIASAINELIGLGARTLMVPGNLPIGCSVIYLTIYETIDKTQYD-QFGCLKWLNEFGEYY  255

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N  LQ EL+ LR  HP   IIYADYYNAA+ LYR P  +GF + L+ CCG GGPYN N  
Sbjct  256  NHKLQSELDKLRVFHPRANIIYADYYNAALPLYRDPTKFGFTD-LKICCGMGGPYNFNKL  314

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
              CG+     CD PS +I WDG+HLTEAAY++I  GL+ GP++ P+ +  C 
Sbjct  315  TNCGNPSVIACDDPSKHIGWDGVHLTEAAYRFIAKGLIKGPYSLPQFSTLCF  366



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 164/254 (65%), Gaps = 2/254 (1%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G ++  FK+ L + C  PS CK  + +++ILMGEIGGNDYN  F +  
Sbjct  132  ERGYHCSHNISLGVQVKVFKESLPNLCGLPSDCKNMIGNALILMGEIGGNDYNGPFFERR  191

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
               EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP 
Sbjct  192  LINEVKELVPLVISTISSAITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIEEYDP-  250

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
             GC+ WLN F EYH+E LQ EL  LR+L+PH  IIYADYYNA +RL + P  YGF N  L
Sbjct  251  FGCLKWLNKFGEYHDEQLQAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPL  310

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN N    CGS     C+ PS Y++WDG+H+TEAAY++I DGLL GP+TSP
Sbjct  311  SACCGVGEPYNFNFSTCCGSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSP  370

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  371  PFNWTCLTSKIKNK  384



>gb|EEE55084.1| hypothetical protein OsJ_02825 [Oryza sativa Japonica Group]
Length=254

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C      CK  +  S+ L+GEIGGNDYNY  + G P E++ SF P VI
Sbjct  2    EMGWFRDLLDMLCAGDMDGCKGMMNQSLFLVGEIGGNDYNYPLMSGVPIEKIRSFTPSVI  61

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+ GC+ W+N+F++Y
Sbjct  62   AKISSTITELIGLGAKTLVVPGNLPIGCIPTYLMQFESDKKEDYEPEIGCLRWMNEFSQY  121

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL  EL +LR+LHP   IIY DYY AAM ++ SP  +G E+ L ACCGGGGPY  + 
Sbjct  122  HNKLLIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSA  181

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG     VCD PS Y SWDG H +EAAY+ I  GLL GP+T P I
Sbjct  182  SAGCGYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  229



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 164/241 (68%), Gaps = 1/241 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  F + L + C +PS C++ +E+++ILMGEIGGNDYN+A  Q  P +EV   VP VI 
Sbjct  145  QLRSFTESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRKPVKEVEELVPFVIA  204

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I EL+  G +  +VPGN PIG S SYL+ + TSN  EYDP TGC+ WLNDF+EY+
Sbjct  205  TISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYY  264

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            N+ LQ+ELN LR+L+PH  IIYADYYNA +RL++ P  +GF N  L ACCG GG YN N 
Sbjct  265  NKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNF  324

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CGS     CD PS Y+++DG+H+TEAAY+ I +GLL GP+  P     C+ S    K
Sbjct  325  SRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNK  384

Query  20   I  18
            +
Sbjct  385  M  385



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 160/238 (67%), Gaps = 1/238 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS C++ +E+S+ILMGEIGGNDYNYAF  G   EE+   VP VI 
Sbjct  143  QLSSFKESLPNLCVSPSDCRDMIENSLILMGEIGGNDYNYAFFVGKNIEEIKELVPLVIE  202

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I ELI  G +  +VPG  P+GCS +YLS + TSN  EYDP TGC+ WLN F+EYH
Sbjct  203  TISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYH  262

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            +E LQ ELN L++L+PH  IIYADYYN  +RL + P  +GF    L ACC  GGP+N   
Sbjct  263  DEQLQAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFISRPLPACCALGGPFNFTL  322

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                G+Q+   CD PS Y+SWDG+H+TEAAY+ + +G+L GP+  P  +  C+ S  K
Sbjct  323  GRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAIPPFDWSCLSSEIK  380



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 158/230 (69%), Gaps = 2/230 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF  +L S C+T + CK YL+ SV L+GEIGGNDYNYAF+QG   E+V S+VP VI 
Sbjct  146  QLGWFYHLLPSLCRTDAACKSYLKKSVFLVGEIGGNDYNYAFIQGKSIEQVKSYVPDVIN  205

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I +  + LI+ GA+ L+VPGNLP+GCS S L+ F+T++ +EYDP+ GC+   N+F +YH
Sbjct  206  AIMNAASVLIRIGAKTLVVPGNLPVGCSASILTGFLTTDKNEYDPRNGCLIRFNEFAQYH  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYNSN  204
            N  L K +  +RE  PH  IIYADYYNAA+R  ++P  +GF  E  L ACCGGGGPYN N
Sbjct  266  NSKLHKAIQAMRERFPHINIIYADYYNAAIRFVQTPEMFGFRKETVLRACCGGGGPYNFN  325

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
                CG   +  C +P+ Y++WDG+HLTEAAY++I   +L G F  P I 
Sbjct  326  ITDRCGHPGAHACANPARYVNWDGIHLTEAAYEFIAKAMLNGEFMHPPIK  375



>ref|XP_009414900.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 157/233 (67%), Gaps = 1/233 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+WFKQ+L   C + S  K+ L +S+IL+GEIGGNDYNYAF Q    +E+ ++VP V
Sbjct  141  GVQLEWFKQLLPILC-SESNSKDILSNSLILLGEIGGNDYNYAFAQKQSIQEIRTYVPSV  199

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I   ++ LI+ GA  L+VPGN PIGC P+YLS + ++ A EYDPQTGCI+WLN+ +E
Sbjct  200  IDAIRQAVDVLIQLGATTLVVPGNFPIGCVPAYLSDYQSTVAEEYDPQTGCISWLNELSE  259

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN +L  ELN LR+++PH  IIYADYY A + + RSP  +GF+  L ACCG  G YN N
Sbjct  260  YHNSMLLDELNQLRKVYPHATIIYADYYEAVLNILRSPQQFGFKTPLAACCGSDGLYNFN  319

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
                CG+Q+S VC  PS  +SWDG+H T+AAY  I   LL G +  P     C
Sbjct  320  WSKMCGTQMSKVCSDPSDSLSWDGIHFTDAAYSTIALSLLDGTYAYPSFTEAC  372



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            + +WFKQ+L S C T S CK  + +S+ L+GEIG ND+ Y+F +G   +E+ +F+P +I 
Sbjct  156  QFNWFKQLLPSLCSTDSDCKGIISNSLFLVGEIGWNDHGYSFNEGRTADEIRTFIPNIIE  215

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
            VI+S I++LIK GA+ L+VPG  P GC P YL++  +    +YDP TGCI W+N+F+ YH
Sbjct  216  VISSVIDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYH  275

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            N+LLQ EL+ +R LHPH  IIYADYY A M ++RSP  +GF+   L+ACCGGGGPYN N 
Sbjct  276  NQLLQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFKKAPLDACCGGGGPYNVNF  335

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               CG  ++TVC  PS ++ WD  H TEAA + +  GLL GP+  P I   C
Sbjct  336  SLPCGGPMATVCKDPSKFVFWDDAHPTEAATEIVARGLLEGPYAYPPILQAC  387



>ref|XP_007025435.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY28057.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=343

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 150/217 (69%), Gaps = 0/217 (0%)
 Frame = -2

Query  686  RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQIL  507
             C E LE+S+ILMGEIGGND+N+AF QG   E +   VP VI  I+S I EL+K GA  +
Sbjct  122  ECNELLENSLILMGEIGGNDFNFAFFQGITTEVIQGLVPDVINAISSAIQELMKLGAVTI  181

Query  506  IVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPH  327
            +VPGNLPIGC P YL+ F TSN  +Y   TGC+ WLNDF++Y+N +L+ ELN +R+LHP 
Sbjct  182  LVPGNLPIGCLPIYLTRFQTSNKQDYGRSTGCLTWLNDFSQYYNGMLKNELNKIRKLHPF  241

Query  326  TRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSY  147
              I+YADYY AA+  YRSP  +GF +TL ACCGGGGPYN N    CGS  +T C  PSSY
Sbjct  242  ANIVYADYYQAAIPFYRSPRQFGFNSTLTACCGGGGPYNFNLSLGCGSPGTTSCGDPSSY  301

Query  146  ISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
            +SWDG+HLTEA Y  I   LL G  T P++   C  S
Sbjct  302  VSWDGIHLTEATYGLISKALLDGSSTIPRLKILCASS  338



>ref|NP_973931.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30997.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=309

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+ FK+ L S C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   +P V
Sbjct  63   GVQLNSFKESLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDKGIEEIKELMPLV  122

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPG  P+GCS  YL+   TSN  EYDP TGC+ WLN F E
Sbjct  123  ITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGE  182

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             H E L+ ELN L++L+PH  IIYADYYNA   LY+ P  +GF N  L ACCG GGPYN 
Sbjct  183  NHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNY  242

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
                 CG+ +   CD PS Y++WDG+H+TEAAY+ + +G+L GP+  P  +  C
Sbjct  243  TVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSC  296



>ref|NP_001172483.1| Os01g0649400 [Oryza sativa Japonica Group]
 dbj|BAH91213.1| Os01g0649400 [Oryza sativa Japonica Group]
Length=306

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C      CK  +  S+ L+GEIGGNDYNY  + G P E++ SF P VI
Sbjct  54   EMGWFRDLLDMLCAGDMDGCKGMMNQSLFLVGEIGGNDYNYPLMSGVPIEKIRSFTPSVI  113

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+ GC+ W+N+F++Y
Sbjct  114  AKISSTITELIGLGAKTLVVPGNLPIGCIPTYLMQFESDKKEDYEPEIGCLRWMNEFSQY  173

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL  EL +LR+LHP   IIY DYY AAM ++ SP  +G E+ L ACCGGGGPY  + 
Sbjct  174  HNKLLIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSA  233

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG     VCD PS Y SWDG H +EAAY+ I  GLL GP+T P I
Sbjct  234  SAGCGYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  281



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 162/254 (64%), Gaps = 2/254 (1%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G ++  FK+ L + C  PS CK  + +++ILMGEIGGNDYN  F Q  
Sbjct  132  ERGYHCPHNISLGVQVKIFKESLPNLCGLPSDCKNMIGNALILMGEIGGNDYNGPFFQRR  191

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYD  
Sbjct  192  PVDEVKELVPLVISTISSAITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYD-S  250

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTL  243
             GC+ WLN F EYH+E LQ EL  LR L+PH  IIYADYYNA +RL + P  YGF +  L
Sbjct  251  FGCLKWLNKFGEYHDEQLQAELKRLRNLNPHVNIIYADYYNALLRLNQEPTKYGFIDKPL  310

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN N    CGS     C+ PS Y++WDG+H+TEAAY+ + DGLL GP+ SP
Sbjct  311  SACCGVGEPYNFNFSTCCGSFGVDSCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYASP  370

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  371  PFNWTCLSSKIKNK  384



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score =   273 bits (697),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 169/233 (73%), Gaps = 2/233 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L WF Q LS  C  T S CK ++E+S++L+GEIGGNDYN+A L G  + EV SFVP V+
Sbjct  540  QLRWFNQFLSKICPTTSSDCKGFIETSLVLVGEIGGNDYNHALLGGIKEAEVRSFVPHVV  599

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
             +I S I ELI  GA  L+VPGN PIGCS +YL+YF++ N  +Y+P TGCI WLN F +Y
Sbjct  600  NIIGSAITELINLGAVTLMVPGNFPIGCSSAYLTYFLSENQDDYEPATGCIKWLNRFAQY  659

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSN  204
            HN+LL+KEL  +RELHPHT IIYADYYNA M LYRSP  +GF    L ACCGGGGPYN N
Sbjct  660  HNDLLKKELARIRELHPHTTIIYADYYNAVMDLYRSPIEHGFAGGALGACCGGGGPYNCN  719

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               +CG   S  CD PS Y++WDGMH TEAAY+WI  GLL GP+T+P ++  C
Sbjct  720  LTVHCGYPPSNTCDDPSLYVNWDGMHFTEAAYKWIALGLLKGPYTTPPLSTVC  772


 Score =   249 bits (635),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 163/239 (68%), Gaps = 10/239 (4%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVM-SFVPK  567
            G +LDWFKQ L+         +++L+SS+I+MGEIGGNDYNY   QG+   +V+ S VP 
Sbjct  139  GIQLDWFKQFLARIPDG----RKFLKSSLIVMGEIGGNDYNYPIQQGNVDPQVIRSLVPT  194

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA-SEYDPQTGCINWLNDF  390
            V+  + S I ELIK GA+ ++VPGNL +GC P YL+ + TS+  ++YDP+TGC+NWLN+ 
Sbjct  195  VVNYMGSIIEELIKLGAETMLVPGNLALGCLPLYLTQYKTSSTENDYDPKTGCLNWLNEL  254

Query  389  TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGP  216
            + YHNELLQKEL  +R LHP   IIYADYYNA +R Y SP+ +GF  E+ L ACCGGGGP
Sbjct  255  SIYHNELLQKELFRIRHLHPRISIIYADYYNATIRFYLSPDQFGFTKESVLRACCGGGGP  314

Query  215  YNSNPHAYCG--SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            YN +P   CG     +  C++PS + SWDG+H TEAA +WI  G +   +T P I   C
Sbjct  315  YNYDPLTACGIDRPAANCCENPSLFASWDGIHFTEAANRWIAQGFIRQHYTHPPIKTLC  373



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 165/254 (65%), Gaps = 1/254 (0%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G +L  FK+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  
Sbjct  123  ERGYHCPHNISLGVQLKIFKESLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFESR  182

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP 
Sbjct  183  PFDEVKELVPFVISTISSAITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPL  242

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TL  243
            TGC+ W N F EYH+E LQ E+  LR+L+PH  IIYADYYNA++ L + P  Y F N TL
Sbjct  243  TGCLKWPNKFGEYHSEQLQVEIKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTL  302

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN +    CGS     C+ PS Y++WDG+H+TEAAY+ + DGLL GP+ +P
Sbjct  303  SACCGVGRPYNFSFSQSCGSVGVESCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATP  362

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  363  PFNWSCLSSKIKNK  376



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 162/235 (69%), Gaps = 9/235 (4%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +LDWFK+ LS+        K+YLE S++++GEIGGNDYN+   QG   + + SF P V
Sbjct  145  GTQLDWFKRFLSTIPDG----KKYLERSLVVVGEIGGNDYNHPLSQGATYDVIQSFAPAV  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA-SEYDPQTGCINWLNDFT  387
            +  I STI ELIK G + ++VP   PIGC P YL+ F  S+   +YDP+TGC+NWLN+F 
Sbjct  201  VDYIGSTIQELIKLGVKTMLVPAIPPIGCLPVYLTQFKKSSTIRDYDPKTGCLNWLNEFA  260

Query  386  EYHNELLQKELNHLREL-HP-HTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGG  219
             YHN+LL+KELN ++EL +P    IIYADYYNAAMR Y SPN YG   +  L ACCG GG
Sbjct  261  RYHNKLLKKELNRIQELINPDQIDIIYADYYNAAMRFYLSPNEYGLSKKGILRACCGAGG  320

Query  218  PYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            PYN N  A CGS  +T CD PSS+ SWDG+H TEAAY+ I  GL  GP+T+P++ 
Sbjct  321  PYNYNASAECGSSPATCCDDPSSFASWDGLHFTEAAYRLIAQGLFDGPYTTPRVK  375



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 155/234 (66%), Gaps = 0/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++ WFK++L SFC   S C+ +L  S++LMGEIGGNDYN  F Q    +E+ ++VP V
Sbjct  150  GTQIQWFKELLPSFCSYKSDCESFLSKSLVLMGEIGGNDYNQPFAQFRTLDEIRTYVPSV  209

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I +    IN LI+ GA+ L+VPG  P+GC  +YL+   +    +YDPQTGCI  LN+F+E
Sbjct  210  INITGWAINSLIELGAKTLVVPGIFPLGCVSAYLTIHQSQRKEDYDPQTGCIKRLNEFSE  269

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN LL+ E++ LR LHP+T IIYADYY AAM +YR P  YG +  L ACCGGGG YN N
Sbjct  270  YHNNLLKAEVDRLRGLHPYTTIIYADYYEAAMDIYRHPLKYGIDAPLAACCGGGGRYNFN  329

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG+   TVC  PS ++ WDGMHLT+A Y+ I  GLL G + +  I   C+
Sbjct  330  LAVMCGAPGGTVCSDPSKHVCWDGMHLTDAVYKIIARGLLEGSYATAPIAQACL  383



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 162/234 (69%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FKQ L + C +PS C+E +  ++I++GEIGGNDYNY  L G   EE+   VP V
Sbjct  144  GVQLKSFKQSLPNICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGKSIEEIKELVPLV  203

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S I EL+  G + ++VP +LPIGC  S+L+ + TSN  EY+P TGC+NWLN+F E
Sbjct  204  ISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPLTGCLNWLNEFVE  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            +HN+ LQ+ELN L++L+PH  I+YADYYNA + +++ P  +GF N  L ACCG GGPYN 
Sbjct  264  HHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFMNRPLSACCGTGGPYNF  323

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  + CG++    C  PS Y+ WDG HLTE+AY+W+  GLL GP+T P  +  C
Sbjct  324  NNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLPAFDWSC  377



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 166/244 (68%), Gaps = 2/244 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++WF+Q+L S C + S C    ++S+ L+GEIGGNDYNY FLQ    +EV+S+VP V
Sbjct  182  GIQIEWFRQLLPSLCSSDSDCNVMFQNSLFLVGEIGGNDYNYPFLQARALDEVISYVPPV  241

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S I  LI+ GA+ L+VPGN PIGC+ +YL+ F ++ + +YD   GCI WLN F+ 
Sbjct  242  MDAISSAITALIELGARTLVVPGNFPIGCNSAYLTVFHSNRSEDYD-AFGCIKWLNKFSR  300

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHN  L+  L  +R+ +PH  +IYADYY+AAM ++RSP   GF ++ L ACCGGGGPYN 
Sbjct  301  YHNNQLRVVLKRIRQRNPHATVIYADYYSAAMSMFRSPQLSGFRSSPLPACCGGGGPYNF  360

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CG+  S VC  PSSY++WDGMH+TEAAY+ I  GLL GP   P I   C  ++ K
Sbjct  361  NSFLQCGNPGSNVCADPSSYVTWDGMHMTEAAYRKIATGLLEGPNAVPPILNTCPRTKQK  420

Query  26   TKIP  15
            T  P
Sbjct  421  TSRP  424



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 166/254 (65%), Gaps = 1/254 (0%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G +L  FK+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  
Sbjct  131  ERGYHCPHNISLGVQLKIFKESLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFESR  190

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS ++L+ + TSN  EYDP 
Sbjct  191  PFDEVKELVPFVISTISSAITELIGMGGRTFLVPGGFPIGCSVAFLTLYQTSNMEEYDPL  250

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TL  243
            TGC+ W N F EYH+E LQ ELN LR+L+PH  IIYADYYNA++ L + P  Y F N TL
Sbjct  251  TGCLKWPNKFGEYHSEQLQVELNRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTL  310

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN +    CGS     C+ PS Y++WDG+H+TEAA++ + DGLL GP+ +P
Sbjct  311  SACCGVGRPYNFSFSQSCGSAGVKSCNDPSKYVAWDGIHMTEAAHKLMADGLLKGPYATP  370

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K +
Sbjct  371  PFNWSCLSSKIKNE  384



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 160/234 (68%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L S C + + C E + +S+ LMGEIGGND+NY   Q     EV +FVP VI 
Sbjct  139  QLNWFKELLPSLCNSSADCHEVVGNSLFLMGEIGGNDFNYLLFQQRSIAEVKTFVPYVIK  198

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S +NELI  GA+ LIVPGN+P+GCS +YL+ + T + ++YD Q GC+ WLN F EY+
Sbjct  199  AITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQYD-QYGCLKWLNKFAEYY  257

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N+ LQ EL+ L+ LH H  IIYADYYNA + LYR P  +GF N L+ CCG GGPYN N  
Sbjct  258  NQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCGMGGPYNYNAS  316

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
            A CG      CD PS +I WDG+HLTEAAY+ I  GL+ GP+  P+ N  C+++
Sbjct  317  ADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQGLIKGPYCLPRFNTLCLIN  370



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 166/254 (65%), Gaps = 1/254 (0%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G +L  FK+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  
Sbjct  132  ERGYHCPHNISLGVQLKIFKESLPNLCGLPSDCRDMIRNALILMGEIGANDYNFPFFESR  191

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP 
Sbjct  192  PFDEVKELVPFVISNISSAITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPL  251

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TL  243
            TGC+ W N F EYH+E LQ EL  LR+L+PH  IIYADYYNA++ L + P  Y F N TL
Sbjct  252  TGCLKWPNKFGEYHSEQLQVELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTL  311

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN +    CGS     C++PS Y++WDG+H+TEAA++ + DGLL GP+ +P
Sbjct  312  SACCGVGKPYNFSFSQSCGSVGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATP  371

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  372  PFNWSCLSSKIKNK  385



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 157/235 (67%), Gaps = 1/235 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L S C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+    P V
Sbjct  144  GVQLQSFKESLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDKSIEEIKELTPLV  203

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPG  P+GCS  YL+   TSN  EYDP TGC+ WLN+F E
Sbjct  204  ITTISSAITELISMGGRTFLVPGEFPVGCSVFYLTSHQTSNMEEYDPLTGCLKWLNNFGE  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             H E L+ EL  L++L+PH  +IYADYYNA +RLY+ P  +GF N  L ACCG GGPYN 
Sbjct  264  NHGEQLRAELKRLQKLYPHVNVIYADYYNALLRLYQEPAKFGFMNRPLSACCGSGGPYNY  323

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                 CG+ +   C+ PS Y++WDG+HLTEAAY+ + +G+L GP+  P  +  C+
Sbjct  324  TVGRKCGTDIVESCNDPSKYVAWDGVHLTEAAYRLMAEGILKGPYAIPPFDWSCL  378



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 161/242 (67%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L S C +PS C + + +++IL+GEIGGNDYNY F      EEV   VP V
Sbjct  143  GVQLTNFKESLRSLCGSPSDCIDMIGNALILIGEIGGNDYNYPFFGHKNIEEVKELVPLV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+STI EL+  G +  +VPG+ P+GCS  YL+ + TSN   YDPQTGC+ WLN+F+E
Sbjct  203  ISTISSTITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKEAYDPQTGCLTWLNEFSE  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHNE LQ ELN LR+L+P+  IIY DYYNA +RL + P  +G   N L  CCG GG YN 
Sbjct  263  YHNEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMNNPLPVCCGLGGRYNY  322

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG +    C+ PS Y++WDG+H+TEAAY+WI +GLL GP+ +P  +  C+ S  K
Sbjct  323  TFGVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATPPFDWSCLSSEIK  382

Query  26   TK  21
             K
Sbjct  383  DK  384



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 164/240 (68%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS C++ +E+++ILMGEIGGNDYN+A  Q    EEV   VP V++
Sbjct  564  QLRSFKESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRKAIEEVEELVPFVVS  623

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+  I EL+  G +  +VPGN P+GCS +YL+ + TSN  EYDP TGC+ WLN F+EY+
Sbjct  624  AISLAIKELVCMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEYDPLTGCLTWLNVFSEYY  683

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            NE LQKELN L+EL+PH  IIYADYYNA +RL+  P  +GF N  L ACCG GG YN N 
Sbjct  684  NEQLQKELNRLKELYPHVNIIYADYYNALLRLFPEPAKFGFMNRPLPACCGLGGSYNFNF  743

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CGS     C+ PS Y++WDG+H+TEAAY+WI +GLL GP+  P  N  C+ S    K
Sbjct  744  SRRCGSVGVEYCNDPSKYVNWDGIHMTEAAYRWISEGLLKGPYAIPTFNWSCLSSEIMNK  803


 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 159/242 (66%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C +PS C++ + +++ILMGEIGGNDYN+ F +  P +EV   VP V
Sbjct  137  GVQLKSFKKSLPDLCGSPSDCRDKIGNALILMGEIGGNDYNFPFFERKPIKEVKELVPFV  196

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI  GA+  +VPG  PIGCS  YL+ + TSN  EYDP TGC+ WLN F E
Sbjct  197  IATISSAITELIGMGAKTFLVPGEFPIGCSVVYLTLYQTSNKEEYDPLTGCLKWLNKFGE  256

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH++ L+ ELN LR+L+PH  IIYADYYNA +RL++ P  +GF +  L ACCG GG YN 
Sbjct  257  YHSQQLKTELNRLRKLNPHVNIIYADYYNALLRLFKEPAKFGFMDRPLHACCGIGGQYNF  316

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CGS     C  PS Y+ WDG+H+TE AY+WI DG+L GP+  P     C+ S  K
Sbjct  317  NFTRKCGSVGVESCKDPSKYVGWDGVHMTEGAYKWIADGILKGPYAIPPFGRSCLRSEIK  376

Query  26   TK  21
             K
Sbjct  377  NK  378



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/254 (50%), Positives = 165/254 (65%), Gaps = 4/254 (2%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            E+ Y   H    G +L  FKQ L + C  PS   + + +++ILMGEIG NDYN+ F Q  
Sbjct  130  EKGYHCPHNFSLGVQLKIFKQSLPNLCGLPS---DMIGNALILMGEIGANDYNFPFFQLR  186

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP 
Sbjct  187  PLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPL  246

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
            TGC+ WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P+ YGF N  L
Sbjct  247  TGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHL  306

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P
Sbjct  307  SACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIP  366

Query  62   KINGECILSRPKTK  21
              +  C+ S  K K
Sbjct  367  PFDWSCLSSMIKKK  380



>ref|XP_002457137.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
 gb|EES02257.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
Length=379

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 154/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P +CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V  
Sbjct  152  QLGWFEQLKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAA  211

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +      LIK GA  L+VPGNLPIGCS +YL+     N+S+YD   GC+   NDF ++H
Sbjct  212  AVTDATERLIKAGATHLVVPGNLPIGCSSAYLTLHPGRNSSDYD-AAGCLKTYNDFAQHH  270

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N +LQ+ L  LR  +P  RI+YADYY AAM   ++P  +GF E  L  CCGGGGPYN NP
Sbjct  271  NAVLQQNLRALRVKYPQARIMYADYYGAAMSFAKNPKQFGFTEGPLRTCCGGGGPYNFNP  330

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  331  KASCGVRGSSVCTDPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  378



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 162/234 (69%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L + C +PS C+E +  ++I++GEIGGNDYNY  L G   EE+   VP V
Sbjct  144  GVQLKSFKKSLPNICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGKSIEEIKELVPLV  203

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S I EL+  G + ++VP +LPIGC  S+L+ + TSN  EY+P TGC+NWLN+F E
Sbjct  204  ISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPLTGCLNWLNEFVE  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            +HN+ LQ+ELN L++L+PH  I+YADYYNA + +++ P  +GF N  L ACCG GGPYN 
Sbjct  264  HHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFVNRPLSACCGTGGPYNF  323

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  + CG++    C  PS Y+ WDG HLTE+AY+W+  GLL GP+T P  +  C
Sbjct  324  NNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLPAFDWSC  377



>ref|XP_010925696.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 156/230 (68%), Gaps = 1/230 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPK-EEVMSFVPKV  564
             +L WF+++  S C T + C  Y   S+ L+GEIGGNDYNY FL G    EEV S+VPKV
Sbjct  144  TQLRWFEELKPSLCNTTTACAGYFSKSLFLVGEIGGNDYNYFFLLGGKSLEEVKSYVPKV  203

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I +    LIK GA  L+VPGNLP GCS  YL+ F + N  EYDP TGC+ WLN F +
Sbjct  204  VGAIVAASERLIKNGAVNLLVPGNLPFGCSSVYLTVFNSPNKEEYDPTTGCLKWLNAFAK  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YH+ LL++ L+ LR  +P  RI+YADYY A++++ RSP  +GF++ L ACCGG GPYN +
Sbjct  264  YHDALLRRALDELRRKYPRARIMYADYYGASIQIGRSPQRFGFDDVLIACCGGDGPYNFS  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            P A+CG   S+VC   SS  +WDG+HLTEAAY +I   LL GP+TSP + 
Sbjct  324  PLAFCGQPGSSVCSCLSSRANWDGLHLTEAAYHFIATSLLDGPYTSPPLR  373



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 162/242 (67%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F    P +EV   VP V
Sbjct  137  GVQLKSFKKSLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRKPVKEVEELVPFV  196

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+STI ELI  G +  +VPG  PIGCS  YL+ + TSN  EYDP TGC+ WLN F E
Sbjct  197  IASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGE  256

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH+E L+ ELN LR+L+PH  IIYADYYN+ +R+++ P  +GF E    ACCG GGPYN 
Sbjct  257  YHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNF  316

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CGS     C  PS Y+ WDG+H+TEAAY+WI DG+L GP+ +P  +  C+ S  K
Sbjct  317  NFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCLRSEIK  376

Query  26   TK  21
             +
Sbjct  377  KE  378


 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 164/241 (68%), Gaps = 1/241 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  F + L + C +PS C++ +E+++ILMGEIGGNDYN+A  Q  P +EV   VP VI 
Sbjct  565  QLRSFTESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRKPVKEVEELVPFVIA  624

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I EL+  G +  +VPGN PIG S SYL+ + TSN  EYDP TGC+ WLNDF+EY+
Sbjct  625  TISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYY  684

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            N+ LQ+ELN LR+L+PH  IIYADYYNA +RL++ P  +GF N  L ACCG GG YN N 
Sbjct  685  NKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNF  744

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CGS     CD PS Y+++DG+H+TEAAY+ I +GLL GP+  P     C+ S    K
Sbjct  745  SRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNK  804

Query  20   I  18
            +
Sbjct  805  M  805



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 164/254 (65%), Gaps = 4/254 (2%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            E+ Y   H    G +L  FKQ L + C  PS C++ + +++ILMGEIG NDYN+ F Q  
Sbjct  130  EKGYHCPHNFSLGVQLKIFKQSLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFQLR  189

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP 
Sbjct  190  PLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPL  249

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
            TGC+ WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P    F N  L
Sbjct  250  TGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPR---FINRHL  306

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P
Sbjct  307  SACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIP  366

Query  62   KINGECILSRPKTK  21
              +  C+ S  K K
Sbjct  367  PFDWSCLSSMIKKK  380



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 160/240 (67%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++  FK+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   +P V
Sbjct  162  GVQISSFKESLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSIEEIKELIPLV  221

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G + ++VPG+ P+GCS +YL+ +  S    YDP TGC+ WLN F E
Sbjct  222  ITTISSAITELIGMGGRTILVPGDFPLGCSATYLTLYQKSKKEAYDPSTGCLTWLNKFGE  281

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             H+  L+ ELN L++L+PH  IIYADYYNA +R+Y+ P N+GF N  L ACCG GGPYN 
Sbjct  282  NHDVQLRAELNRLQKLYPHVNIIYADYYNALLRIYQEPENFGFMNRPLSACCGVGGPYNF  341

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+ +   C+ PS Y++WDG+H+TEAAY  I +G+L GP+  P  N  C+ S  K
Sbjct  342  TSFWQCGTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGPYAVPPFNWSCLSSEFK  401



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+ FK+ L S C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   +P V
Sbjct  144  GVQLNSFKESLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDKGIEEIKELMPLV  203

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPG  P+GCS  YL+   TSN  EYDP TGC+ WLN F E
Sbjct  204  ITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGE  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             H E L+ ELN L++L+PH  IIYADYYNA   LY+ P  +GF N  L ACCG GGPYN 
Sbjct  264  NHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNY  323

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
                 CG+ +   CD PS Y++WDG+H+TEAAY+ + +G+L GP+  P  +  C
Sbjct  324  TVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSC  377



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score =   268 bits (685),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 165/242 (68%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYN+A  Q    EEV   VP V
Sbjct  143  GVQLRSFKESLPCLCASPSDCRDMIENALILMGEIGGNDYNFALFQRKAIEEVKELVPLV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I EL++ G +  +VPGN P+GCS +YL+ + TSN  +YDP TGC+ WLNDF +
Sbjct  203  IATISSAITELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEKYDPLTGCLTWLNDFGK  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH+E LQ ELN L+ L+P+  IIYADYYNA +RLY+ P  +GF +  L ACCG GG YN 
Sbjct  263  YHSEQLQTELNRLKNLNPNVNIIYADYYNALLRLYQEPTKFGFIKRPLPACCGLGGLYNF  322

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CGS     C  PS +++WDG+H+TEAAY+WI +GLL GP+  P  N  C+ S+ K
Sbjct  323  NFTRKCGSLGVESCIDPSEFVNWDGIHMTEAAYRWISEGLLNGPYAIPPFNWSCLNSKIK  382

Query  26   TK  21
             K
Sbjct  383  NK  384


 Score =   255 bits (651),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 155/240 (65%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C  PS C++ +E+++ILMGEIGGNDYNYAF      EE    VP V
Sbjct  553  GVQLSSFKESLPKLCGAPSDCRDMIENALILMGEIGGNDYNYAFFVNKSTEETKELVPLV  612

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI  G +  +VPG  P GCS  YL+ +  SN  EYDP TGC+ WLN F +
Sbjct  613  IRTISSAITELISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVEEYDPLTGCLTWLNKFGK  672

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
             H E L+ ELN L++L+PH  IIYADYYNA +R+Y+ P  +GF +  L ACCG GGP+N 
Sbjct  673  NHGEQLRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMDRPLSACCGVGGPHNF  732

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+ +   CD PS Y++WDG+HLTEAAY+ I +G+L GP+  P  +  C+ S  K
Sbjct  733  TAGNKCGTVVVESCDDPSKYVAWDGVHLTEAAYRLIAEGILKGPYAVPPFDWFCLSSEIK  792



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 155/238 (65%), Gaps = 1/238 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE    VP V
Sbjct  118  GVQLSSFKESLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSTEETNELVPLV  177

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI  G +  +VPG  P+GCS  Y + + T+N  EYDP TGC+ WLN F E
Sbjct  178  IRTISSAITELIGMGGKAFLVPGEFPMGCSVVYWTIYQTTNMEEYDPLTGCLKWLNKFGE  237

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHNE LQ ELN L++L+PH  IIYADYYN    +++ P  +GF N  L ACCG GGPYN 
Sbjct  238  YHNEQLQVELNRLQKLYPHVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYNY  297

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
                 CG+ +   C  PS Y++WDG+HLTEAAY  I +G+L GP+T P  +  C+ SR
Sbjct  298  TVGKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCLSSR  355



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 158/244 (65%), Gaps = 1/244 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK  L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   +P V
Sbjct  144  GVQLSSFKASLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSIEEIKELIPLV  203

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPG+ P+GCS +YL+ + TSN   YDP TGC+ WLN F E
Sbjct  204  ITTISSAITELIGMGGRTFLVPGDFPLGCSATYLTLYQTSNVEAYDPWTGCLTWLNKFGE  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             H+E LQ EL  L++L+PH  IIYADYY A +R+Y+ P  +GF N  L ACCG GGPYN 
Sbjct  264  NHDEQLQAELKKLQKLYPHVNIIYADYYKALLRIYQEPEKFGFMNRPLSACCGVGGPYNF  323

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+ +   C+ PS Y++WDG+H+TEAAY  I +G+L G +  P  N  C+ S  K
Sbjct  324  TSFWQCGTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGAYAVPPFNWSCLSSEIK  383

Query  26   TKIP  15
               P
Sbjct  384  DNGP  387



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score =   272 bits (696),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 164/242 (68%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   VP V
Sbjct  140  GVQLKSFKESLPKICGSPSDCRDMIENALILMGEIGGNDYNYAFFVRKSIEEIKELVPLV  199

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPGN PIGCS +YL+ + TSN  EYDP TGC+ WLN+F E
Sbjct  200  ITTISSAITELIGMGGRTFLVPGNFPIGCSVAYLTLYQTSNKKEYDPLTGCLAWLNEFGE  259

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH E LQ ELN L++L+PH  IIYADYYN  +R+++ P  +GF    L ACCG GG YN 
Sbjct  260  YHGEQLQVELNRLQKLYPHVNIIYADYYNPMLRIFQEPAKFGFISRPLPACCGVGGLYNY  319

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+++   C+ PS Y++WDG+HLTEAAY+W+ DGLL GP+  P  +  C+ S  K
Sbjct  320  TVGMQCGTEVVECCNDPSKYVNWDGVHLTEAAYRWLADGLLNGPYAIPPFDWSCLSSEIK  379

Query  26   TK  21
             K
Sbjct  380  NK  381


 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L + C +P+ C+E + +++I++G IGGNDYNYA   G   EE    VP V
Sbjct  469  GVQLKSFKESLLNLCGSPADCREMIGNALIIVGGIGGNDYNYASFVGKSIEETKELVPLV  528

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  432
            I+ I+STI ELI  G + ++VP + PIG S   +S+   S  S+
Sbjct  529  ISTISSTITELISMGGRTILVPSDFPIGYSNQTVSHVGGSLTSQ  572


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  230   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  51
             G GG YN N    CG++    C  PS Y+ WDG HLTE+ Y+WI  GLL GP+T P  + 
Sbjct  1292  GAGGMYNYNSVRQCGTKGVDCCLDPSKYVHWDGSHLTESTYRWIAMGLLEGPYTIPAFDW  1351

Query  50    ECI  42
              C+
Sbjct  1352  SCL  1354



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 157/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL-QGHPKEEVMSFVPKV  564
             +L WF+++  S C T + C ++   S+ ++GEIGGNDYNY FL  G   +EV  +VPKV
Sbjct  135  TQLRWFERLKPSLCNTATACADHFSKSLFVVGEIGGNDYNYFFLLGGKSPKEVKPYVPKV  194

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I + I  LIK GA  L+VPG LP GCS +YL+ F + N  +YDP+TGC+ WLN F +
Sbjct  195  IGAIVAAIESLIKNGAVNLLVPGILPFGCSSAYLTVFNSPNREDYDPRTGCLRWLNGFAK  254

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHN LL++ L+ LR  +P  RI+YADYY A+  + RSP ++GF  N   ACCGG GPYN 
Sbjct  255  YHNALLRRALDELRRKYPRARIMYADYYGASNPISRSPQHFGFGRNIFVACCGGDGPYNF  314

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
            +P A CG   STVC  PSSY++WDG HLTEAAY +I  GLL GP+T+P +
Sbjct  315  SPLALCGQPSSTVCSHPSSYVNWDGFHLTEAAYHFIATGLLEGPYTTPPL  364



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 155/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V  
Sbjct  151  QLGWFEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAG  210

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +A     LIK GA  L+VPGNLPIGCS +YL+   +SN S+YD  TGC+   NDF ++H
Sbjct  211  AVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHH  269

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +LQ +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  270  NAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  329

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  330  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  377



>gb|AFW80395.1| esterase [Zea mays]
Length=367

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 153/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P  CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V  
Sbjct  140  QLGWFEQLKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAA  199

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +      LIK GA  L+VPGNLP+GCS +YL+     N S+YD   GC+   NDF ++H
Sbjct  200  AVTDATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYD-AAGCLRTYNDFAQHH  258

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N +LQ++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  259  NAVLQRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNP  318

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  319  KASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  366



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 167/234 (71%), Gaps = 3/234 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++WFKQ+L S C + S CK  L +S+ L+GEIGGNDYN+ F QG   +E+ +FVP++
Sbjct  141  GTQIEWFKQLLPSLCSSSSDCKGILSNSLFLVGEIGGNDYNHPFFQGKTVDEIRTFVPRI  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI WLN+F+ 
Sbjct  201  ISAISSAINVLIQLGAKTLVVPGNFPIGCVSWYLQIFQSQRKEDYDSQTGCIKWLNEFSA  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            +HN LL  EL+ LR+LHPH  IIYADYY A + ++RSP  +GF+   L ACCGGGGPYN+
Sbjct  261  HHNRLLLDELDRLRQLHPHATIIYADYYKALLHIFRSPTQFGFKKAPLAACCGGGGPYNA  320

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            +    CG + +TVC+ PS Y+SWDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  321  S--VACGDRAATVCNDPSRYVSWDGMHLTEAAYKTIAQGLLEGPDTTPPITQAC  372



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 155/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V  
Sbjct  147  QLGWFEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAG  206

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +A     LIK GA  L+VPGNLPIGCS +YL+   +SN S+YD  TGC+   NDF ++H
Sbjct  207  AVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHH  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +LQ +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  266  NAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  325

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  326  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 155/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V  
Sbjct  147  QLGWFEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAG  206

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +A     LIK GA  L+VPGNLPIGCS +YL+   +SN S+YD  TGC+   NDF ++H
Sbjct  207  AVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHH  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +LQ +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  266  NAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  325

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  326  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/250 (49%), Positives = 166/250 (66%), Gaps = 7/250 (3%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G++++WF+Q+L S C + S C +   +S+ L+GEIGGNDYNY FLQ    +E++S+VP+V
Sbjct  142  GSQIEWFRQLLPSLCSSDSDCNDMFRNSLFLVGEIGGNDYNYPFLQARSLDEIVSYVPRV  201

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S I  LI+ GA+ L+VPGN PIGC+ +YL+ F ++ + +YD   GCI WLN F+ 
Sbjct  202  MDAISSAITALIELGARTLVVPGNFPIGCNSAYLTVFRSNRSEDYD-AIGCIKWLNKFSR  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNS  207
            +HN  L+  LN +R  +PH  +IYADYY+AAM L+ SP   GF  + L ACCGGGGPYN 
Sbjct  261  FHNNRLRVVLNRVRLRNPHATVIYADYYSAAMSLFSSPEPSGFRISPLPACCGGGGPYNY  320

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI-----  42
            N    CG+  S +C  PS YI+WDGMH+TEAAY+ I  GLL GP   P I   C      
Sbjct  321  NSSLQCGNSGSNICADPSIYITWDGMHMTEAAYRKIAIGLLKGPNAVPAILNTCPQTNQE  380

Query  41   LSRPKTKIPD  12
             SRP+  + D
Sbjct  381  FSRPQYVLSD  390



>ref|XP_003565548.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=373

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 157/228 (69%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWF+++  S C +P  CKEY   S+ L+GEIGGNDYNYAF +G   ++  S+VP V T
Sbjct  146  QLDWFEKLKPSLCNSPKNCKEYFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAT  205

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I      LIK GA  L+VPGNLP+GCS +YL+     N+S+YD   GC+   N+F + H
Sbjct  206  AIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGKNSSDYD-SVGCLKTYNEFAQRH  264

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            N ++Q++L  LR  +P  RI+YADYY AAM   ++P  +GF++  L+ CCGGGGPYN NP
Sbjct  265  NAMVQQKLQGLRRKYPQARIMYADYYGAAMSFAKNPKQFGFKHGPLKTCCGGGGPYNFNP  324

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CG + S+VC+ PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  325  KTSCGVRGSSVCEDPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  372



>ref|XP_008371712.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Malus 
domestica]
Length=434

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 154/215 (72%), Gaps = 1/215 (0%)
 Frame = -2

Query  683  CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILI  504
            C E+L  S+ILMGEIGGNDYN A L G   E+V  +VP VI  I  +INELI+ GA  L+
Sbjct  217  CSEFLSGSLILMGEIGGNDYNDALLGGKSIEQVQEYVPLVIEEIGLSINELIELGAATLL  276

Query  503  VPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHT  324
            VPGNLPIGC P YL+ +  S+ S+YDP TGC+NWLN F EY+NE LQ EL+ +R LHPH 
Sbjct  277  VPGNLPIGCLPIYLTNYEGSDESDYDPSTGCLNWLNKFVEYYNEQLQTELSRIRSLHPHV  336

Query  323  RIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSY  147
             IIYADYYNA M L  SP  +GF   + +ACCGGGG YN N  A CG + ++ C++P+ +
Sbjct  337  NIIYADYYNAMMYLXHSPEQFGFIGGSPKACCGGGGTYNYNSSAQCGMRQASACENPAEF  396

Query  146  ISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
            ISWDG+H TEAAY+WI + LL G +T P+I+  C+
Sbjct  397  ISWDGIHFTEAAYKWITNALLKGNYTDPRISSLCV  431



>ref|NP_001149156.1| esterase precursor [Zea mays]
 gb|ACG34406.1| esterase precursor [Zea mays]
Length=370

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 153/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P  CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V  
Sbjct  143  QLGWFEQLKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAA  202

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +      LIK GA  L+VPGNLP+GCS +YL+     N S+YD   GC+   NDF ++H
Sbjct  203  AVTDATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYD-AAGCLRTYNDFAQHH  261

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N +LQ++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  262  NAVLQRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNP  321

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  322  KASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  369



>gb|AAL86351.1| putative lipase [Arabidopsis thaliana]
Length=243

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 155/225 (69%), Gaps = 1/225 (0%)
 Frame = -2

Query  689  SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQI  510
            S C++ +E+++ILMGEIGGNDYN+A  Q  P +EV   VP VI  I+S I EL+  G + 
Sbjct  1    SDCRDMIENALILMGEIGGNDYNFALFQRKPVKEVEELVPFVIATISSAITELVCMGGRT  60

Query  509  LIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHP  330
             +VPGN PIG S SYL+ + TSN  EYDP TGC+ WLNDF+EY+N+ LQ+ELN LR+L+P
Sbjct  61   FLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYP  120

Query  329  HTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPS  153
            H  IIYADYYNA +RL++ P  +GF N  L ACCG GG YN N    CGS     CD PS
Sbjct  121  HVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNFSRRCGSVGVEYCDDPS  180

Query  152  SYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKI  18
             Y+++DG+H+TEAAY+ I +GLL GP+  P     C+ S    K+
Sbjct  181  QYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNKM  225



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 159/236 (67%), Gaps = 1/236 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK++L S C TPS CK+ L  S+IL+GEIGGNDYN+ F +G   E +   VP VI 
Sbjct  186  QLGLFKELLPSLCSTPSDCKKLLGESLILLGEIGGNDYNHPFFEGINFETIQDLVPYVIN  245

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   I ELI+ GA  ++VPGNLPIGCSPSYL+ F  S+  +YD  TGC+NWLN F + H
Sbjct  246  TIGLAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKKDYDHLTGCLNWLNKFAQEH  305

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNP  201
            NE L KEL  +++LHPH +IIYADYYNAAM  Y SPN +GF    L++CCG GG YN N 
Sbjct  306  NEQLIKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGFTGGVLKSCCGWGGMYNYNS  365

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
               CG+ L +VCD P+S+++WDG+H TEA Y+ I + ++ G  + P     C L+ 
Sbjct  366  LVKCGNPLVSVCDDPTSFVNWDGIHYTEATYKLIFESIIEGSNSYPSFKAFCNLNH  421



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 158/235 (67%), Gaps = 1/235 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK++L S C TPS CK+ L  S+IL+GEIGGNDYN+ F +G   E +   VP VI 
Sbjct  142  QLGLFKELLPSLCSTPSDCKKLLGDSLILLGEIGGNDYNHPFFEGINFETIQDLVPYVIN  201

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   I ELI+ GA  ++VPGNLPIGCSPSYL+ F  S+  +YD  TGC+ WLN F + H
Sbjct  202  TIGLAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKKDYDHFTGCLKWLNKFAQEH  261

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNP  201
            NE L KEL  +++LHPH +IIYADYYNAAM  Y SPN +GF    L++CCG GG YN N 
Sbjct  262  NEQLMKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGFTGGVLKSCCGWGGMYNYNS  321

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
               CG+ L + CD P+S+++WDG+H TEA Y+ I + ++ G ++ P     C L+
Sbjct  322  LVNCGNPLVSACDDPTSFVNWDGIHYTEATYKLIFESIIEGSYSYPSFKAFCYLN  376



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/254 (50%), Positives = 164/254 (65%), Gaps = 2/254 (1%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G ++  FK+ L + C  PS CK  + +++ILMGEIGGND+N  F Q  
Sbjct  132  ERGYHCPHNISLGVQVKVFKESLPNLCGLPSDCKNMIGNALILMGEIGGNDHNGPFFQRR  191

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
            P +EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP 
Sbjct  192  PIDEVKELVPLVISTISSAITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYDP-  250

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
             GC+ WLN F EYH+E L+ EL  LR+L+ H  IIYADYYNA + L + P  YGF N  L
Sbjct  251  FGCLKWLNKFGEYHDEQLEAELKRLRKLNHHVNIIYADYYNALLGLNQEPTKYGFINKPL  310

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN N    CGS     C+ PS Y++WDG+H+TEAAY+++ DG+L GP+TSP
Sbjct  311  SACCGVGEPYNFNFSTCCGSFGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSP  370

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  371  PFNWTCLSSKIKNK  384



>ref|XP_004968625.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=374

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 154/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P +CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V  
Sbjct  147  QLGWFEQLKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAG  206

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +      LIK GA  L+VPGNLP+GCS +YL+     N S+YD   GC+   NDF ++H
Sbjct  207  AVTDATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYD-AAGCLKTYNDFAQHH  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N +LQ++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  266  NAVLQQKLQALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNP  325

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEAAY  I + +L GP+TSP++
Sbjct  326  KASCGVRGSSVCTDPSAYANWDGVHLTEAAYHAIANSILNGPYTSPRL  373



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 159/234 (68%), Gaps = 4/234 (2%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
             +L WFK +L S C + S C E  +SS+ LMG  GGNDY  AFLQG   EE  S VP VI
Sbjct  151  TQLRWFKGLLPSLCNS-SSCSEVFKSSLFLMG-FGGNDYGKAFLQGKSLEETKSLVPLVI  208

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
            +   S INELI  G   ++V G LP GCSP+ L+YF +SN  +YD  TGC++WLNDF+ Y
Sbjct  209  SATGSAINELIDLGVVNIMVNGLLPDGCSPAMLTYFKSSNKEDYDTATGCLSWLNDFSNY  268

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGG-PYNS  207
            HNELLQ+ELN +R  HP   I+YADY+N  M+L+RSP   GF   +L ACCG GG PYN 
Sbjct  269  HNELLQEELNGVRANHPDALILYADYFNPLMQLFRSPEQNGFGGRSLMACCGDGGPPYNY  328

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N  A CG   ST C  PS YISWDG+HLTEAAY+++  GLL GP+T+P+IN  C
Sbjct  329  NFSAQCGEPASTACAWPSLYISWDGIHLTEAAYRFMAKGLLEGPYTTPRINPLC  382



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 162/248 (65%), Gaps = 1/248 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK  L+  C +PS CK+ +E+++ILMGEIGGNDYNYAF      EE+ + +P V
Sbjct  141  GVQLSSFKASLTKLCGSPSDCKDMIENALILMGEIGGNDYNYAFFVKKSIEEIKALIPLV  200

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            IT I+S I ELI  G +  +VPG+ P+GCS  YL+ + TSN   YDP TGC+ WLN F E
Sbjct  201  ITTISSAITELIDMGGRTFLVPGDFPLGCSAIYLTSYQTSNMEAYDPLTGCLTWLNKFGE  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
             HN+ LQ ELN L +L+PH  IIYADYYNA +R+Y+ P+ +GF N  L ACCG GGPYN 
Sbjct  261  NHNKQLQAELNRLLKLYPHVNIIYADYYNALLRIYQEPSKFGFMNRPLSACCGVGGPYNF  320

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+ +   C  PS Y++WDG+H+TEAAY  I +G+L GP+  P  +  C+ S  K
Sbjct  321  TSFWQCGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAVPPFDWSCLSSEIK  380

Query  26   TKIPDS*R  3
               P   R
Sbjct  381  DNGPSEKR  388


 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 155/240 (65%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK  L +FC +PS C + +E+++ILMGEIG NDY Y F  G   +EV   +P VIT
Sbjct  567  QLSSFKASLPNFCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGKSLQEVKELIPLVIT  626

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EYDP TGC+ WLN F E H
Sbjct  627  TISSAITELISMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCLTWLNKFGENH  686

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            +  L+ ELN +++L+PH  IIY DYYNA +R Y+ P  +GF +  L ACCG GGPYN   
Sbjct  687  DAQLRAELNRIQKLYPHVNIIYVDYYNALLRFYQEPAKFGFMDRPLPACCGVGGPYNYTS  746

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CG+ +   C  PS Y++WDG+H+TEAAY+ + +G+L GP+  P  +  C+ S  K K
Sbjct  747  VTQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPLFDWSCLSSEIKDK  806



>gb|KJB63193.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=399

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 156/217 (72%), Gaps = 1/217 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G E++ FK +L S C + S CKE L +S+I+MGEIGGNDYN+AF+QG   E +   VP V
Sbjct  148  GVEVNSFKHLLPSLCSSSSNCKELLRNSLIVMGEIGGNDYNHAFMQGKNIENIRQLVPLV  207

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            + +I+S+INELI+ GA   +VPGN PIGCSPS L+ F  S   +YDP TGC+ WLN F++
Sbjct  208  VDIISSSINELIELGAMTFLVPGNFPIGCSPSLLTKFHGSERDQYDPLTGCLTWLNRFSQ  267

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            +HNELL+KEL ++R LHP   IIY DYY AA+R Y SP  +GF+ TL+ACCG GG YN +
Sbjct  268  HHNELLRKELENIRSLHPQINIIYVDYYKAAVRFYHSPKQFGFKETLKACCGIGGLYNYD  327

Query  203  PHAYCG-SQLSTVCDSPSSYISWDGMHLTEAAYQWIV  96
            P  +CG  QL   C+ PSSYISWDG+H TEA  +W+ 
Sbjct  328  PLIFCGYPQLKQCCNDPSSYISWDGIHYTEAVNKWLA  364



>ref|XP_007148064.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
 gb|ESW20058.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
Length=380

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 156/229 (68%), Gaps = 2/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++L S C + S CK  + +S+ ++GEIGGNDY Y   +     +++ ++P+V++
Sbjct  141  QLDWFKKLLPSLCNSSSGCKNLIGNSLFMVGEIGGNDYGYPLSKTTAFGDLVPYIPQVVS  200

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
            VI + I ELI  GA   +VPG LP+GC+ +YL+ F T++  EYD Q GC+ WLN F EYH
Sbjct  201  VITAVIRELIDLGAVTFMVPGMLPLGCNSAYLTRFETTDKEEYD-QVGCLKWLNTFYEYH  259

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            NELLQ ELN LR L+ HT IIYADY+NAA++LY+SP  +GF  N L+ CCG  G YN N 
Sbjct  260  NELLQIELNQLRGLYSHTNIIYADYFNAALQLYKSPEQFGFGGNVLKVCCGVDGSYNYND  319

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
               CG      CD PS YISWDG H+TEAAY+WI   LL G +T PK N
Sbjct  320  TYKCGEAGVVACDDPSQYISWDGYHMTEAAYRWIAIALLDGSYTIPKFN  368



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 159/241 (66%), Gaps = 2/241 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            GN+L  FK+ L   C + S  C++ +E++ IL+GEIGGNDYN+        EEV   VP 
Sbjct  136  GNQLKSFKESLPYLCGSSSPDCRDMIENAFILIGEIGGNDYNFPLFDRKNIEEVKELVPL  195

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            VIT I+S I+EL+  GA+  +VPGN P+GCS +YL+ + T N  EY+P TGC+ WLNDF+
Sbjct  196  VITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFS  255

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYN  210
             YHNE LQ EL  LR L+PH  IIY DYYN  +RL + P+ +G  +  L ACCG GGPYN
Sbjct  256  VYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYN  315

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRP  30
                  CGS+    C  PS Y++WDG+H+TEAAY+WI +G+L GP+  P  N  C+ S+ 
Sbjct  316  FTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNWSCLDSKI  375

Query  29   K  27
            K
Sbjct  376  K  376



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 159/241 (66%), Gaps = 2/241 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            GN+L  FK+ L   C + S  C++ +E++ IL+GEIGGNDYN+        EEV   VP 
Sbjct  140  GNQLKSFKESLPYLCGSSSPDCRDMIENAFILIGEIGGNDYNFPLFDRKNIEEVKELVPL  199

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            VIT I+S I+EL+  GA+  +VPGN P+GCS +YL+ + T N  EY+P TGC+ WLNDF+
Sbjct  200  VITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFS  259

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYN  210
             YHNE LQ EL  LR L+PH  IIY DYYN  +RL + P+ +G  +  L ACCG GGPYN
Sbjct  260  VYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYN  319

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRP  30
                  CGS+    C  PS Y++WDG+H+TEAAY+WI +G+L GP+  P  N  C+ S+ 
Sbjct  320  FTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNWSCLDSKI  379

Query  29   K  27
            K
Sbjct  380  K  380



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 165/255 (65%), Gaps = 2/255 (1%)
 Frame = -2

Query  782  GERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  603
             ER Y   +    G +L  FK+ L + C  PS C++ + +++ILMG+IG NDYN  F + 
Sbjct  131  AERGYHCRNNISLGVQLKIFKESLPNLCGLPSDCRDMIGNALILMGDIGANDYNLLFFKR  190

Query  602  HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  423
             P  EV   VP VI+ I+S I ELI  G +  +VPG  P GCS +YL+ + TSN +EYD 
Sbjct  191  RPFHEVKELVPLVISTISSAITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLAEYD-  249

Query  422  QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENT  246
              GC+ WLN F+EYH+E LQ EL  LR+L+PH  II+ADYYN  +RL + P+ YGF +  
Sbjct  250  SLGCLKWLNKFSEYHDEQLQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFTKEP  309

Query  245  LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  66
            L ACCG GGPYN N +  CGS     C+ PS Y++WDG+H+TEAAY+ + DGLL GP+ +
Sbjct  310  LYACCGVGGPYNFNFNTKCGSVEVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGPYAT  369

Query  65   PKINGECILSRPKTK  21
            P  N  C+ S+ K K
Sbjct  370  PPFNWSCLSSKIKNK  384



>emb|CDM83549.1| unnamed protein product [Triticum aestivum]
Length=389

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 155/229 (68%), Gaps = 1/229 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C    + C + +  S+ L+GEIGGNDYN     G P E++ +F P +I
Sbjct  138  EMAWFRDLLGLLCPGGVADCMDMMSKSLFLVGEIGGNDYNLPLFYGVPFEKIHTFTPSII  197

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI EL++ GA+ L+VPGNLPIGC P+YL+ +M+    +Y+P+TGCI W+N+F++Y
Sbjct  198  AKISSTIAELVELGAKTLLVPGNLPIGCIPAYLTTYMSDKMEDYEPETGCIRWMNEFSQY  257

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL  EL +LR+LHP   IIYADYY AAM ++ SP  +G E+ L ACCGGGGPY  + 
Sbjct  258  HNKLLVDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSA  317

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG     VCD P  Y SWDG H TEA Y+ I +GLL G +T P I+
Sbjct  318  TAGCGHGDYKVCDDPQEYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  366



>gb|EAY75182.1| hypothetical protein OsI_03072 [Oryza sativa Indica Group]
Length=310

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 151/232 (65%), Gaps = 5/232 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C      CK  +  S+ L+GEIGGNDYNY  + G P E++ SF P VI
Sbjct  54   EMGWFRDLLDMLCAGDMDGCKGMMNQSLFLVGEIGGNDYNYPLMSGVPIEKIRSFTPSVI  113

Query  560  TVIASTI----NELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLND  393
              I+STI     ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+ GC+ W+N+
Sbjct  114  AKISSTITLSSQELIGLGAKTLVVPGNLPIGCIPTYLMQFESDKKEDYEPEIGCLRWMNE  173

Query  392  FTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPY  213
            F++YHN+L   EL +LR+LHP   IIY DYY AAM ++ SP  +G E+ L ACCGGGGPY
Sbjct  174  FSQYHNKLFIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPY  233

Query  212  NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
              +  A CG     VCD PS Y SWDG H +EAAY+ I  GLL GP+T P I
Sbjct  234  GVSASAGCGYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  285



>ref|XP_006844513.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
 gb|ERN06188.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
Length=387

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 150/232 (65%), Gaps = 2/232 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+WF Q+L S C+  S CKE+++ S+ L+GEIGGND N+AF QG   EEV +FVP +
Sbjct  136  GVQLEWFHQLLPSLCKPYSDCKEFMKKSMFLVGEIGGNDCNFAFFQGKSTEEVKAFVPSI  195

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I    +E I  G + L++PGNLPIGCS +YL+ F T +  EYDP TGC+   NDF  
Sbjct  196  INTIMKAASEFINEGVETLVIPGNLPIGCSTAYLTMFQTQDKQEYDPDTGCLKRFNDFAI  255

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYN  210
            Y+N  LQ  +  +R+  PH   IYADYYNAA+R ++SP  +G   E    ACCG G  YN
Sbjct  256  YYNSKLQDAIQVMRQKFPHATTIYADYYNAALRFFKSPEAFGLAKETVHSACCGVGDRYN  315

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             N +  CG+   T C  P+SYISWDGMHLTE AY++I   LL G FT P + 
Sbjct  316  FNFNRMCGTSGVTACSDPASYISWDGMHLTETAYKFITASLLSGEFTDPPLR  367



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 156/235 (66%), Gaps = 1/235 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WF+Q+L S C +P+ C++ L++++ LMGEIGGNDYN+   QG   +E  SFVP V+ 
Sbjct  136  QIRWFQQLLPSLCASPTDCEDMLQNTLFLMGEIGGNDYNFPLSQGRSLQETESFVPLVVD  195

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S IN+LI+ GA+ L+VPG  P+GC+  YL+ + +  A +YD   GCI WLN+F++YH
Sbjct  196  TISSGINKLIELGARALLVPGITPLGCNTVYLTTYRSDRAEDYD-AIGCIRWLNEFSQYH  254

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N  L  E+  L+ LHP   IIYADYY A M ++  P  +G E    ACCGGGGPYN N  
Sbjct  255  NGHLHDEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEERFLACCGGGGPYNYNSS  314

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
              CGS+  TVCD  S+Y+ WDG+H+TEA Y+ +  GLL GPF  P I   C  +R
Sbjct  315  RPCGSEGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGPFAVPAIATTCPATR  369



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 160/242 (66%), Gaps = 4/242 (2%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L S C +PS   + + +++IL+GEIGGNDYNY F      EEV   VP V
Sbjct  143  GVQLTNFKESLRSLCGSPS---DMIGNALILIGEIGGNDYNYPFFGHKNIEEVKELVPLV  199

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+STI EL+  G +  +VPG+ P+GCS  YL+ + TSN   YDPQTGC+ WLN+F+E
Sbjct  200  ISTISSTITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKEAYDPQTGCLTWLNEFSE  259

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHNE LQ ELN LR+L+P+  IIY DYYNA +RL + P  +G   N L  CCG GG YN 
Sbjct  260  YHNEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMNNPLPVCCGLGGRYNY  319

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG +    C+ PS Y++WDG+H+TEAAY+WI +GLL GP+ +P  +  C+ S  K
Sbjct  320  TFGVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATPPFDWSCLSSEIK  379

Query  26   TK  21
             K
Sbjct  380  DK  381



>ref|XP_007020872.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12397.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=344

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 164/237 (69%), Gaps = 4/237 (2%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G EL +F+ +LSS C + S C++ L +S+I+MGEIGGNDYN+AF +G   EE    VP V
Sbjct  96   GVELGFFRDVLSSLCSSSSDCRKLLSNSLIVMGEIGGNDYNFAFEEGKSNEETRELVPLV  155

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  IAS I+ELI+ GA   +VPGNLP GC PS L+ F  S+  EYDP TGC+ WLN F+E
Sbjct  156  IDTIASAIHELIELGAVTFLVPGNLPFGCFPSCLTNFEGSDEEEYDPLTGCLTWLNQFSE  215

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYN  210
            YHN+LLQ+EL  ++E+HPH  I+YADYY+AA+R Y SP  +GF  E   +ACCGGGGPYN
Sbjct  216  YHNQLLQEELARIQEIHPHVNIVYADYYSAAIRFYLSPKQFGFRKETLTKACCGGGGPYN  275

Query  209  SNPHAYCGSQLST-VCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS-PKINGEC  45
             N  A CG  L T  CD PSSY+SWDG+H TEAA + +   +L G  T+ P  N  C
Sbjct  276  FNLSAICGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAILDGLHTNFPISNSLC  332



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 153/226 (68%), Gaps = 1/226 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  Y + ++ L+GEIGGNDYNYAF  G   +++ + VP V+ 
Sbjct  141  QLGWFKKLKPSLCSTKQECDNYFKKTLFLVGEIGGNDYNYAFFVGGNIKQLKASVPYVVG  200

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I +  + LI+ GA  L+VPGNLPIGCS  YL+ F T N S YD + GC+   N F++YH
Sbjct  201  AITNATSALIEEGAVELLVPGNLPIGCSAVYLTLFQTPNRSYYDKRNGCLKAFNTFSKYH  260

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N  L++ L  LR+ +PH  IIYADYY AAM  + +P +YGF++ TL ACCGGGGPYN N 
Sbjct  261  NSELKRALATLRQKYPHVNIIYADYYGAAMPFFHAPQHYGFKSGTLRACCGGGGPYNFNN  320

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             A CG   ST C  PSSY++WDG+HLTEAAY++I  GL+ G FT P
Sbjct  321  SARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHGQFTKP  366



>ref|XP_002456052.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
 gb|EES01172.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
Length=399

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 155/228 (68%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E++WF+ +L   C    + C + +  S+ L+GEIGGNDYN+  L G P E++ +  P V+
Sbjct  147  EMEWFRDLLHLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNFPLLSGVPLEKIRTMTPSVV  206

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI+ELI+ GA+ L+VPGNLPIGC P YL  F +    +Y+PQTGC+ W+N+F++Y
Sbjct  207  AKISSTISELIQLGAKTLMVPGNLPIGCVPDYLMIFKSDKEEDYEPQTGCLRWMNEFSQY  266

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL +EL  LR+LHP   IIYADYY AAM ++ SP  YG E+ L ACCGG GPY  +P
Sbjct  267  HNKLLVEELKKLRKLHPGVTIIYADYYGAAMEIFLSPEQYGIEHPLVACCGGEGPYGVSP  326

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CG     +CD+P  Y SWDG H +E+AY+ I  GLL+G +T P I
Sbjct  327  TITCGFGEYKLCDNPEKYGSWDGFHPSESAYRAIATGLLLGSYTRPSI  374



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 160/234 (68%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L + C + + C E L +S+ L+GEIGGND+N+ F       EV ++VP VI 
Sbjct  147  QLNWFKELLPTLCNSSTGCHEVLRNSLFLVGEIGGNDFNHPFSIRKSIVEVKTYVPYVIN  206

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S INELI  GA+ LIVPGN PIGCS SYL+ + T   ++YD Q GC+ WLN F EY+
Sbjct  207  AISSAINELIGLGARTLIVPGNFPIGCSASYLTIYETEYKNQYD-QFGCLKWLNKFAEYY  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N  LQ EL+ LR L+P   IIYADY+NAA+  YR P  +GF   L+ CCG GGPYN N  
Sbjct  266  NNELQSELDKLRRLYPRANIIYADYFNAALLFYRDPTKFGFTG-LKVCCGMGGPYNYNTS  324

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
            A CG+   + CD PS +I WD +HLTEAAY+ + +GL+ GP+  P+IN  C+++
Sbjct  325  ADCGNPGVSACDDPSKHIGWDSVHLTEAAYRIVAEGLIKGPYCLPQINTLCLMN  378



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 153/232 (66%), Gaps = 5/232 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK +L S C T   C + +  S+  +GEIGGNDYN+AF QG   +E+ +FVP V++
Sbjct  153  QLEWFKHLLPSLCAT--NCSDLMSESLFSVGEIGGNDYNHAFFQGRGVDEIKTFVPGVVS  210

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S I ELIK GA+ +IVPGN PIGC   YL+ F +    +Y+  TGCI WLN F+ YH
Sbjct  211  AIGSAIEELIKLGARTMIVPGNFPIGCVAVYLTMFQSDRREDYESGTGCIEWLNQFSMYH  270

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N  L  EL  LR  +P   IIYA+YY AAM ++RSP  YGF    L ACCGGGGPYN N 
Sbjct  271  NRHLLDELTQLRRRYPQATIIYANYYEAAMAIFRSPQEYGFGKFPLAACCGGGGPYNYNH  330

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               CG   + VC SPSS ISWDG+HLTEAAY+ I  GLL GP+T P ++  C
Sbjct  331  STKCGKD-AGVCSSPSSQISWDGIHLTEAAYRVIARGLL-GPYTIPSLSRSC  380



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 154/232 (66%), Gaps = 15/232 (6%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCK-EYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +++WFKQ+L S   TPS  +   L +S+ L+GEIGGNDYN+ F Q    EE+ +FVP V+
Sbjct  138  QIEWFKQLLRS---TPSVSEPSILGNSLFLVGEIGGNDYNHPFFQNRRVEEIRTFVPSVV  194

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +LIK GA+ L+VPGNLPIGC P YL+ F T    +YD +TGCI WLN+F++Y
Sbjct  195  KAISSAITDLIKLGAKNLVVPGNLPIGCVPVYLTQFQTQKLDDYDAKTGCIRWLNEFSQY  254

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN LLQ E+  +R LHP+  I YADYY +AMRL+ SP  +GF+  L ACC G        
Sbjct  255  HNRLLQDEIERVRGLHPNATIAYADYYESAMRLFESPKQFGFKEPLSACCVG--------  306

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               CG   + +C  PSSY SWDG+HLTEAAY+ I +GLL GP   P +N  C
Sbjct  307  ---CGGPSAKLCSDPSSYASWDGLHLTEAAYRTIANGLLKGPLAVPSLNQTC  355



>gb|KCW76151.1| hypothetical protein EUGRSUZ_D00528 [Eucalyptus grandis]
Length=263

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+ + SS C T   C EY + S+ L+GEIG NDYN++FL G   E++   VP+++ 
Sbjct  34   QLGWFQSLKSSLCTTKQECDEYFKKSLFLVGEIGENDYNFSFLFGRTIEQLRPLVPQIVG  93

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YH
Sbjct  94   AIIRAVSILIEEGAVNLVVPGQLPTGCISLYLTLFQSANESAYDPKTGCLKAYNALFKYH  153

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL  LRE +PH R++YADYY A++ +YR+P  YGF    L ACCGGGGPYN N 
Sbjct  154  NNYLKQELQKLREQYPHARVMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  213

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             AYCG   STVC  PS+++ WDG+H TE+AY +I  GL+ G F SP +
Sbjct  214  SAYCGQPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  261



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 160/243 (66%), Gaps = 2/243 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            GN+L  FK+ L   C + S  C++ + ++ IL+GEIGGNDYN+        EEV   VP 
Sbjct  140  GNQLKSFKESLPYLCGSSSVDCRDMIGNAFILIGEIGGNDYNFPLFDRKNIEEVKELVPL  199

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            VIT I+S I+EL+  GA+  +VPGN P+GCS +YL+ + TSN  EY+P TGC+ WLNDF+
Sbjct  200  VITTISSVISELVDMGARTFLVPGNFPLGCSVAYLTLYETSNEEEYNPLTGCLTWLNDFS  259

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYN  210
             YHNE LQ ELN LR+L+PH  IIY DYYN  +RL + P+ +G  +  L ACCG GGPYN
Sbjct  260  VYHNEQLQAELNRLRKLYPHVNIIYGDYYNTLLRLVQEPSKFGLMDRPLPACCGVGGPYN  319

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRP  30
                  CGS+    C  PS Y++WDG+H+TEAAY+ I +G+L GP+  P  +  C+ S  
Sbjct  320  FTFSIQCGSKGVEYCSDPSKYVNWDGIHMTEAAYKCISEGILKGPYAIPPFDWSCLSSEI  379

Query  29   KTK  21
            K K
Sbjct  380  KNK  382



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 163/240 (68%), Gaps = 1/240 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK  L + C + S C++ +E+++ILMGEIGGNDYNYAF  G P +E+   VP V
Sbjct  505  GVQLRSFKDSLPNLCGSSSDCRDMMENALILMGEIGGNDYNYAFFLGKPIQEIKELVPFV  564

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S I ELI  G +  +VPG+ P+GCS +YL+ + TSN  EYDP+TGC+ WLN F E
Sbjct  565  ISSISSAIKELINMGGRTFLVPGDFPLGCSVAYLTIYQTSNMEEYDPKTGCLKWLNKFGE  624

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            Y+N+ LQ ELN L++L+PH  IIYADYYNA  RL++ P  +GF N  L ACCG GG YN 
Sbjct  625  YYNKQLQAELNKLQKLYPHVNIIYADYYNAVSRLFQEPAKFGFMNRPLPACCGLGGSYNF  684

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG Q    C+ P+ Y++WDG+HLTE+AY+ I +GLL GP+  P  +  C+ S  K
Sbjct  685  TFGRKCGFQGVECCNDPTKYVNWDGVHLTESAYRLIAEGLLKGPYAIPPFDWSCLSSEIK  744


 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 157/242 (65%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G ++  FK+ L + C +PS C++ + +++ILMGEIGGNDYNY F      EE+   VP V
Sbjct  146  GVQIQSFKESLLNLCGSPSDCRDMIGNALILMGEIGGNDYNYPFFGRKTIEEIKELVPLV  205

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I EL+  G +  +VPGN P+GCS  YL+ + T N  +YDP TGC+ WLN+F+E
Sbjct  206  INTISSAITELVDMGGKTFLVPGNFPLGCSVIYLTLYQTPNKEDYDPLTGCLTWLNEFSE  265

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YHNE LQ ELN LR+L+PH  IIY DYYNA +RL + P  +G     L  CCG GG YN 
Sbjct  266  YHNEKLQTELNRLRKLYPHVNIIYGDYYNALLRLIQEPAKFGLMSRPLPVCCGSGGTYNF  325

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CGS+    CD PS Y++WDG+H+TE AY+ I +GLL GP++ P  +  C+ S  +
Sbjct  326  TFGVKCGSKGVGYCDDPSKYVNWDGVHMTETAYRLIAEGLLKGPYSIPPFDWSCLSSEIE  385

Query  26   TK  21
             K
Sbjct  386  NK  387



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 160/234 (68%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L + C + + C E + +S+ LMGEIGGND+NY F       EV ++VP VI 
Sbjct  152  QLNWFKELLPALCNSSTDCHEVVGNSLFLMGEIGGNDFNYPFFLQRSVAEVKTYVPYVIR  211

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S +NELI  GA+ LIVPGNLP+GCS +YL+ + T + ++YD Q GC+ WLN+F EY+
Sbjct  212  AITSAVNELIGLGARTLIVPGNLPLGCSINYLTIYETMDKNQYD-QYGCLKWLNEFAEYY  270

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N+ LQ EL+ LR LH H  IIYADYYNA + LY +   +GF N L+ CCG GGPYN N  
Sbjct  271  NQKLQSELDRLRGLHSHANIIYADYYNATLPLYHNTTMFGFTN-LKTCCGMGGPYNYNAA  329

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
            A CG   +  CD PS +I WD +H TEAAY+ I +GL+ GP+  P+ N  C+++
Sbjct  330  ADCGDPGAIACDDPSKHIGWDSVHFTEAAYRIIAEGLIKGPYCLPQFNTFCLMN  383



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 160/235 (68%), Gaps = 2/235 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +   FK+ L + C +P+ C+E + ++++++GEIGGNDYNY FL G   EE+   VP V
Sbjct  145  GVQFKNFKESLPNICGSPADCREMIGTALLIVGEIGGNDYNYGFLVGKTVEELKELVPLV  204

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+  I EL+K G + ++VP + PIGC  ++L+ +  SN  EYDP TGC+ WLN+F E
Sbjct  205  ISSISFMITELVKMGGKTIMVPADFPIGCWTAFLTEYRISNNEEYDPLTGCLKWLNEFIE  264

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN--TLEACCGGGGPYN  210
            YHN+ LQ+ELN +++++PH  IIYADYYNA +R+++ P  +GF +   L A CG GGPYN
Sbjct  265  YHNKELQEELNRVQKIYPHVTIIYADYYNALLRIFQEPAKFGFTSGRPLSAFCGTGGPYN  324

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             N  ++CG++    C  PS Y+ WDG HLTE+AY+WI  G L GP+T P  +  C
Sbjct  325  FNSMSWCGTKKVDSCSDPSKYVHWDGFHLTESAYRWIAMGFLKGPYTIPAYDWSC  379



>gb|EMT27195.1| GDSL esterase/lipase [Aegilops tauschii]
Length=403

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            G E+ WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F P 
Sbjct  149  GVEMKWFHDLLDLLCPADRADCMGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPS  208

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            V+  I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+F+
Sbjct  209  VVAKISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNEFS  268

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNS  207
            +YHN LL  EL  LR+LHP   IIYADYY AAM +YRSP  +G ++ L ACCGGGGPY  
Sbjct  269  KYHNRLLIDELEKLRKLHPGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGV  328

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            +  A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  329  SMTARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  379



>ref|NP_973930.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30995.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=317

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 149/220 (68%), Gaps = 1/220 (0%)
 Frame = -2

Query  683  CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILI  504
            C++ +E+S+ILMGEIGGNDYNYAF  G   EE+   VP VI  I+S I ELI  G +  +
Sbjct  89   CRDMIENSLILMGEIGGNDYNYAFFVGKNIEEIKELVPLVIETISSAITELIGMGGKTFL  148

Query  503  VPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHT  324
            VPG  P+GCS +YLS + TSN  EYDP TGC+ WLN F+EYH+E LQ ELN L++L+PH 
Sbjct  149  VPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHV  208

Query  323  RIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSY  147
             IIYADYYN  +RL + P  +GF    L ACC  GGP+N       G+Q+   CD PS Y
Sbjct  209  NIIYADYYNTLLRLAQEPAKFGFISRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKY  268

Query  146  ISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            +SWDG+H+TEAAY+ + +G+L GP+  P  +  C+ S  K
Sbjct  269  VSWDGVHMTEAAYRLMAEGILKGPYAIPPFDWSCLSSEIK  308



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 157/235 (67%), Gaps = 1/235 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++  FKQ+L S        K+ L SS+ILMGEIGGNDYN  F QG   +E+  FVP VI+
Sbjct  141  QIQLFKQLLPSIAAG-RDPKDVLNSSLILMGEIGGNDYNQPFFQGIKLDEIRPFVPSVIS  199

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S IN+LI+ GA+ L+VPGN PIGC P YL  + + N  EY+  TGCI WLN+ ++YH
Sbjct  200  AISSGINDLIELGAKTLLVPGNFPIGCVPVYLDIYKSYNVEEYESDTGCIKWLNELSKYH  259

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N LL  EL+ LR+LHP+  IIYA+YY+A +  +R+P  +GF+  L ACCG  GPY+ N +
Sbjct  260  NRLLLAELDRLRKLHPNVMIIYANYYDAMISFFRAPEVFGFKAPLHACCGSDGPYSVNRN  319

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
            A CG + + VC  PSS +SWDG+HLTEAAY  I   LL GP  +P +   C  +R
Sbjct  320  APCGHRNAKVCSDPSSSVSWDGIHLTEAAYGTIASSLLEGPHANPPLTRACSSTR  374



>ref|NP_001149094.1| LOC100282715 precursor [Zea mays]
 gb|ACG34180.1| esterase precursor [Zea mays]
 gb|ACN34799.1| unknown [Zea mays]
 tpg|DAA58332.1| TPA: esterase [Zea mays]
Length=399

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C    + C + +  S+ L+GEIGGNDYN   L G P EE+ +  P V+
Sbjct  147  EMKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNGPLLSGVPFEEIRAITPSVV  206

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI+ELI+ GA+ L+VPGNLPIGC P YL  F ++   +YDPQTGC+ W+N+F++Y
Sbjct  207  AKISSTISELIQLGAKTLVVPGNLPIGCVPKYLMIFKSNKKEDYDPQTGCLRWMNEFSQY  266

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL ++L  LR LHP   IIYADYY AAM ++ SP  YG E  L ACCG  GPY  +P
Sbjct  267  HNKLLVEQLKKLRRLHPGVTIIYADYYGAAMEIFLSPERYGIEYPLVACCGAEGPYGVSP  326

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CG     +CD+P  Y SWDG+H TE+AY+ I  GLL+G +T P I
Sbjct  327  TTSCGLGEYKLCDNPERYGSWDGLHPTESAYKVIAMGLLLGSYTRPPI  374



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 161/255 (63%), Gaps = 2/255 (1%)
 Frame = -2

Query  782  GERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  603
             ER Y   H    G +L  FK+ L   C  PS C++ + +++ILMG+IG NDYN  F + 
Sbjct  131  AERGYHCRHNISLGVQLKIFKESLPDLCGLPSDCRDMIGNALILMGDIGANDYNLPFFEH  190

Query  602  HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  423
             P +EV   VP VI+ I+S I ELI  G +  +VPG  P GCS +YL+ + TSN  EYD 
Sbjct  191  RPFDEVKELVPLVISTISSAITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLEEYD-  249

Query  422  QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENT  246
              GC+ WLN F EYH+E LQ EL  LR+L+PH  II+ADYYN  +RL + P+ YGF +  
Sbjct  250  SFGCLKWLNKFAEYHDEQLQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFIKEP  309

Query  245  LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  66
            L ACCG GG YN N    CG+     C+ PS Y++WDG+H+TEAAY+ + DGLL GP+ +
Sbjct  310  LSACCGVGGTYNFNLSTGCGNVGVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGPYAT  369

Query  65   PKINGECILSRPKTK  21
            P  +  C+ S+ K K
Sbjct  370  PPFSWSCLSSKIKNK  384



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 156/229 (68%), Gaps = 2/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++ S+ C TP  CK + + S+ L+GEIGGNDYNY F  G   ++V + VP V+ 
Sbjct  142  QLGWFKKVKSTLCSTPQECKNFFKKSLFLVGEIGGNDYNYPFFIGGTIKQVKATVPVVVE  201

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IA+TI+ LI  GA  L+VPGN PIGCS  YL+ F T N + YD + GC+   N F +YH
Sbjct  202  AIAATISALIDEGAVELVVPGNFPIGCSAVYLTLFETPNKAAYD-EHGCLKVYNAFAKYH  260

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L+  L  LR+ +P  +IIYADYY AA R   SP +YGF ++ L ACCGGGGPYN N 
Sbjct  261  NAQLRLGLEKLRQKYPQAKIIYADYYGAAKRFVHSPKHYGFSKDRLVACCGGGGPYNFNN  320

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   ST C SPS++ +WDG+HLTEAAY+++  GL+ GPF+SP ++
Sbjct  321  SARCGHTGSTTCTSPSAHANWDGIHLTEAAYRYVAMGLINGPFSSPSLS  369



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 158/236 (67%), Gaps = 2/236 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E LE S+ILMGEIGGNDYNY F +G    E+   VP VI
Sbjct  146  QLNIFKQILPNLCASSSRDCREILEDSLILMGEIGGNDYNYPFFEGKSINELKDLVPLVI  205

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +LI  G +  +VPGN P+GCSP+YL+ F T    E+DP TGCI WLN+F ++
Sbjct  206  KAISSAIVDLIDLGGKTFLVPGNFPLGCSPAYLTLFKTVEEEEHDPFTGCITWLNEFGQH  265

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HNE L+ EL  L++L+PH  IIYADYYN+    ++ P  YGF+N  L ACCG GG YN  
Sbjct  266  HNEQLKTELKRLQKLYPHVNIIYADYYNSMYPFFQEPARYGFKNRPLGACCGVGGNYNFT  325

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
             +  CG +  + C +PS Y++WDG HLTEA +Q I  GLL GP+ +P  +  CI S
Sbjct  326  INEECGYEGVSYCQNPSEYVNWDGYHLTEATHQKIAHGLLNGPYATPAFDWSCIGS  381



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 154/233 (66%), Gaps = 1/233 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS C+E + ++++++GEIGGNDYNY FL G    E+   VP VI+
Sbjct  146  QLQSFKESLPNLCGSPSDCREMIGNALVIVGEIGGNDYNYGFLVGKSIVEMKELVPLVIS  205

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S + ELI  G + ++VP + PIGC PS+L+ + TSN  EYDP TGC+ WLN+F E H
Sbjct  206  TISSVVTELISMGGRTILVPSDFPIGCWPSFLTQYQTSNQEEYDPLTGCLKWLNEFIERH  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            NE LQ ELN L+ L+P   I+YADY+NA +  ++ P  +GF N  L ACCG GGPY  N 
Sbjct  266  NEELQAELNRLQRLNPRVTILYADYHNALLHTFQEPTRFGFMNRPLSACCGSGGPYKFNS  325

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
               CG++    C  PS Y+ WDG HLTE+AY+WI  GLL G +T P  +  C+
Sbjct  326  VRQCGTKGVDCCVDPSKYVHWDGFHLTESAYRWIALGLLEGNYTVPAFDWSCL  378



>ref|XP_010911731.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Elaeis guineensis]
Length=226

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 142/202 (70%), Gaps = 2/202 (1%)
 Frame = -2

Query  650  MGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSP  471
            MGEIGGNDYN   +QG   +E+ +FVP VI+VI+ST+  LI+ GA+ L+VPGN  IGC P
Sbjct  1    MGEIGGNDYNEPLIQGRTVDEIRTFVPDVISVISSTLKVLIELGAKTLVVPGNFAIGCVP  60

Query  470  SYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAA  291
             YL  F +  +  YDPQTGCI WLN+F+EYHN LL  EL+ LR L+P+  IIYADYY A 
Sbjct  61   LYLMLFQSPASEYYDPQTGCIKWLNEFSEYHNRLLLDELDKLRHLYPNATIIYADYYKAL  120

Query  290  MRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAA  111
            + +YRSP  +GFE   +ACCGGGGP NS     CG    TVC  PS Y+SWDG+HLTEAA
Sbjct  121  LSIYRSPREFGFEKPFDACCGGGGPNNS--AVPCGDPGFTVCSDPSKYVSWDGLHLTEAA  178

Query  110  YQWIVDGLLIGPFTSPKINGEC  45
            Y+ I  GLL G +T+P +N  C
Sbjct  179  YREIALGLLQGSYTTPSMNQVC  200



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 154/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWF ++  S C +P  CK+Y   S+ L+GEIGGNDYNYA  +G   ++  S+VP V +
Sbjct  155  QLDWFDKLKPSLCSSPKNCKKYFSRSLFLVGEIGGNDYNYALFKGKTLDDAKSYVPTVSS  214

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I      LIK GA  L+VPGNLP+GCS +YL+     N+S+YD   GC+   N+F + H
Sbjct  215  AIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGRNSSDYD-SVGCLKTYNEFAQRH  273

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N ++Q++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L+ CCGGGGPYN NP
Sbjct  274  NAMVQQKLQVLRLKYPKARIMYADYYGAAMSFAKNPKQFGFKQGPLKTCCGGGGPYNFNP  333

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  334  TASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  381



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 162/242 (67%), Gaps = 1/242 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L     + S C + +E+++ILMGEIGGNDYN+A  Q    EEV   VP+V
Sbjct  143  GVQLRSFKESLHCLRVSLSDCIDMIENALILMGEIGGNDYNFALFQRKAIEEVKELVPRV  202

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S   EL++ G +  +VPGN P+GCS +YL+ + TSN  EYDP TGC+ WLNDF +
Sbjct  203  IATISSATTELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEYDPLTGCLTWLNDFGK  262

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
            YH+E LQ ELN L+ L+P+  IIYADYYNA + LY+ P  +GF +  L ACCG GG YN 
Sbjct  263  YHSEQLQTELNRLKNLYPNVNIIYADYYNALLCLYQEPTKFGFIKRPLPACCGLGGLYNF  322

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
            N    CGS     C+ PS Y++WDG+H+TEAAY+WI +GLL GP+  P  N  C+ S+ K
Sbjct  323  NFTRKCGSLGVESCNDPSKYVNWDGIHMTEAAYRWISEGLLNGPYAIPPFNWSCLNSKIK  382

Query  26   TK  21
             K
Sbjct  383  KK  384


 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 156/240 (65%), Gaps = 2/240 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L + C +PS C++ +E+++ILMGEIGGNDYNYAF      EE    VP V
Sbjct  551  GVQLTSFKESLPNLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSTEETNELVPLV  610

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I  LI  G +  +VPG  P GCS  YL+ +  SN  EYDP TGC+ WLN + E
Sbjct  611  IRTISSAIT-LISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVDEYDPLTGCLTWLNKYGE  669

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  207
             H E L+ ELN L++L+PH  IIYADYYNA +R+Y+ P  +GF +  L ACCG GGPYN 
Sbjct  670  NHGEQLRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMKRPLSACCGVGGPYNF  729

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  27
                 CG+ +   C+ PS Y++WDG+HLTEAAY+ + +G+L GP+  P  +  C+ S  K
Sbjct  730  TAGKKCGTDVVDSCNDPSKYVAWDGVHLTEAAYRLMAEGILNGPYAVPPFDWSCLSSEIK  789



>ref|XP_010041182.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 150/228 (66%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++ 
Sbjct  137  QLGWFKSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVG  196

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YH
Sbjct  197  AIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYH  256

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N 
Sbjct  257  NNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  316

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             AYCG   STVC  PS+++ WDG+H TEAAY +I  GL+ G F SP +
Sbjct  317  SAYCGQSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLIDGGFISPPL  364



>ref|XP_009784633.1| PREDICTED: GDSL esterase/lipase At5g45910 [Nicotiana sylvestris]
Length=366

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 150/226 (66%), Gaps = 1/226 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            N+L WF+++ S+ C T   C+EY + S+ ++GEIGGNDYNY +  G   +++ + VP V+
Sbjct  132  NQLGWFQEVKSNICATRKDCREYFKKSLFIVGEIGGNDYNYPYFVGGSIKQLKALVPAVV  191

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I    + LI+ GA  LIVPGNLPIGCS  YL+ F T N + YD + GC+   N F++Y
Sbjct  192  ETIIEATSVLIEEGAVELIVPGNLPIGCSAVYLTLFGTQNKAAYD-KNGCLKAYNAFSKY  250

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN  L+  L  LRE +PH +IIYADYY AA R + +P +YGF NTL ACCGGGGPYN N 
Sbjct  251  HNSQLKLSLEKLREEYPHAKIIYADYYGAAKRFFHAPKHYGFSNTLVACCGGGGPYNFNN  310

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             A CG   S  C   S + +WDG+HLTEAAY  I  GLL GPFTSP
Sbjct  311  SARCGHIGSKACLDSSKFANWDGIHLTEAAYHHIAKGLLNGPFTSP  356



>gb|EMT22154.1| GDSL esterase/lipase [Aegilops tauschii]
Length=387

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 154/232 (66%), Gaps = 4/232 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFC----QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVP  570
            E++WF+ +L   C         C + +  S+ L+GEIGGNDYN     G P E++ +F P
Sbjct  133  EIEWFRDLLDLLCPGDVADEIDCMDMMSKSLFLVGEIGGNDYNLPLFYGVPFEKIRTFTP  192

Query  569  KVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDF  390
             +I  I+STI EL++ GA+ L+VPGNLPIGC P+YL+ + +    +Y+P+TGCI W+N+F
Sbjct  193  SIIAKISSTIAELVELGAKTLLVPGNLPIGCIPAYLTTYKSDMMEDYEPETGCIRWMNEF  252

Query  389  TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYN  210
            ++YHN+LL  EL +LR+LHP   IIYADYY AAM ++ SP  +G E+ L ACCGGGGPY 
Sbjct  253  SQYHNKLLVDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYG  312

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             +  A CG     VC+ P  Y SWDG H TEA Y+ I +GLL G +T P I+
Sbjct  313  VSASAGCGHGDYKVCNDPQKYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  364



>ref|NP_001130974.1| uncharacterized protein LOC100192079 [Zea mays]
 gb|ACF79385.1| unknown [Zea mays]
 gb|ACN29020.1| unknown [Zea mays]
 tpg|DAA58329.1| TPA: hypothetical protein ZEAMMB73_195608 [Zea mays]
Length=403

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 153/229 (67%), Gaps = 1/229 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C    + C + +  S+ L+GEIGGNDYN   L G P E++ +  P V+
Sbjct  151  EMKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNGPLLSGVPMEKIRAITPSVV  210

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI+ELI+ GA+ L+VPGNLPIGC P YL  F ++   +Y+PQTGC+ W+N+F++Y
Sbjct  211  AKISSTISELIRLGAKTLVVPGNLPIGCIPDYLMIFKSNKEEDYEPQTGCLRWMNEFSQY  270

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN++L ++L  LR+LHP   IIYADYY AAM ++ SP  YG E  L ACCGG GPY  +P
Sbjct  271  HNKVLVEQLKKLRKLHPGATIIYADYYGAAMEIFLSPEQYGIEYPLVACCGGEGPYGVSP  330

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
               CG     +CD+P  Y SWDG H +E+AY+ I  GLL+G +T P I 
Sbjct  331  STGCGFGEYKLCDNPEKYGSWDGFHPSESAYRAIAMGLLLGSYTRPSIT  379



>ref|XP_006643908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=377

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 151/228 (66%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V  
Sbjct  150  QLGWFEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAG  209

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             +A     LIK GA  L+  G LPIGCS +YL+   + N S+YD  TGC+   NDF ++H
Sbjct  210  AVADATERLIKAGALHLVGRGTLPIGCSSAYLTLHPSGNKSDYD-ATGCLKTYNDFAQHH  268

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +LQ +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP
Sbjct  269  NAVLQDKLQLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  328

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  329  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  376



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G+EL+ FK +L S C + + CK+ L +S+I+MG IGGNDY++AF + +  E    FVP V
Sbjct  148  GDELNSFKHLLPSLCSSSADCKKLLRNSLIVMGVIGGNDYSHAFREKN-NEAARKFVPLV  206

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  IAS I+ELI+ GA   +VPGN PIGCSP  L+ +  SN  +YDP TGC+ WLN F++
Sbjct  207  VHTIASAIHELIELGAMTFLVPGNFPIGCSPELLTNYQGSNKDKYDPLTGCLTWLNQFSQ  266

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            +HNELL+ EL  LR  HP   I+YADYYN AMR Y SP  +GF+ TL+ACCG GG YN N
Sbjct  267  HHNELLRTELEKLRNRHPDINIVYADYYNIAMRFYHSPKQFGFKETLKACCGIGGLYNYN  326

Query  203  PHAYCG-SQLSTVCDSPSSYISWDGMHLTEAAYQWIVD  93
                CG   L + C+ PSSYISWDG+H TEAA +W+ +
Sbjct  327  SSRSCGYPPLKSSCNDPSSYISWDGIHYTEAANKWLAN  364



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 157/240 (65%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS C + +E+++ILMGEIG NDY Y F  G   +EV   +P VIT
Sbjct  146  QLSSFKESLPNLCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGKSIQEVKELIPLVIT  205

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             ++S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EYDP TGC+ WLN F E H
Sbjct  206  TVSSAITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCLTWLNKFGENH  265

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            +  L+ ELN +++L+PH  IIYADYYNA +R Y+ P  +GF +  L ACCG GGPYN   
Sbjct  266  DSQLRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLCACCGVGGPYNYTS  325

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
             + CG+ +   C  PS Y++WDG+H+TEAAY+ + +G+L GP+  P  +  C+ S  K K
Sbjct  326  VSQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPPFDWSCLSSEIKDK  385



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L S C + SR C+E L  S+ILMGEIGGNDYNY F +G    E+   VP +I
Sbjct  144  QLNTFKQVLPSLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLII  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +L+  G +  +VPGN PIGCS SYL+ F  +   E+DP TGCI WLN+F EY
Sbjct  204  KTISSAIVDLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEEEHDPFTGCIPWLNEFGEY  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HNE L+ EL  L++L+PH  IIYADYYN+    ++ P  YGF+N  L ACCG GG YN  
Sbjct  264  HNEQLKTELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGFKNRPLAACCGVGGKYNFT  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             +  CG      C +PS Y++WDG HLTEAAY  I  GLL GP+ +P  +  C
Sbjct  324  VNEECGYGGVNYCQNPSEYVNWDGYHLTEAAYHKIAHGLLNGPYATPAFDWSC  376



>emb|CDM83548.1| unnamed protein product [Triticum aestivum]
Length=426

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 149/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            G E+ WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F P 
Sbjct  152  GVEMKWFHDLLDLLCPADRADCMGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPS  211

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            V+  I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+F+
Sbjct  212  VVAKISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNEFS  271

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNS  207
            +YHN LL  EL  LR+LHP   IIYADYY AAM +YRSP  +G ++   ACCGGGGPY  
Sbjct  272  KYHNRLLIDELEKLRKLHPGMSIIYADYYGAAMEIYRSPEQFGIDHPSAACCGGGGPYGV  331

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            +  A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  332  SMTARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  382



>ref|XP_010052214.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WF+ + SS C T   C EY + S+ L+GEIG NDYN++FL G   E++   VP+++ 
Sbjct  137  QLGWFQSLKSSLCTTKQECDEYFKKSLFLVGEIGENDYNFSFLFGRTIEQLRPLVPQIVG  196

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YH
Sbjct  197  AIIRAVSILIEEGAVNLVVPGQLPTGCISLYLTLFQSANESAYDPKTGCLKAYNALFKYH  256

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL  LRE +PH R++YADYY A++ +YR+P  YGF    L ACCGGGGPYN N 
Sbjct  257  NNYLKQELQKLREQYPHARVMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  316

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             AYCG   STVC  PS+++ WDG+H TE+AY +I  GL+ G F SP +
Sbjct  317  SAYCGQPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
             +L WFK++  S C T   C  Y + ++ L+GEIGGNDYNYAF  G   +++ + VP V+
Sbjct  135  TQLGWFKKLKPSLCTTKQECDNYFKKALFLVGEIGGNDYNYAFFVGGNIKQLKASVPFVV  194

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I    + LI+ GA  L+VPGNLPIGCS  YL+ F + N + YD + GC+   N F++Y
Sbjct  195  EAITQATSALIEEGAVELVVPGNLPIGCSAVYLTLFRSPNEAVYDKRNGCLKAFNGFSKY  254

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSN  204
            HN  L++ L  LR  +PH RIIYADYY AAM  Y +P +YGF++ TL ACCGGGGPYN N
Sbjct  255  HNSELKRALGALRLKYPHARIIYADYYGAAMPFYHAPQHYGFKSGTLRACCGGGGPYNFN  314

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
              A CG   ST C  PSSY +WDG+HLTEAAY  I  GL+ G F +P
Sbjct  315  NSARCGHIGSTACKDPSSYANWDGIHLTEAAYGHIAKGLIHGRFATP  361



>dbj|BAK06933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 147/231 (64%), Gaps = 1/231 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            G E+ WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F P 
Sbjct  147  GVEMKWFHDLLDLLCPADRADCTGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPS  206

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            V+  I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +YDP+TGC+ W+N+F+
Sbjct  207  VVAKISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYDPETGCLRWMNEFS  266

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNS  207
            +YHN LL  EL  LR  H    IIYADYY AAM +YRSP  +G ++ L ACCGGGGPY  
Sbjct  267  KYHNRLLIDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGV  326

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            +  A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  327  SMTARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>gb|KGN49290.1| hypothetical protein Csa_6G519430 [Cucumis sativus]
Length=326

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 158/243 (65%), Gaps = 14/243 (6%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPS--RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            +L+WF++  S  C + S  RC E L+ S+ ++GEIGGNDYNY F + H  EE+ S VP V
Sbjct  78   QLEWFRKAYSLACPSSSSTRCTEILKKSLFVVGEIGGNDYNYPFFKQHSFEEIKSLVPLV  137

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I STI ELI  GAQ L+VPGNLPIGCS  YL  + TS     D + GC++WLN F+E
Sbjct  138  VKSIGSTITELIHLGAQSLLVPGNLPIGCSSKYLQIYSTSIQ---DSKNGCLDWLNQFSE  194

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEAC-------CGG  225
            YHN+ LQ+ELN +R  HP+ +IIYADY+N+AM+ Y  P N+G +NTLEAC          
Sbjct  195  YHNKYLQEELNRIRSRHPNVQIIYADYHNSAMQFYNHPENFGLKNTLEACLVDRNETLKK  254

Query  224  GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             G Y         +++   CD PS Y+SWDG+HLTEAAY+ I  GLL GP+T P+    C
Sbjct  255  DGKYGLGGKTKTKTKIE--CDDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSC  312

Query  44   ILS  36
            I+S
Sbjct  313  IIS  315



>ref|XP_010052212.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=392

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 150/228 (66%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++ 
Sbjct  137  QLGWFKSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVG  196

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YH
Sbjct  197  AIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYH  256

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N 
Sbjct  257  NNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  316

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             AYCG   STVC  PS+++ WDG+H TE+AY +I  GL+ G F SP +
Sbjct  317  SAYCGQSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +G    E+   VP +I
Sbjct  144  QLNTFKQVLPNLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEGKTVNEIKELVPLII  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +L+  G +  +VPGN PIGCS SYL+ F  +   E+DP TGCI WLN+F EY
Sbjct  204  KTISSAIVDLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEEEHDPFTGCIPWLNEFGEY  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HN+ L+ EL  L++L+PH  IIYADYYN+    ++ P  YGF+N  L ACCG GG YN  
Sbjct  264  HNDQLKTELKRLQKLYPHVNIIYADYYNSIYTFFQEPAKYGFKNRPLAACCGVGGKYNFT  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             +  CG +    C +PS Y++WDG HLTEAAY+ I  GLL GP+ +P  +  C
Sbjct  324  VNEECGYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATPAFDWSC  376



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 155/234 (66%), Gaps = 19/234 (8%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +++WFKQ+L S C + S                GGNDYN+ F QG   +E+ +FVP +
Sbjct  141  GTQIEWFKQLLPSLCSSGS----------------GGNDYNHPFFQGKTVDEIRTFVPSI  184

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ I+S IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI WLN+F E
Sbjct  185  ISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAE  244

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHN LL  EL+HL++LHPH  IIYADYY A + ++RSP  +GF+   L ACCGGGGPYN 
Sbjct  245  YHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNI  304

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            +    CG + +TVC+ PS+Y+ WDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  305  S--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  356



>ref|XP_004969326.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=422

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 150/229 (66%), Gaps = 1/229 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
             E+ WF+ +L   C    S C + +  S+ L+GEIGGNDYN   L   P E++ SF P V
Sbjct  149  TEMKWFRDLLDLLCPGGRSDCSDMMGQSLFLVGEIGGNDYNLPLLSRLPIEKIRSFTPSV  208

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+STI ELI  GA+ L+VPGNLPIGC P YLS F + N  +Y+P++GC+ W+N+F++
Sbjct  209  VAKISSTITELIGLGAKTLVVPGNLPIGCVPRYLSIFRSDNKEDYEPESGCLRWMNEFSK  268

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN+LL +EL  LR+LHP   IIYADYY AAM ++  P  +G E  L ACCGG G +  +
Sbjct  269  YHNKLLVEELEKLRKLHPGVSIIYADYYGAAMEIFLFPERFGIEEPLVACCGGEGTHGVS  328

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
            P A CG     VCD+P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  329  PAAACGYGEYKVCDNPDKYGSWDGFHPSEAAYKAIAMGLLRGTYTQPSI  377



>ref|XP_010232088.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Brachypodium 
distachyon]
Length=404

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 1/230 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            G E+ WF+ +L   C    + C+  +  S+ L+GEIGGNDYN   L   P E++ +F P 
Sbjct  150  GIEMKWFRNLLDLLCPVDRADCRGLMNKSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPS  209

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            V+  I+STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+F+
Sbjct  210  VVAKISSTITELIGLGAKTLVVPGNLPIGCIPNYLMIFKSDKKEDYEPETGCLRWMNEFS  269

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNS  207
            +YHN+LL  EL  LR+LH    +IYADYY AAM +YRSP  +G E+ L ACCGGGGPY  
Sbjct  270  QYHNKLLVDELEKLRKLHHGVSLIYADYYGAAMEIYRSPEQFGIEHPLAACCGGGGPYGV  329

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
            +  + CG     VC  P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  330  SITSRCGYGEYKVCHDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSI  379



>ref|XP_006646093.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Oryza 
brachyantha]
Length=383

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L +   + S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VPKV+ 
Sbjct  124  QMQWFKKLLPTIASSESELSDVMSKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVG  183

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S I +LI +GA+ L+VPGN PIGC P YLS F +     YD +TGCI WLN+FTEYH
Sbjct  184  TITSAITDLINFGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYH  243

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N LLQ+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L +CCG   PYN +P 
Sbjct  244  NRLLQEELEKLRNLHPDVSIIYADYYGAALNIFRAPLQFGFTVPLNSCCGSDAPYNCSPS  303

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   S VC  PS Y SWDG+H TEA Y+ I+ G+L G +  P ++  C
Sbjct  304  ILCGHPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYAIPPLSETC  353



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 152/234 (65%), Gaps = 3/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L S C + S  CK  LE S+ILMGEIGGNDYNY F       E+   VP VI
Sbjct  132  QLNTFKQVLPSLCASSSHVCKVMLEDSLILMGEIGGNDYNYPFFGRKSINEIKKLVPLVI  191

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
             VI++ I +LI  G +  +VPGN PIGCS +YL+ F T+   E+DP TGCI WLN F E+
Sbjct  192  KVISAAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTAKV-EHDPFTGCIPWLNKFAEH  250

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HNE L+ EL  L+ L+PH  IIYADYYN+  R ++ P  YGF N  L ACCG GG YN  
Sbjct  251  HNEQLKTELKRLQNLYPHVNIIYADYYNSLYRFFQEPAKYGFRNRPLAACCGVGGQYNFT  310

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG +  + C +PS Y++WDG HLTEA Y+ +  GLL GP+TSP  +  C+
Sbjct  311  IGKECGDKRVSYCQNPSVYVNWDGYHLTEATYRKMAQGLLNGPYTSPAFDWSCL  364



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 155/238 (65%), Gaps = 1/238 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EEV   VP V
Sbjct  571  GVQLSSFKESLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVEKSIEEVKELVPLV  630

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI  G +  +VPG  P+GCS  YL+ + T+N  EYDP TGC+  LN F E
Sbjct  631  IRTISSAITELIGMGGKTFLVPGEFPMGCSVVYLTIYHTANMEEYDPLTGCLKLLNKFGE  690

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHNE LQ ELN L++L+P   IIYADYYN    +++ P  +GF N  L ACCG GGPYN 
Sbjct  691  YHNEQLQVELNRLQKLYPRVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYND  750

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
                 CG+ +   C  PS Y++WDG+HLTEAAY  I +G+L GP+T P  +  C+ SR
Sbjct  751  TVGKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCLSSR  808


 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 153/233 (66%), Gaps = 1/233 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS C + +E+++ILMGEIG NDY Y F  G   +EV   +P VIT
Sbjct  145  QLSSFKESLPNLCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGKSIQEVKELIPLVIT  204

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             ++S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EYDP TGC+ WLN F E H
Sbjct  205  TVSSAITELIGMGGKTFLVPGEFPMGCLVAYLTLYQTSNKEEYDPLTGCLTWLNKFGENH  264

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            +  L+ ELN L++L+PH  IIYADYYNA +R Y+ P  +GF +  L ACCG GGPYN   
Sbjct  265  DGQLRAELNRLQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLSACCGVGGPYNYTS  324

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
               CG+ +   C  PS Y++WDG+H+TEAAY+ I DG+L GP+  P  +  C+
Sbjct  325  VTQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLISDGILKGPYAVPPFDWSCL  377



>dbj|BAJ93079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 147/231 (64%), Gaps = 1/231 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            G E+ WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F P 
Sbjct  147  GVEMKWFHDLLDLLCPADRADCTGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPS  206

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            V+  I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +YDP+TGC+ W+N+F+
Sbjct  207  VVAKISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYDPETGCLRWMNEFS  266

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNS  207
            +YHN LL  EL  LR  H    IIYADYY AAM +YRSP  +G ++ L ACCGGGGPY  
Sbjct  267  KYHNRLLIDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGV  326

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            +  A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  327  SMTARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>ref|XP_003569457.2| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Brachypodium 
distachyon]
Length=424

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 1/230 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            G E+ WF+ +L   C    + C+  +  S+ L+GEIGGNDYN   L   P E++ +F P 
Sbjct  150  GIEMKWFRNLLDLLCPVDRADCRGLMNKSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPS  209

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  387
            V+  I+STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+F+
Sbjct  210  VVAKISSTITELIGLGAKTLVVPGNLPIGCIPNYLMIFKSDKKEDYEPETGCLRWMNEFS  269

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNS  207
            +YHN+LL  EL  LR+LH    +IYADYY AAM +YRSP  +G E+ L ACCGGGGPY  
Sbjct  270  QYHNKLLVDELEKLRKLHHGVSLIYADYYGAAMEIYRSPEQFGIEHPLAACCGGGGPYGV  329

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
            +  + CG     VC  P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  330  SITSRCGYGEYKVCHDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSI  379



>ref|XP_011027710.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Populus euphratica]
Length=373

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 153/229 (67%), Gaps = 2/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFKQ+ SS C +   C  Y + S+ L+GEIGGNDYNYA+  G   +++ + VP V+ 
Sbjct  142  QLGWFKQLKSSLCISKQECDNYFKKSLFLVGEIGGNDYNYAYFAGGSIKQLRASVPLVVE  201

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IA   + LI+ GA  L+VPGNLPIGCS  YL+ F + N +EYD + GC+   N F++YH
Sbjct  202  AIAKATSFLIEEGAVELLVPGNLPIGCSAVYLTLFGSPNRTEYD-RNGCLKACNAFSKYH  260

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNP  201
            N  L+  L  LR+ +PH RIIYADYY AA R Y +P  +GF   TL ACCGGGGPYN N 
Sbjct  261  NNQLKTALQMLRQKYPHARIIYADYYGAAKRFYHAPQRHGFTGGTLTACCGGGGPYNFNN  320

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   S  C +PSS+ +WDG+HLTEAAY++I  GL+ G FT+P + 
Sbjct  321  SARCGHMGSRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGSFTTPPLR  369



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 154/240 (64%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E LE S+ILMGEIGGNDYNY F +G    E+   VP +I
Sbjct  144  QLNTFKQILPNLCASSSRDCREMLEDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLII  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +L+  G +  +VPG  P GCS +YL+ F T    ++DP TGCI WLN+F E+
Sbjct  204  KAISSAIVDLVDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQDHDPLTGCIPWLNEFGEH  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HNE L+ EL  L++L+PH  IIYADY+N+  R ++ P  YGF+N L ACCG GG YN   
Sbjct  264  HNEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTI  323

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CG +    C +PS +++WDG HLTEA YQ +   LL GP+ +P  +  C+ S    K
Sbjct  324  DKECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNGPYATPAFDWSCLDSDSVAK  383



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 153/240 (64%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E LE S+ILMGEIGGNDYNY F +G    E    VP +I
Sbjct  144  QLNTFKQILPNLCASSSRDCREILEESLILMGEIGGNDYNYPFFEGKSINETKELVPLII  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +LI  G +  +VPG  P GCS +YL+ F T    E+DP TGCI WLN+F E+
Sbjct  204  KAISSAIVDLIDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQEHDPLTGCIPWLNEFGEH  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HNE L+ EL  L++L+PH  IIYADY+N+  R ++ P  YGF+N L ACCG GG YN   
Sbjct  264  HNEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTI  323

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CG +    C +PS +++WDG HLTEA YQ +   LL GP+ +P  +  C+ S    K
Sbjct  324  DKECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAHSLLNGPYATPAFDWSCLDSDSVAK  383



>ref|XP_008439761.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=384

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (65%), Gaps = 5/245 (2%)
 Frame = -2

Query  743  GNELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  567
            GN+ + F Q  SS C  +P +CK+  +SS+ +MGEIGGNDYNY F  G   EE+ S V  
Sbjct  138  GNQFNSFNQSYSSICTSSPPKCKDIFKSSLFIMGEIGGNDYNYLFFDGRNIEELESLVLL  197

Query  566  VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYF-MTSNASEYDPQTGCINWLNDF  390
            V+  IAS I ELI+ G + L+VP NLPIGC P YL ++  TSN S++DPQ GC+ WLN F
Sbjct  198  VVNKIASVILELIELGVETLMVPSNLPIGCLPVYLEFYKTTSNESQFDPQNGCLKWLNQF  257

Query  389  TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACC-GGGGPY  213
            +EYHN+ LQ++L  +R LHPH  +IY DY+NAAMR+Y +P ++G    L+ CC    G Y
Sbjct  258  SEYHNQQLQEQLKRIRVLHPHVHLIYVDYFNAAMRIYNAPKDFGLVEPLQVCCVDKNGSY  317

Query  212  NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  33
               P   CG   + VCD PS Y SWDG+HLTEAAY+ +   ++ G FT P+ +  C+   
Sbjct  318  YFPPP--CGGAGTIVCDDPSKYASWDGLHLTEAAYELMATSIINGEFTFPQFSISCLQRN  375

Query  32   PKTKI  18
              T++
Sbjct  376  TSTQL  380



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 154/233 (66%), Gaps = 2/233 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +G     +   VP +I
Sbjct  144  QLNTFKQILPNLCASTSRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINGIKELVPLII  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +L+  G++  +VPGN PIGCS SYL+ F  +   E+DP TGCI WLN+F EY
Sbjct  204  KTISSAIVDLVDLGSKTFLVPGNFPIGCSASYLTLFQNAKEEEHDPFTGCIPWLNEFGEY  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HN+ L+ EL  L++L+PH  IIYADYYN+    ++ P  YGF+N  L ACCG GG YN  
Sbjct  264  HNDQLKNELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGFKNRPLAACCGVGGKYNFT  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             +  CG +    C +PS Y++WDG HLTEAAY+ I  GLL GP+ +P  +  C
Sbjct  324  VNEECGYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATPAFDWSC  376



>gb|KDO77812.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=286

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 152/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++DWFK++ SS C T   C+ Y + S+  +GEIGGNDYNY    G    ++ + VP V+ 
Sbjct  59   QIDWFKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGESINQLRASVPLVVK  118

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I +    LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD + GC+   N F  YH
Sbjct  119  AITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-RNGCLKAPNAFARYH  177

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +L+ EL+ LR+ +PH  IIYADYY AAMR Y +P +YGF N  ++ACCGGGGPYN N 
Sbjct  178  NTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  237

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   S  C++PS++ +WDG+HLTE+AY+ + +GL+ GPF +P +
Sbjct  238  SARCGHTGSRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  285



>dbj|BAJ98364.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 150/228 (66%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C +  + C   +  S+ L+GEIGGNDYN       P E++ +F P VI
Sbjct  139  EMSWFRDLLRLLCPRDLADCVGMMNKSLFLVGEIGGNDYNIPLTSSVPVEKIRAFAPSVI  198

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
            + I+STI +LI  GA+ L+VPGNLPIGC P YL+ + T N  +Y+ +TGCI W+N+F+ Y
Sbjct  199  SKISSTITDLIGLGAKTLVVPGNLPIGCLPVYLTMYQTDNMGDYESETGCIRWMNEFSRY  258

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL  EL  LR+LHP   IIYADYY AAM ++ SP  +G E+ L ACCG  GPY  + 
Sbjct  259  HNKLLVDELEKLRKLHPSASIIYADYYGAAMEIFVSPYKFGIEDPLMACCGVEGPYGVSI  318

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CG     VCD+P +Y SWDG+H TE +Y+ I DGLL GP+T P I
Sbjct  319  TTKCGHGEYKVCDNPQNYASWDGLHPTETSYRVIADGLLRGPYTQPPI  366



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 152/229 (66%), Gaps = 3/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  Y + S+ L+GEIGGNDYNYA + G+   ++ + VP V+ 
Sbjct  141  QLGWFKKLKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAGN-ITQLQATVPPVVE  199

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I + INELI  GA+ L+VPGN PIGCS  YL+ F + N  +YD  +GC+   N F EYH
Sbjct  200  AITAAINELIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-DSGCLKTFNGFAEYH  258

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N+ L+  L  LR+ +PH RI+YADYY AA R + +P ++GF N  L ACCGGGGPYN N 
Sbjct  259  NKELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPYNFNI  318

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   S  C  PS+Y +WDG+HLTEAAY++I  GL+ GPF+ P + 
Sbjct  319  SARCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  367



>ref|XP_007148066.1| hypothetical protein PHAVU_006G177700g [Phaseolus vulgaris]
 gb|ESW20060.1| hypothetical protein PHAVU_006G177700g [Phaseolus vulgaris]
Length=369

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 155/227 (68%), Gaps = 2/227 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L S C + + C+E   +S+ LMGEIGGND+NY F + +   EV ++VP VI 
Sbjct  145  QLNWFKELLPSLCNSFTDCREVFGNSLFLMGEIGGNDFNYFFFEQNSIAEVKTYVPYVIN  204

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IAS I+EL+  GA+ LI+PGNLPIGCS  YL+ + T + +EYD Q+GC+ WLN+F EY+
Sbjct  205  AIASAIHELVGVGARTLIIPGNLPIGCSVIYLTIYETKDENEYD-QSGCLKWLNEFAEYY  263

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N  LQ EL+ L+ L+ H  II+ADYYNAA+ LYR P  +GF   L+ACCG GGPYN N  
Sbjct  264  NHELQSELHKLQALYSHANIIFADYYNAALPLYRDPTKFGFSG-LKACCGMGGPYNFNAS  322

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
              CG      CD PS YI WDG+HLTEAA + I   ++   ++S  I
Sbjct  323  VKCGDPRVIPCDDPSKYIGWDGIHLTEAANKLIAQAVIKWSYSSSSI  369



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 152/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++DWFK++ SS C T   C+ Y + S+  +GEIGGNDYNY    G    ++ + VP V+ 
Sbjct  135  QIDWFKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGESINQLRASVPLVVK  194

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I +    LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD + GC+   N F  YH
Sbjct  195  AITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-RNGCLKAPNAFARYH  253

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +L+ EL+ LR+ +PH  IIYADYY AAMR Y +P +YGF N  ++ACCGGGGPYN N 
Sbjct  254  NTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  313

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   S  C++PS++ +WDG+HLTEAAY+ + +GL+ GPF +P +
Sbjct  314  SARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_010052216.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76154.1| hypothetical protein EUGRSUZ_D00533 [Eucalyptus grandis]
Length=386

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 150/229 (66%), Gaps = 1/229 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK + SS C T  +C EY   S+ L+GEIGGNDYNY    G   +++ + VP V+ 
Sbjct  157  QLRWFKNLKSSLCTTKQQCDEYFNRSLFLVGEIGGNDYNYPSFVGASIKQLHALVPLVVG  216

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   +  LI+ GA  L+VPGNLP+GCS  YL+ F + + S YDP TGC+   N F +YH
Sbjct  217  AITRAVGMLIEEGAVNLVVPGNLPVGCSAVYLTLFHSPDKSAYDPGTGCLKAYNVFAKYH  276

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL +LRE +PH RI+YADYY AA+ +Y +P +YGF   TL ACCGGGGP+N N 
Sbjct  277  NNYLKQELQNLREQYPHARIMYADYYGAALPIYHTPKHYGFYGGTLRACCGGGGPFNFNN  336

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   ST C  PS++ +WDG+HLTE+AY  I   L+ G F SP + 
Sbjct  337  SARCGHTGSTACRDPSAFANWDGIHLTESAYHHIAKRLIYGGFISPPLR  385



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 152/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++DWFK++ SS C T   C+ Y + S+  +GEIGGNDYNY    G    ++ + VP V+ 
Sbjct  135  QIDWFKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGGSINQLRASVPLVVK  194

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I +    LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD Q GC+   N F  YH
Sbjct  195  AITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-QNGCLKAPNAFARYH  253

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +L+ +L+ LR+ +PH  IIYADYY AAMR Y +P +YGF N  ++ACCGGGGPYN N 
Sbjct  254  NTMLKAQLHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  313

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   S  C++PS++ +WDG+HLTEAAY+ + +GL+ GPF +P +
Sbjct  314  SARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_010052211.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76147.1| hypothetical protein EUGRSUZ_D00523 [Eucalyptus grandis]
Length=367

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK + SS C T   C EY + S+ L+GEIG NDYN+  L G   +++ + VP V+ 
Sbjct  138  QLGWFKNLKSSLCTTEQECDEYFKKSLFLVGEIGENDYNFPALSGQSIKQLRALVPLVVG  197

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP+GC+  +L+ F ++N S YD +TGC+   + F +YH
Sbjct  198  AITRAVSMLIEEGAVDLMVPGQLPVGCTSMFLTVFQSANESAYDNRTGCLKAYDAFFKYH  257

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL +LRE +PH RI+YADYY AAM +YRSP +YGF   T  ACCGGGGP+N N 
Sbjct  258  NNYLKQELQNLREQYPHARIMYADYYGAAMTIYRSPKHYGFYGGTPRACCGGGGPHNFNT  317

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   +T C  PS+++ WDG+H TE+AY  I  G++ G FTSP +
Sbjct  318  TAVCGQTGATACKDPSAFMDWDGIHFTESAYHHIAKGMINGGFTSPPL  365



>emb|CDY64716.1| BnaCnng44670D [Brassica napus]
Length=389

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 154/234 (66%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + S  C++ LE S+ILMGE+GGNDYNY F +     E+    P +I
Sbjct  143  QLNTFKQILPTLCASSSHDCRKVLEDSLILMGELGGNDYNYPFFEDKSINEIKELTPLII  202

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+  I +LI  G +  +VPG+ P+GCS +YL+ F T+   +YDP TGC+ WLNDF ++
Sbjct  203  KAISDAIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEKDYDPLTGCLPWLNDFGKH  262

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            H+E L+ E+  LR+L+PH  IIYADYYN+  RLY+ P  YGF+N  L ACCG GG YN  
Sbjct  263  HDEQLKTEIRRLRKLYPHVNIIYADYYNSLYRLYQKPTKYGFKNRPLAACCGVGGQYNFT  322

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP+ +P  N  C+
Sbjct  323  IGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYATPAFNWSCL  376



>gb|KHN08453.1| GDSL esterase/lipase [Glycine soja]
Length=296

 Score =   239 bits (609),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 150/229 (66%), Gaps = 3/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  Y + S+ L+GEIGGNDYNYA + G+   ++ S VP V+ 
Sbjct  63   QLGWFKKLKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAGN-VTQLQSTVPPVVE  121

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   IN LI  GA+ L+VPGN PIGCS  YL+ F + N  +YD ++GC+   N F EYH
Sbjct  122  AITMAINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-ESGCLKTFNGFAEYH  180

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N  L+  L  LR+ +PH RI+YADYY AA R + +P ++GF N  L ACCGGGGP+N N 
Sbjct  181  NRELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNI  240

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   S  C  PS+Y +WDG+HLTEAAY++I  GL+ GPF+ P + 
Sbjct  241  SARCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  289



>ref|XP_003593740.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63991.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=387

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 156/236 (66%), Gaps = 2/236 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+WFK++L   C +   C E L  S+ L+GEIGGND+NY         ++  +VP V
Sbjct  142  GVQLNWFKELLPHICNSSKTCHEVLGKSLFLVGEIGGNDFNYPLHIRQSITKLKEYVPHV  201

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I   INELI  GA+ L+VPGN P+GCS  +L+ + T++ ++YD   GC+ WLN+F+E
Sbjct  202  INAITLAINELIDLGARTLMVPGNFPLGCSAVHLTTYETTDKNQYD-SFGCLKWLNEFSE  260

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            ++N+ LQ E++ LR +HPH  IIYADYYNAA+ LYR P  YGF   L+ CCG G PYN N
Sbjct  261  FYNQKLQHEIHRLRVIHPHANIIYADYYNAALPLYRYPKKYGFTG-LKVCCGIGSPYNYN  319

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
                CG      CD PS YI+WDG+H TEAAY+ I +GL+ GP++ P+++  C ++
Sbjct  320  ASNMCGKPGVPACDDPSQYITWDGVHFTEAAYRLIANGLIKGPYSVPQLSNLCFMN  375



>ref|XP_008439763.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=398

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 157/243 (65%), Gaps = 12/243 (5%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPS--RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            +L+WFK+  S  C + S  RC + L+ S+ ++GEIGGNDYNY F + H  EE+ S VP V
Sbjct  148  QLEWFKKAYSLACPSSSSTRCTKILKKSLFVVGEIGGNDYNYPFFKQHSFEEIKSLVPVV  207

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I S I ELI+ GAQ LIVPGNLPIGC P YL  + TS     D + GC++WLN F+E
Sbjct  208  VKSIGSAITELIQLGAQSLIVPGNLPIGCCPKYLKIYSTSIQ---DSKNGCLDWLNQFSE  264

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEAC-------CGG  225
            YHN+ LQ+ELN +R  HP+ +IIYADY+N+AM+ Y  P N+G  NTLEAC          
Sbjct  265  YHNKHLQEELNRIRSQHPNVQIIYADYHNSAMQFYNHPENFGLANTLEACLVDKNETLKK  324

Query  224  GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             G Y     A   ++    CD PS Y+SWDG+HLTEAAY+ I + +L GP+T PK    C
Sbjct  325  DGNYGLRSKAKTKTKTKKECDDPSKYVSWDGVHLTEAAYRLIANAILQGPYTHPKFTTSC  384

Query  44   ILS  36
            I+S
Sbjct  385  IMS  387



>ref|XP_009608031.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X1 [Nicotiana 
tomentosiformis]
Length=366

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 151/226 (67%), Gaps = 1/226 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +++ WF+++ S+ C T   C+EY + S+ ++GEIGGNDYNY +  G   +++ + VP V+
Sbjct  132  DQVGWFQEVKSNICATRKDCREYFKKSLFIVGEIGGNDYNYPYFVGGSIKQLKALVPAVV  191

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I    + LI+ GA  LIVPGNLPIGCS  YL+ F T+N + YD + GC+   N F++Y
Sbjct  192  ETIIEATSVLIEEGAVELIVPGNLPIGCSALYLTLFGTTNKAAYD-KNGCLKAYNAFSKY  250

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN  L+  L  LRE +PH +IIYADYY AA RL+ +P +YGF NTL ACCGGGGPYN N 
Sbjct  251  HNSQLKLSLEKLREEYPHAKIIYADYYGAAKRLFHAPKHYGFFNTLVACCGGGGPYNFNN  310

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             A CG   S  C   S + +WDG+HLTEAAY  I  GLL G FTSP
Sbjct  311  SARCGHIGSKACLDSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSP  356



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
 ref|XP_004155633.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=397

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 158/243 (65%), Gaps = 14/243 (6%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPS--RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            +L+WF++  S  C + S  RC E L+ S+ ++GEIGGNDYNY F + H  EE+ S VP V
Sbjct  149  QLEWFRKAYSLACPSSSSTRCTEILKKSLFVVGEIGGNDYNYPFFKQHSFEEIKSLVPLV  208

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I STI ELI  GAQ L+VPGNLPIGCS  YL  + TS     D + GC++WLN F+E
Sbjct  209  VKSIGSTITELIHLGAQSLLVPGNLPIGCSSKYLQIYSTSIQ---DSKNGCLDWLNQFSE  265

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEAC-------CGG  225
            YHN+ LQ+ELN +R  HP+ +IIYADY+N+AM+ Y  P N+G +NTLEAC          
Sbjct  266  YHNKYLQEELNRIRSRHPNVQIIYADYHNSAMQFYNHPENFGLKNTLEACLVDRNETLKK  325

Query  224  GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             G Y         +++   CD PS Y+SWDG+HLTEAAY+ I  GLL GP+T P+    C
Sbjct  326  DGKYGLGGKTKTKTKIE--CDDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSC  383

Query  44   ILS  36
            I+S
Sbjct  384  IIS  386



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 152/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++DWFK++ SS C T   C+ Y + S+  +GEIGGNDYNY    G    ++ + VP V+ 
Sbjct  135  QIDWFKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGESINQLRASVPLVVK  194

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I +    LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD + GC+   N F  YH
Sbjct  195  AITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-RNGCLKAPNAFARYH  253

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N +L+ EL+ LR+ +PH  IIYADYY AAMR Y +P +YGF N  ++ACCGGGGPYN N 
Sbjct  254  NTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  313

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   S  C++PS++ +WDG+HLTE+AY+ + +GL+ GPF +P +
Sbjct  314  SARCGHTGSRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  361



>gb|KCW63207.1| hypothetical protein EUGRSUZ_G00824, partial [Eucalyptus grandis]
Length=349

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 157/231 (68%), Gaps = 8/231 (3%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+ 
Sbjct  121  QLDWFKKLKSSLCTTQQDCDTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVG  180

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSY---FMTSNASEYDPQTGCINWLNDFT  387
             IA+  + LI++GA  L+VPGNLPIGC   Y++    F+ +NA   +  TGC+N  N+F 
Sbjct  181  AIANATSMLIEHGAVELVVPGNLPIGCLTLYITTAPPFLKNNA---NTTTGCLNRYNEFA  237

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYN  210
            +YHN+ LQ+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N
Sbjct  238  KYHNDYLQRELQVLRQKYNHARIIYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFN  297

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             N    CGS+ S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP++
Sbjct  298  FNVRMMCGSK-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  347



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 159/237 (67%), Gaps = 8/237 (3%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G + DWF Q L+         ++++++S+IL+GEIGGNDY    L     + + SF+P V
Sbjct  161  GTQFDWFNQFLAVI----PNGRKFVKNSLILVGEIGGNDYGNPLLLDIDPKAIRSFMPAV  216

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA-SEYDPQTGCINWLNDFT  387
            +  I STI ELIK GA  ++VPG +P+GC P+ L+++ TS+   +Y P TGC+NWLN+ +
Sbjct  217  VNYIGSTIEELIKLGATTMLVPGVIPMGCLPALLTHYKTSSTEKDYHPTTGCLNWLNELS  276

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPY  213
             YHNELLQKEL+ LR LHPH  IIYAD YNA MR Y SP+ +GF  E+ L ACCGGGGPY
Sbjct  277  IYHNELLQKELSRLRHLHPHIAIIYADNYNAMMRFYLSPHQFGFAKESILRACCGGGGPY  336

Query  212  NSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            N N  A CG+   +  C++PS Y++WDG+H TEAA +WI  GL  G +T P I   C
Sbjct  337  NFNGSALCGNLPRANCCENPSLYVNWDGLHCTEAANKWIAQGLWEGSYTHPHIKTIC  393



>ref|XP_010068245.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 157/231 (68%), Gaps = 8/231 (3%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+ 
Sbjct  139  QLDWFKKLKSSLCTTQQDCDTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVG  198

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSY---FMTSNASEYDPQTGCINWLNDFT  387
             IA+  + LI++GA  L+VPGNLPIGC   Y++    F+ +NA   +  TGC+N  N+F 
Sbjct  199  AIANATSMLIEHGAVELVVPGNLPIGCLTLYITTAPPFLKNNA---NTTTGCLNRYNEFA  255

Query  386  EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYN  210
            +YHN+ LQ+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N
Sbjct  256  KYHNDYLQRELQVLRQKYNHARIIYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFN  315

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             N    CGS+ S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP++
Sbjct  316  FNVRMMCGSK-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>gb|KJB62806.1| hypothetical protein B456_009G437200 [Gossypium raimondii]
Length=399

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 158/238 (66%), Gaps = 2/238 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G E++ FK +L S C + S CK+ L  S+I+MGE+GGNDYN+AF QG   E +   VP V
Sbjct  148  GVEVNSFKHLLPSLCSSSSNCKKLLRKSLIVMGEVGGNDYNHAFKQGKNIENIRRLVPLV  207

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            + +I+ +I ELI+ GA   +VPGN PIGCSPS L+ F  S   +YDP TGC+ WLN F++
Sbjct  208  VDIISLSIKELIELGAVTFLVPGNFPIGCSPSLLTSFHGSEKDQYDPLTGCLTWLNQFSQ  267

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            +HNELL+KEL ++R LHP   IIY DYY A+   Y+SP NYGF+ TL+ACCG GG YN +
Sbjct  268  HHNELLRKELENIRNLHPQINIIYVDYYKASTPFYQSPKNYGFKETLKACCGIGGLYNYD  327

Query  203  PHAYCG-SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF-TSPKINGECILS  36
            P  YCG   L   C+ PSSYISWDG+H TE   +W+   +      T P++   C LS
Sbjct  328  PLIYCGYPPLKQCCNDPSSYISWDGIHFTEVVNKWLAHTVFEELMNTIPRLGSLCPLS  385



>ref|XP_003569458.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=395

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 147/229 (64%), Gaps = 2/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C +  + C + +  S+ L+GEIGGNDYN   L   P + + +F P V+
Sbjct  141  EMGWFRDLLDLLCPRDLADCIDMMNRSLFLVGEIGGNDYNLPLLSRVPYKTIRAFTPSVV  200

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              IASTI ELI+ GAQ L+VPGNLPIGC P YL  + ++   +Y+P+TGCI W+N F+ Y
Sbjct  201  GKIASTIAELIELGAQTLVVPGNLPIGCIPMYLMMYKSNKPEDYEPETGCIRWMNKFSRY  260

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGG-GPYNSN  204
            HN+LL  EL  LR+LHP   IIYADYY AAM +Y SP  +  EN L ACCGGG  PY  +
Sbjct  261  HNKLLVGELEKLRKLHPGVAIIYADYYGAAMEIYSSPEQFEIENPLVACCGGGEEPYGVS  320

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
              A CG     VC  P  Y SWDG H TEA Y+ I DGLL GP+T P I
Sbjct  321  RAAGCGHGEYKVCSDPQKYGSWDGFHPTEAVYKAIADGLLRGPYTQPAI  369



>ref|XP_010068248.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 152/228 (67%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+ 
Sbjct  139  QLDWFKKLKSSLCTTQQDCNTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVG  198

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IA+    LI++GA  L+VPGNLPIGC  SY++       ++ +  TGC+N  N+F +YH
Sbjct  199  AIANATGMLIEHGAVELVVPGNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYH  258

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  LQ+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N N 
Sbjct  259  NNYLQRELQVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  318

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CGS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP++
Sbjct  319  RMMCGST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>gb|KCW44565.1| hypothetical protein EUGRSUZ_L01922, partial [Eucalyptus grandis]
Length=353

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 145/219 (66%), Gaps = 1/219 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++ 
Sbjct  134  QLGWFKSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVG  193

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YH
Sbjct  194  AIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYH  253

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N 
Sbjct  254  NNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  313

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLL  84
             AYCG   STVC  PS+++ WDG+H TEAAY +I  GL+
Sbjct  314  SAYCGQSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLI  352



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 153/240 (64%), Gaps = 1/240 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + S  C+E LE S+ILMGEIGGNDYNY F +G    E+   VP +I
Sbjct  144  QLNTFKQILPNLCASSSLDCREMLEDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLII  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +L+  G +  +VPG  P GCS +YL+ F T    ++DP TGCI WLN+F E+
Sbjct  204  KAISSAIVDLVDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQDHDPLTGCIPWLNEFGEH  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HNE L+ EL  L++L+PH  IIYADY+N+  R ++ P  YGF+N L ACCG GG YN   
Sbjct  264  HNEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTI  323

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
               CG +    C +PS +++WDG HLTEA YQ +   LL GP+ +P  +  C+ S    K
Sbjct  324  DKECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNGPYATPAFDWSCLDSDSVAK  383



>gb|EEC71081.1| hypothetical protein OsI_02841 [Oryza sativa Indica Group]
Length=388

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L++   + S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VPKV+ 
Sbjct  129  QMQWFKKLLTTVSSSESELNDIMTKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVG  188

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S I ELI  GA+ L+VPGN PIGC P YLS F +     YD +TGCI WLN+FTEYH
Sbjct  189  TITSAITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYH  248

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N LLQ+EL  LR L+P   IIYADYY AA+ ++ +P  +GF   L +CCG   PYN +P 
Sbjct  249  NRLLQEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPS  308

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   S VC  PS Y SWDG+H TEA Y+ I+ G+L G + +P ++  C
Sbjct  309  ILCGHPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYANPPLSETC  358



>ref|XP_003569350.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Brachypodium 
distachyon]
Length=402

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 153/231 (66%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK +LSS   + S  ++ +  S+ L+GE+GGNDYN+  ++G   +E+   VP V+ 
Sbjct  142  QIQWFKNLLSSIASSESEHRDVMSKSLFLVGEVGGNDYNHLIVRGKSLDELHKLVPNVVG  201

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
            VI+S I ELI  GA+ L+VPGN PIGC P YL+ F +     Y+ +TGCI WLN+FTEYH
Sbjct  202  VISSAITELINLGARKLVVPGNFPIGCVPLYLAIFPSQKEGYYNEKTGCIEWLNEFTEYH  261

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N L+Q+EL+ LR LHP   +IYADYY A + +YR+P  +GF   L +CCG   P+N +P 
Sbjct  262  NRLIQEELDKLRNLHPDVSLIYADYYGATLDIYRAPLQFGFTVPLNSCCGSDAPHNCSPS  321

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG+  S VC  PS YISWDG+H TEA Y+ I+ G+L G +  P ++  C
Sbjct  322  VMCGNPGSFVCPDPSKYISWDGLHFTEATYKVIIQGVL-GSYAFPPLSETC  371



>ref|XP_006644441.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=265

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C    + CK+ +  S+ L+GEIGGNDYN+  L G    ++ SF P VI
Sbjct  13   EMKWFRDLLHLLCPAGLAGCKDMMNQSLFLVGEIGGNDYNHPLLNGVSITKIRSFPPSVI  72

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I ELI  GA+ L+VPGNLPIGC P+YL  FM+    +Y+PQTGC+ W+N+F++Y
Sbjct  73   AKISSIITELIGLGAKTLVVPGNLPIGCIPNYLRIFMSDKQEDYEPQTGCLRWMNEFSQY  132

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL  EL  LR+LHP+  IIYADYY AAM ++ SP ++G E+ L ACCGG GPY  + 
Sbjct  133  HNKLLLDELEKLRKLHPNVTIIYADYYGAAMEIFLSPEHFGIEDPLVACCGGEGPYGVSA  192

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG+    VCD P  Y SWDG H TEAAY+ +  GL+ G  T P I
Sbjct  193  DARCGTGEYKVCDDPEKYASWDGHHPTEAAYKAMAVGLVRGSHTQPPI  240



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 153/236 (65%), Gaps = 3/236 (1%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
             +L WFK +L S C++ S C+E   SS+I+MG  GGNDY ++FLQG   EE  + VP VI
Sbjct  147  TQLSWFKGVLPSLCRS-SSCRELFNSSLIVMGPFGGNDYGHSFLQGRSLEETKTLVPLVI  205

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+ +I ELI  G + ++VPG LP GC P  L+ F      +YD  TGC+ WLNDF++Y
Sbjct  206  NAISISIQELINLGVKNIMVPGMLPDGCLPISLTMFKGYKKEDYDRITGCLIWLNDFSKY  265

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGG-PYNS  207
            HNELLQ EL  +R+ H +  ++YA+YY+A M+LY SP  YGF    L ACCG GG PYN 
Sbjct  266  HNELLQAELTRIRQRHRNAVVMYANYYDALMQLYLSPEQYGFGGEPLTACCGAGGIPYNY  325

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECIL  39
            +  A CG   S  C  PS YISWDG H TEAAY++I   LL GP+T+P IN  C L
Sbjct  326  DSDAVCGDPPSRACAQPSLYISWDGAHCTEAAYRFITKSLLEGPYTAPHINSSCSL  381



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 152/234 (65%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +     E+    P +I
Sbjct  143  QLNTFKQILPTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEDKSINEIKELTPLII  202

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+  I +LI  G +  +VPG+ P GCS +YL+ F T+   +YDP TGC+ WLNDF ++
Sbjct  203  KAISDAIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEEDYDPLTGCLPWLNDFGKH  262

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            H+E L+ E+  LR+ +PH  IIYADYYN+  RLY+ P  YGF+N  L ACCG GG YN  
Sbjct  263  HDEQLKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFT  322

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP+ +P  N  C+
Sbjct  323  IGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>ref|XP_006853138.1| hypothetical protein AMTR_s00038p00165200 [Amborella trichopoda]
 gb|ERN14605.1| hypothetical protein AMTR_s00038p00165200 [Amborella trichopoda]
Length=744

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 158/231 (68%), Gaps = 3/231 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L+WF+Q+L S C  P  CK+Y++ S+ L+GEIGGNDYNYAF+     +E+ S VP V
Sbjct  506  GVQLNWFEQLLPSLCD-PLECKKYMKKSLFLVGEIGGNDYNYAFIAAKRMDELKSLVPHV  564

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +      +  LI+ GA+ ++VPGNLPIGC P YL+ F   +  +YDPQTGC+ +LNDF+ 
Sbjct  565  LKSTMHAVEVLIRKGAKNVVVPGNLPIGCLPIYLTLFKKFDRQQYDPQTGCLTYLNDFSI  624

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT--LEACCGGGGPYN  210
             HN  LQ+ +  +R+  PH RI+YADYYNAAMR+++ P ++GF N   L ACCG GG YN
Sbjct  625  DHNSKLQESIKVMRQRFPHARIMYADYYNAAMRIFKKPESHGFTNETPLSACCGRGGHYN  684

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             N   +CG     VC+ PSS++SWDG+HLTEAAY+ +V  LL G  T P I
Sbjct  685  FNFINWCGHLGVPVCNDPSSHVSWDGIHLTEAAYKSMVQSLLCGGLTYPHI  735


 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 135/199 (68%), Gaps = 3/199 (2%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L WF+ +L S C+ PS CKEY++ S+ L+GEIGGNDYNYAF QG   + V S+V  V
Sbjct  140  GVQLQWFRDLLPSLCE-PSDCKEYMKKSMFLVGEIGGNDYNYAFFQGRSIDAVKSYVDDV  198

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I   + ELI  GA+ L+VPGNLPIGCS SYL+ F TS+  +YDPQTGC+  LNDF  
Sbjct  199  VNYIMDAVTELILKGAETLVVPGNLPIGCSTSYLTAFQTSDKQQYDPQTGCLTHLNDFAC  258

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYN  210
            +HN  LQ  +  +RE  PH RI+YADYYN+AMR +++P  +GF  E  L ACCG GG YN
Sbjct  259  HHNSKLQDAIKVMRERFPHARIMYADYYNSAMRFFKNPELFGFPKETYLSACCGVGGQYN  318

Query  209  SNPHAYCGSQLSTVCDSPS  153
             N    CG+   TVC  PS
Sbjct  319  YNFVKTCGTSGVTVCKDPS  337



>ref|XP_007148063.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
 gb|ESW20057.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
Length=370

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 153/229 (67%), Gaps = 3/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  Y E S+ L+GEIGGNDYNYA + G+   ++ + VP V+ 
Sbjct  137  QLGWFKKLKPSLCSTKQDCGSYFERSLFLVGEIGGNDYNYAAIAGN-ITQLQATVPPVVE  195

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I + INELI  GA+ L+VPGNLPIGCS  YL+ + + N  +YD   GC+   NDF EYH
Sbjct  196  TITTAINELIAEGARELLVPGNLPIGCSALYLTLYGSGNKEDYDGD-GCLKGFNDFAEYH  254

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N+ L+  L  LR+ +PH RI+YADYY+ A R + +P +YGF +  L ACCGGGG YN N 
Sbjct  255  NKELKLALKTLRQKNPHARILYADYYDVAKRFFHAPGHYGFSSGALRACCGGGGAYNFNM  314

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   S VC  PS++ +WDG+HLTEAAY++I  GL+ GPF+ P + 
Sbjct  315  SARCGHIGSKVCADPSTHANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  363



>gb|EAZ12674.1| hypothetical protein OsJ_02589 [Oryza sativa Japonica Group]
 dbj|BAH01546.1| unnamed protein product [Oryza sativa Japonica Group]
Length=408

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L++   + S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VPKV+ 
Sbjct  149  QMQWFKKLLTTVSSSESELNDIMTKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVG  208

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S I ELI  GA+ L+VPGN PIGC P YLS F +     YD +TGCI WLN+FTEYH
Sbjct  209  TITSAITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYH  268

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N LLQ+EL  LR L+P   IIYADYY AA+ ++ +P  +GF   L +CCG   PYN +P 
Sbjct  269  NRLLQEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPS  328

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   S VC  PS Y SWDG+H TEA Y+ I+ G+L G + +P ++  C
Sbjct  329  ILCGHPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYANPPLSETC  378



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 155/236 (66%), Gaps = 3/236 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + +R C+E L  S+ILMGEIGGNDYNY F +G    E+   VP +I
Sbjct  114  QLNTFKQILPNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLII  173

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +LI  G +  +VPGN PIGCS +YL+ F T+   E+DP TGCI WLN F E+
Sbjct  174  KAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATV-EHDPFTGCIPWLNKFGEH  232

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HNE L+ EL  L++L+PH  IIYADYYN+   L++ P  YGF+N  L ACCG GG YN  
Sbjct  233  HNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFT  292

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
                CG    + C +PS Y++WDG HLTEA YQ +  GLL G +T+P  +  C+ S
Sbjct  293  IGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPAFDWSCLGS  348



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 155/236 (66%), Gaps = 3/236 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + +R C+E L  S+ILMGEIGGNDYNY F +G    E+   VP +I
Sbjct  146  QLNTFKQILPNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLII  205

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +LI  G +  +VPGN PIGCS +YL+ F T+   E+DP TGCI WLN F E+
Sbjct  206  KAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATV-EHDPFTGCIPWLNKFGEH  264

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HNE L+ EL  L++L+PH  IIYADYYN+   L++ P  YGF+N  L ACCG GG YN  
Sbjct  265  HNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFT  324

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
                CG    + C +PS Y++WDG HLTEA YQ +  GLL G +T+P  +  C+ S
Sbjct  325  IGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPAFDWSCLGS  380



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 154/235 (66%), Gaps = 3/235 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+WFK++L + C  + + C E LE+S+ L+GEIGGND+NY         EV ++VP VI
Sbjct  148  QLNWFKELLPALCNHSSTNCHEVLENSLFLVGEIGGNDFNYPLFIQKSISEVKTYVPHVI  207

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I S INELI  GA+ LIVPGN P+GC+  YL+ +   + ++YD   GC+ WLN F E+
Sbjct  208  NAITSAINELIYLGARTLIVPGNFPLGCNAIYLTKYEAKDKNQYD-SAGCLKWLNAFAEF  266

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            +N+ LQ E++ LR +HP   IIYADYYNA + LY  P  YGF   L+ACCG GGPYN N 
Sbjct  267  YNQKLQYEIHRLRGIHPDANIIYADYYNAVLPLYHYPTKYGFTG-LKACCGIGGPYNYNT  325

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
               CG      C+ PS YI WDG+HLTEAAY+ I DGL+ GP+  P+ +  C ++
Sbjct  326  SKACGDPDVIACEDPSQYIGWDGIHLTEAAYKLIADGLINGPYCVPQFSNLCFMN  380



>sp|Q3ZFI4.1|SCE3_BRANA RecName: Full=Sinapine esterase; Short=BnSCE3; AltName: Full=Lipase 
2; Short=BnLIP2; Flags: Precursor [Brassica napus]
 gb|AAX58135.1| lipase 2 [Brassica napus]
Length=389

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 153/234 (65%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E L  S+ILMGE GGNDYNY F +     E+    P +I
Sbjct  143  QLNTFKQILPTLCASSSRDCREMLGDSLILMGESGGNDYNYPFFEDKSINEIKELTPLII  202

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+  I +LI  G +  +VPG+ P+GCS +YL+ F T+   +YDP TGC+ WLNDF ++
Sbjct  203  KAISDAIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEKDYDPLTGCLPWLNDFGKH  262

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            H+E L+ E+  LR+L+PH  I+YADYYN+  RLY+ P  YGF+N  L ACCG GG YN  
Sbjct  263  HDEQLKTEIRRLRKLYPHVNIMYADYYNSLYRLYQKPTKYGFKNRPLAACCGVGGQYNFT  322

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG +    C +PS YI+WDG H+TEAA+Q +  G+L GP+ +P  N  C+
Sbjct  323  IGEECGYEGVGYCQNPSEYINWDGYHITEAAHQKMAHGILNGPYATPAFNWSCL  376



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 150/229 (66%), Gaps = 3/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  Y + S+ L+GEIGGNDYNYA + G+   ++ S VP V+ 
Sbjct  142  QLGWFKKLKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAGN-VTQLQSTVPPVVE  200

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   IN LI  GA+ L+VPGN PIGCS  YL+ F + N  +YD ++GC+   N F EYH
Sbjct  201  AITMAINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-ESGCLKTFNGFAEYH  259

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N  L+  L  LR+ +PH RI+YADYY AA R + +P ++GF N  L ACCGGGGP+N N 
Sbjct  260  NRELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNI  319

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   S  C  PS+Y +WDG+HLTEAAY++I  GL+ GPF+ P + 
Sbjct  320  SARCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  368



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 154/254 (61%), Gaps = 16/254 (6%)
 Frame = -2

Query  779  ERNY**LHKCISGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  600
            ER Y   H    G ++  FK+ L + C  PS              EIGGNDYN  F +  
Sbjct  132  ERGYHCSHNISLGVQVKVFKESLPNLCGLPS--------------EIGGNDYNGPFFERR  177

Query  599  PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  420
               EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP 
Sbjct  178  LINEVKELVPLVISTISSAITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIEEYDP-  236

Query  419  TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  243
             GC+ WLN F EYH+E LQ EL  LR+L+PH  IIYADYYNA +RL + P  YGF N  L
Sbjct  237  FGCLKWLNKFGEYHDEQLQAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPL  296

Query  242  EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
             ACCG G PYN N    CGS     C+ PS Y++WDG+H+TEAAY++I DGLL GP+TSP
Sbjct  297  SACCGVGEPYNFNFSTCCGSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSP  356

Query  62   KINGECILSRPKTK  21
              N  C+ S+ K K
Sbjct  357  PFNWTCLTSKIKNK  370



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 152/234 (65%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +     E+    P +I
Sbjct  143  QLNTFKQILPTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEDKSINEIKELTPLII  202

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+  I +LI  G +  +VPG+ P GCS +YL+ F T+   +YDP TGC+ WLNDF ++
Sbjct  203  KAISDAIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEEDYDPLTGCLPWLNDFGKH  262

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            H+E L+ E+  LR+ +PH  +IYADYYN+  RLY+ P  YGF+N  L ACCG GG YN  
Sbjct  263  HDEQLKTEIKRLRKRYPHVNVIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFT  322

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP+ +P  N  C+
Sbjct  323  IGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>ref|NP_001140937.1| hypothetical protein [Zea mays]
 gb|ACF85001.1| unknown [Zea mays]
 tpg|DAA58957.1| TPA: hypothetical protein ZEAMMB73_908344 [Zea mays]
Length=433

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L+S     +   + +  S+  +GE+GGNDYN+  ++    +E+   VP V+ 
Sbjct  174  QMQWFKKLLTSIAPLETEQNKIISKSLFFVGEVGGNDYNHLIVRDKSVDELHEVVPNVVG  233

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLNDF EYH
Sbjct  234  AISSAITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNDFAEYH  293

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N++LQ+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P 
Sbjct  294  NKMLQEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNACCGSDAPYNCSPS  353

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  354  ILCGRPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSETC  403



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 152/234 (65%), Gaps = 2/234 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +     E+    P +I
Sbjct  143  QLNTFKQILPTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEDKSINEIKELTPLII  202

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+  I +LI  G +  +VPG+ P GCS +YL+ F T+   +YDP TGC+ WLNDF ++
Sbjct  203  KAISDAIVDLIDLGGKTFLVPGSFPGGCSAAYLTLFQTAKEEDYDPLTGCLPWLNDFGKH  262

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            H+E L+ E+  LR+ +PH  IIYADYYN+  RLY+ P  YGF+N  L ACCG GG YN  
Sbjct  263  HDEQLKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFT  322

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  42
                CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP+ +P  N  C+
Sbjct  323  IGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>ref|XP_002455947.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
 gb|EES01067.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
Length=437

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L S   + +  KE +  S+  +GE+GGNDYN+  ++    +E+   VP V+ 
Sbjct  178  QMQWFKKLLPSIASSETEQKEIMSKSLFFVGEVGGNDYNHLIVRQKSLDELHEVVPNVVG  237

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYH
Sbjct  238  AISSAIVDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNEFAEYH  297

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N +LQ+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L +CCG   PYN +P 
Sbjct  298  NRMLQEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNSCCGSDAPYNCSPS  357

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  358  ILCGRPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSETC  407



>gb|KCW63215.1| hypothetical protein EUGRSUZ_G00835, partial [Eucalyptus grandis]
Length=345

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 150/226 (66%), Gaps = 2/226 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+ 
Sbjct  121  QLDWFKKLKSSLCTTQQDCNTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVG  180

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IA+    LI++GA  L+VPGNLPIGC  SY++       ++ +  TGC+N  N+F +YH
Sbjct  181  AIANATGMLIEHGAVELVVPGNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYH  240

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  LQ+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N N 
Sbjct  241  NNYLQRELQVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  300

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
               CGS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP
Sbjct  301  RMMCGST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSP  345



>gb|KCW76148.1| hypothetical protein EUGRSUZ_D00525 [Eucalyptus grandis]
Length=374

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 145/219 (66%), Gaps = 1/219 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++ 
Sbjct  134  QLGWFKSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVG  193

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I   ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YH
Sbjct  194  AIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYH  253

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N  L++EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N 
Sbjct  254  NNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  313

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLL  84
             AYCG   STVC  PS+++ WDG+H TE+AY +I  GL+
Sbjct  314  SAYCGQSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLI  352



>tpg|DAA58330.1| TPA: hypothetical protein ZEAMMB73_195608 [Zea mays]
Length=231

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 0/206 (0%)
 Frame = -2

Query  671  LESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGN  492
            +  S+ L+GEIGGNDYN   L G P E++ +  P V+  I+STI+ELI+ GA+ L+VPGN
Sbjct  2    MNQSLFLVGEIGGNDYNGPLLSGVPMEKIRAITPSVVAKISSTISELIRLGAKTLVVPGN  61

Query  491  LPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIY  312
            LPIGC P YL  F ++   +Y+PQTGC+ W+N+F++YHN++L ++L  LR+LHP   IIY
Sbjct  62   LPIGCIPDYLMIFKSNKEEDYEPQTGCLRWMNEFSQYHNKVLVEQLKKLRKLHPGATIIY  121

Query  311  ADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDG  132
            ADYY AAM ++ SP  YG E  L ACCGG GPY  +P   CG     +CD+P  Y SWDG
Sbjct  122  ADYYGAAMEIFLSPEQYGIEYPLVACCGGEGPYGVSPSTGCGFGEYKLCDNPEKYGSWDG  181

Query  131  MHLTEAAYQWIVDGLLIGPFTSPKIN  54
             H +E+AY+ I  GLL+G +T P I 
Sbjct  182  FHPSESAYRAIAMGLLLGSYTRPSIT  207



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 152/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++L S C + S+C++    S+ ++GEIGGNDY+ A  +G   EE+ S VP+VI 
Sbjct  144  QLRWFKELLPSLCDSDSKCRDLFSRSLFIVGEIGGNDYSLALNRGRSLEEIKSLVPRVIN  203

Query  557  VIASTINELIKY-GAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
             I+S I   I+  GA  L+VPG+LP GC P +L+ F + N  +Y+ +TGC+ WLN  +E+
Sbjct  204  NISSAIQMFIQENGAVTLLVPGHLPYGCFPVFLTDFKSPNEEDYESETGCLRWLNQLSEF  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN--TLEACCGGGGPYNS  207
            +N LLQ+E++ LR LHPH  IIYAD YNA   ++RSP+ +GF     L  CCGG GPYN 
Sbjct  264  NNHLLQEEIHRLRHLHPHVTIIYADLYNAVKAIFRSPDKFGFRKGALLLTCCGGEGPYNY  323

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
            N   +CG + + VC  PS Y SWDG H+TEA Y+ I  GL+ GP+  P  N
Sbjct  324  NKSVHCGVRGAKVCQDPSQYGSWDGTHMTEAVYRVIATGLMEGPYAIPPFN  374



>gb|KCW76155.1| hypothetical protein EUGRSUZ_D00534, partial [Eucalyptus grandis]
Length=362

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 151/228 (66%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++ SS C T   CK Y + S+ L+GEIGGNDYN AF  G   E++   VP V+ 
Sbjct  134  QLDWFKKLKSSLCTTQQDCKTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVG  193

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IA   + LI+ GA  LIVPGNLPIGC  SY++       ++ +  TGC+N  N+F +YH
Sbjct  194  AIAKATSMLIEQGAVELIVPGNLPIGCLTSYITTAPPFLKNDANATTGCLNRYNEFAKYH  253

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N+ LQ+EL  LR+ + H +IIY DYY   MRL+ SP  YGF ++T  ACCG GGP+N N 
Sbjct  254  NDYLQRELQVLRQKYSHAKIIYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  313

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CGS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL  PFTSP++
Sbjct  314  RMMCGST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDSPFTSPRL  360



>ref|XP_006644439.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=405

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 145/226 (64%), Gaps = 1/226 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C    + CK  +  S+ L+GE GGNDYNY  L G    ++ SF P +I
Sbjct  153  EMKWFRDLLDLLCPGDLAGCKGMMNESLFLVGEFGGNDYNYPLLNGVSINKIRSFTPHII  212

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI ELI  GA+ ++VPGNLPIGC P+YL  F +    +Y+ +TGC+ WLN+F++Y
Sbjct  213  AKISSTITELIGLGAKTMVVPGNLPIGCIPNYLVKFESDEKEDYELETGCLRWLNEFSQY  272

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+ L  EL  LR+LHP   IIYADYY A+M ++ SP  +G E+ L ACCGGGGPY  + 
Sbjct  273  HNKHLTDELEKLRKLHPDVAIIYADYYGASMEIFLSPEQFGIEDPLVACCGGGGPYGVSA  332

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  63
               CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P
Sbjct  333  SVRCGHGEYKVCDGPEKYASWDGFHPSEAAYKAITIGLLRGSYTQP  378



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+WFK++L S C +   C E   +S+ LMGEIGGND+NY         E+ ++VP VI+
Sbjct  159  QLNWFKELLPSLCNSSKNCHEVFANSLFLMGEIGGNDFNYPLFIRRSIVEIKTYVPHVIS  218

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S INELI  GA+ L++PGN P+GC+  YL+ + T++ S+YD   GC+ WLN+F E++
Sbjct  219  AITSAINELIDLGARTLMIPGNFPLGCNVIYLTKYETTDKSQYD-SAGCLKWLNEFAEFY  277

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N+ LQ EL+ LR +HPH  IIYADYYNA + LY++P  +GF   L+ CCG GG YN    
Sbjct  278  NQELQYELHRLRRIHPHATIIYADYYNALLPLYQNPTKFGFTG-LKNCCGMGGSYNFGSG  336

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
            + CG      CD PS YI WDG+HLTEAAY+ I DG++ GP + P+ +  C
Sbjct  337  S-CGKPGVFACDDPSQYIGWDGVHLTEAAYRLIADGIINGPCSVPQFSNLC  386



>ref|NP_001149136.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG34335.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=402

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 149/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L     + +   E +  S++ +GEIGGNDYN+  ++    +E+   VP V+ 
Sbjct  143  QMQWFKKLLPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVG  202

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYH
Sbjct  203  AISSGITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYH  262

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N +LQ+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P 
Sbjct  263  NRMLQEELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPS  322

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  323  ILCGRPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSEAC  372



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 156/240 (65%), Gaps = 4/240 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L  FK+ L + C +PS   + +E+++ILMGEIG NDY Y F  G   +EV   +P VIT
Sbjct  146  QLSSFKESLPNLCGSPS---DMMENALILMGEIGLNDYFYLFFVGKSIQEVKELIPLVIT  202

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             ++S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EYDP TGC+ WLN F E H
Sbjct  203  TVSSAITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCLTWLNKFGENH  262

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            +  L+ ELN +++L+PH  IIYADYYNA +R Y+ P  +GF +  L ACCG GGPYN   
Sbjct  263  DSQLRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLCACCGVGGPYNYTS  322

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  21
             + CG+ +   C  PS Y++WDG+H+TEAAY+ + +G+L GP+  P  +  C+ S  K K
Sbjct  323  VSQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPPFDWSCLSSEIKDK  382



>ref|XP_004234095.1| PREDICTED: GDSL esterase/lipase At5g45910 [Solanum lycopersicum]
Length=368

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 150/228 (66%), Gaps = 1/228 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            ++L WFK++ ++ C T   C+EY + S+ ++GEIGGNDYNY    G   +++   VP V+
Sbjct  134  HQLGWFKEVKANICVTRKDCREYFKKSLFIVGEIGGNDYNYPSFLGGSIKQLKVLVPLVV  193

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I    + LI+ GA  LIVPGNLPIGCS  +L+ F T+N   YD + GC+   N F++Y
Sbjct  194  ETIIGATSALIEEGAVELIVPGNLPIGCSAVFLTIFGTTNKDAYD-KYGCLKAYNAFSKY  252

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN  L+  + +LR+ +PH +IIYADYY  A RL  SP +YGF NTL ACCGGGGPYN N 
Sbjct  253  HNAKLKLGIENLRKEYPHAKIIYADYYGVAKRLIHSPKHYGFSNTLVACCGGGGPYNFNN  312

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   S  C   SS+ +WDG+HLTEAAY  I  GLL GPFTSP +
Sbjct  313  SARCGHIGSKSCLDASSFTNWDGIHLTEAAYHHIAKGLLNGPFTSPSL  360



>ref|XP_006367777.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Solanum tuberosum]
Length=368

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 149/228 (65%), Gaps = 1/228 (0%)
 Frame = -2

Query  740  NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            ++L WF+++ S+ C T   C+EY + S+ ++GEIGGNDYNY    G   +++ + VP V+
Sbjct  134  HQLGWFQEVKSNICATKKDCREYFKKSLFIVGEIGGNDYNYPSFLGGSIKQLKALVPLVV  193

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I    + LI+ GA  LIVPGN PIGCS  +L+ F T+N   YD   GC+   N F++Y
Sbjct  194  ETIIEATSVLIEEGAVELIVPGNFPIGCSAVFLTIFGTTNKEAYDKH-GCLKAYNAFSKY  252

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN  L+  + +LR+ +PH +IIYADYY AA RL  SP +YGF NTL ACCGGGGPYN N 
Sbjct  253  HNAKLKLGIENLRKEYPHAKIIYADYYGAAKRLIHSPKHYGFSNTLVACCGGGGPYNFNN  312

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             A CG   S  C   SS+ +WDG+HLTEAAY  I  GLL GPF SP +
Sbjct  313  SARCGHIGSKACLDASSFANWDGIHLTEAAYHHIAKGLLNGPFISPSL  360



>gb|EEE55085.1| hypothetical protein OsJ_02827 [Oryza sativa Japonica Group]
Length=398

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 147/224 (66%), Gaps = 1/224 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E++WF+ +L   C    + C + +  S+ L+GEIGGNDYN+  + G    ++ SF P VI
Sbjct  151  EMNWFRDLLGLLCPDDLADCNDMMNQSLFLVGEIGGNDYNHPLICGVSIRKIRSFTPSVI  210

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI ELI+ GA+ L+VPGNLPIGC P YL  F +    +Y+P+TGC+ W+N F++Y
Sbjct  211  AEISSTITELIRLGAKTLVVPGNLPIGCIPYYLMIFKSGKKEDYEPETGCLRWMNGFSQY  270

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL  EL +LR+LHP   IIYADYY AAM ++ SP  +G EN L ACCGGGGPY  + 
Sbjct  271  HNKLLMDELENLRKLHPDVAIIYADYYGAAMGIFFSPEQFGIENPLAACCGGGGPYGVSE  330

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  69
             A CG     VCD P  Y SWD  H +EA ++ I  GLL G +T
Sbjct  331  TARCGHGEYKVCDDPQLYGSWDDYHPSEAVFKAIAIGLLRGSYT  374



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 151/237 (64%), Gaps = 2/237 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L  FK++L S C+  S C E+L +S+ILMGEIGGNDYNYAF      + V   VP V
Sbjct  152  GVQLTVFKEILPSLCRPSSDCSEFLNNSLILMGEIGGNDYNYAFFTHKSIQVVRELVPPV  211

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            +  I+S I ELI  G +  +VPG+ PIGCS +YL+ F T N  EYDP TGC+ WLN+F E
Sbjct  212  VDAISSAIVELIDMGGRTFLVPGDFPIGCSTAYLTVFQTGNTEEYDPLTGCLTWLNEFAE  271

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNS  207
            YHNE LQ EL+ LR+L+PH  I+Y DYY+   R +  P+ YGF    L ACCG GGPYN 
Sbjct  272  YHNEQLQTELDRLRKLYPHVNIVYGDYYSVVSRFHAQPSKYGFGKMHLAACCGEGGPYNF  331

Query  206  NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
                 CGS +   C  PS Y+ +DG+H+TEA+Y  I + LL G   +  ++  C+ S
Sbjct  332  TLGKQCGSGVP-CCSDPSEYVYFDGVHMTEASYGRIAEHLLDGIRANSALDQCCLSS  387



>gb|ACL53525.1| unknown [Zea mays]
 gb|AFW83241.1| alpha-L-fucosidase 2 [Zea mays]
Length=432

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 149/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L     + +   E +  S++ +GEIGGNDYN+  ++    +E+   VP V+ 
Sbjct  173  QMQWFKKLLPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVG  232

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYH
Sbjct  233  AISSGITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYH  292

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N +LQ+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P 
Sbjct  293  NRMLQEELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPS  352

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  353  ILCGRPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSEAC  402



>gb|ACN28025.1| unknown [Zea mays]
 tpg|DAA58333.1| TPA: hypothetical protein ZEAMMB73_278814 [Zea mays]
Length=395

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 148/228 (65%), Gaps = 5/228 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            E+ WF+ +L   C    + C + +  S+ L+GEIGGNDYN   L G P EE+ +  P V+
Sbjct  147  EMKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNGPLLSGVPFEEIRAITPSVV  206

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+STI+     GA+ L+VPGNLPIGC P YL  F ++   +YDPQTGC+ W+N+F++Y
Sbjct  207  AKISSTIS----LGAKTLVVPGNLPIGCVPKYLMIFKSNKKEDYDPQTGCLRWMNEFSQY  262

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  201
            HN+LL ++L  LR LHP   IIYADYY AAM ++ SP  YG E  L ACCG  GPY  +P
Sbjct  263  HNKLLVEQLKKLRRLHPGVTIIYADYYGAAMEIFLSPERYGIEYPLVACCGAEGPYGVSP  322

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CG     +CD+P  Y SWDG+H TE+AY+ I  GLL+G +T P I
Sbjct  323  TTSCGLGEYKLCDNPERYGSWDGLHPTESAYKVIAMGLLLGSYTRPPI  370



>ref|XP_008654982.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
Length=431

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 149/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L     + +   E +  S++ +GEIGGNDYN+  ++    +E+   VP V+ 
Sbjct  172  QMQWFKKLLPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVG  231

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYH
Sbjct  232  AISSGITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYH  291

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N +LQ+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P 
Sbjct  292  NRMLQEELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPS  351

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
              CG   STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  352  ILCGRPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSEAC  401



>ref|XP_010054333.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=388

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 151/228 (66%), Gaps = 2/228 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +LDWFK++ SS C T   CK Y + S+ L+GEIGGNDYN AF  G   E++   VP V+ 
Sbjct  160  QLDWFKKLKSSLCTTQQDCKTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVG  219

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             IA   + LI+ GA  LIVPGNLPIGC  SY++       ++ +  TGC+N  N+F +YH
Sbjct  220  AIAKATSMLIEQGAVELIVPGNLPIGCLTSYITTAPPFLKNDANATTGCLNRYNEFAKYH  279

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  201
            N+ LQ+EL  LR+ + H +IIY DYY   MRL+ SP  YGF ++T  ACCG GGP+N N 
Sbjct  280  NDYLQRELQVLRQKYSHAKIIYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  339

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
               CGS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL  PFTSP++
Sbjct  340  RMMCGST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDSPFTSPRL  386



>ref|NP_174185.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31008.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 150/232 (65%), Gaps = 1/232 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L+ FKQ+L + C + S C+E L  S+ILMGEIG NDYNY F +G    E+   VP VI 
Sbjct  144  QLNIFKQILPNLCTSSSHCREMLGDSLILMGEIGVNDYNYPFFEGKSINEIKQLVPLVIK  203

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I+S I +LI  G +  +VPGN P+GC P+YL+ F T+   ++DP TGCI  LN+F EYH
Sbjct  204  AISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEEDHDPFTGCIPRLNEFGEYH  263

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNP  201
            NE L+ EL  L+EL+ H  IIYADYYN+  RLY+ P  YGF+N  L ACCG GG YN   
Sbjct  264  NEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGFKNRPLAACCGVGGQYNFTI  323

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
               CG +  + C +PS Y++WDG HLTEA +Q +   +L G + SP  +  C
Sbjct  324  GKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVILNGTYASPAFDWSC  375



>ref|XP_002438721.1| hypothetical protein SORBIDRAFT_10g025020 [Sorghum bicolor]
 gb|EER90088.1| hypothetical protein SORBIDRAFT_10g025020 [Sorghum bicolor]
Length=254

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 144/231 (62%), Gaps = 4/231 (2%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTP----SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVP  570
            EL+WF+ ML   C       S C + +  S+ ++GEIGGNDYN   L+    E+V++F P
Sbjct  2    ELEWFRDMLGLLCPADGLSLSGCSDVMNQSLFIVGEIGGNDYNLPLLERVAFEDVVTFAP  61

Query  569  KVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDF  390
             VI  ++S+I ELI+ GA+ L+VPGNLPIGC P YL  F +    +Y+P TGCI WLN+F
Sbjct  62   AVIAKVSSSITELIRLGAKTLVVPGNLPIGCIPMYLLAFQSDENEDYEPGTGCIKWLNEF  121

Query  389  TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYN  210
              YHN+LL +EL  LR+LHP   IIYADYY AA  ++ SP  YG E  L ACCGGGG Y 
Sbjct  122  ARYHNKLLIQELEKLRKLHPRVTIIYADYYGAATEVFASPQQYGIEYPLMACCGGGGRYG  181

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
             +    CG     +C++P  + SWDGMH +E  Y+ I   LL G  T P I
Sbjct  182  VSSGVRCGRGEYKLCENPEMHGSWDGMHPSETVYKAIAMSLLRGSRTQPPI  232



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 151/236 (64%), Gaps = 2/236 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  561
            +LD FKQ+L + C + +R CKE L  S+ILMGEIGGNDYNY F +G    E+   VP ++
Sbjct  144  QLDTFKQILPNLCASSTRDCKEMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLIV  203

Query  560  TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  381
              I+S I +LI  G +  +VPG  P GCS +YL+ F T    + DP TGC   LN+F E+
Sbjct  204  KAISSAIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEKDQDPLTGCYPLLNEFGEH  263

Query  380  HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSN  204
            HNE L+ EL  L++ +PH  IIYADY+N+  R Y+ P  YGF+N  L ACCG GG YN  
Sbjct  264  HNEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFT  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  36
                CG +    C +PS Y++WDG HLTEAAYQ + +G+L GP+ +P  +  C+ S
Sbjct  324  IGKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNGPYATPAFDWSCLGS  379



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 149/229 (65%), Gaps = 3/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            +L WFK++  S C T   C  Y + S+ ++GEIGGNDYNYA   G+   ++ + VP V+ 
Sbjct  142  QLGWFKKLKPSLCTTKQDCDSYFKKSLFVVGEIGGNDYNYAAFAGN-ISDLQATVPLVVE  200

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I  TI ELI  GA  L+VPGNLPIGCS  YL+ F + N  +YD + GC+   N F +YH
Sbjct  201  EITKTITELIAEGAVELLVPGNLPIGCSAVYLTLFRSKNIEDYD-KNGCLKAFNGFAKYH  259

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  201
            N+ L   L  LR+ +PH RIIYA+Y+ AA R + +P +YGF N    ACCGGGGPYN N 
Sbjct  260  NKQLNLALETLRQKNPHARIIYANYFGAANRFFHAPRHYGFTNGASRACCGGGGPYNFNN  319

Query  200  HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  54
             A CG   S  C  P++Y +WDG+HLTEAAY+ I  GL+ GPFT+P +N
Sbjct  320  SARCGHSNSKACADPTTYANWDGIHLTEAAYRHIAKGLIEGPFTNPPLN  368



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 157/235 (67%), Gaps = 2/235 (1%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +   FK+ L + C + + C+E + ++++++GEIGGNDYNY FL G   EE+   VP V
Sbjct  145  GVQFKNFKESLPNICGSLADCREMIGNALLIVGEIGGNDYNYGFLVGKTVEELKELVPLV  204

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I+ ++S I +L+  G + ++VP + PIGC  ++L+ +  SN  EYDP TGC+  LN+F E
Sbjct  205  ISSMSSVITDLVNMGGKTIMVPADFPIGCWSAFLTEYWISNKEEYDPLTGCLKSLNEFIE  264

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN--TLEACCGGGGPYN  210
            YHN+ LQ+E+N +++L+PH  I+YADYYNA +R++  P  +GF +   L ACCG G PYN
Sbjct  265  YHNKELQEEINRVQKLYPHVTILYADYYNALLRIFLEPAKFGFTSGRPLSACCGTGEPYN  324

Query  209  SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  45
             N  ++CG++    C  PS Y+ WDG HLTE+AY+WI  G L GP+T P  +  C
Sbjct  325  FNSMSWCGTKNVDSCIDPSKYVHWDGFHLTESAYRWIAMGFLKGPYTIPAYDWSC  379



>dbj|BAD61220.1| lanatoside 15'-O-acetylesterase-like [Oryza sativa Japonica Group]
 dbj|BAD61510.1| lanatoside 15'-O-acetylesterase-like [Oryza sativa Japonica Group]
Length=386

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 141/216 (65%), Gaps = 0/216 (0%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  558
            ++ WFK++L++   + S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VPKV+ 
Sbjct  149  QMQWFKKLLTTVSSSESELNDIMTKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVG  208

Query  557  VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  378
             I S I ELI  GA+ L+VPGN PIGC P YLS F +     YD +TGCI WLN+FTEYH
Sbjct  209  TITSAITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYH  268

Query  377  NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  198
            N LLQ+EL  LR L+P   IIYADYY AA+ ++ +P  +GF   L +CCG   PYN +P 
Sbjct  269  NRLLQEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPS  328

Query  197  AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDG  90
              CG   S VC  PS Y SWDG+H TEA Y+ I+ G
Sbjct  329  ILCGHPGSVVCSDPSKYTSWDGLHFTEATYKIIIQG  364



>ref|NP_001043721.1| Os01g0649900 [Oryza sativa Japonica Group]
 dbj|BAB89190.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05635.1| Os01g0649900 [Oryza sativa Japonica Group]
 gb|EAY75183.1| hypothetical protein OsI_03073 [Oryza sativa Indica Group]
 gb|EAZ12905.1| hypothetical protein OsJ_02826 [Oryza sativa Japonica Group]
Length=400

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 146/229 (64%), Gaps = 2/229 (1%)
 Frame = -2

Query  737  ELDWFKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            E++WF+ +L   C       CK  +  S+ L+GEIGGNDYN   + G   E++ +F P V
Sbjct  147  EMEWFRDLLGMLCTGGDMDGCKGMMNQSLFLVGEIGGNDYNLPLMSGMSIEKIRNFTPSV  206

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I+S I ELI  GA+ L+VPGN+PIGC P YL  F +    +Y+P+ GC+ W+N+F++
Sbjct  207  IAKISSIITELIGLGAKTLVVPGNIPIGCIPMYLMQFESDKKEDYEPKIGCLRWMNEFSQ  266

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            YHN+LL  EL +LR+LH    IIYADYY AAM ++ SP  +G E+ L ACCGG GPY  +
Sbjct  267  YHNKLLVDELENLRKLHLDVTIIYADYYGAAMEVFLSPERFGIEDPLVACCGGRGPYGVS  326

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  57
                CG     VCD P+ Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  327  ASVRCGYGEYKVCDDPAKYASWDGFHPSEAAYKGIAIGLLQGSYTQPPI  375



>gb|KJB57433.1| hypothetical protein B456_009G164000 [Gossypium raimondii]
Length=379

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 153/228 (67%), Gaps = 1/228 (0%)
 Frame = -2

Query  743  GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  564
            G +L   K +L S C + S C E+L +S+ILMGEIGGN++N AF+QG   E +   VP+V
Sbjct  145  GVQLGLLKTLLPSLCSSSSACNEFLNNSLILMGEIGGNEFNLAFIQGISSEVIGGLVPEV  204

Query  563  ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  384
            I  I++ I ELI+ GA   +VPG +P+GC P  L+ F TSN   YD + GC+ WLNDF  
Sbjct  205  IKAISAAIEELIELGAMTFVVPGTIPLGCLPVLLTRFRTSNKQAYD-RYGCLIWLNDFAH  263

Query  383  YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  204
            Y+NE L+KEL  +R LHP   IIYADYY A+M LY SP ++GF++TL ACCGG GPYN N
Sbjct  264  YYNEYLKKELESMRRLHPRINIIYADYYQASMPLYLSPRSFGFKSTLTACCGGEGPYNVN  323

Query  203  PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  60
                CG   +  CD PSSY++WDG H T+ A++ I +GLL G  T P+
Sbjct  324  VTLSCGDPGTKSCDDPSSYVNWDGAHFTDEAHRVISNGLLDGSCTIPR  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005