BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015E02

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004147981.1|  PREDICTED: methylsterol monooxygenase 1-2-like   53.5    4e-13   
ref|XP_007039998.1|  Sterol-4alpha-methyl oxidase 1-1 isoform 4       50.8    8e-13   
ref|XP_010676652.1|  PREDICTED: methylsterol monooxygenase 1-1-like   50.8    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011463780.1|  PREDICTED: methylsterol monooxygenase 1-1        50.1    2e-12   Fragaria vesca subsp. vesca
ref|XP_007039997.1|  Sterol-4alpha-methyl oxidase 1-1 isoform 3       51.2    2e-12   
ref|XP_007039996.1|  Sterol-4alpha-methyl oxidase 1-1 isoform 2       50.8    2e-12   
ref|XP_009624558.1|  PREDICTED: methylsterol monooxygenase 1-1-like   73.2    3e-12   Nicotiana tomentosiformis
ref|XP_009778106.1|  PREDICTED: methylsterol monooxygenase 1-1-like   73.2    3e-12   Nicotiana sylvestris
gb|KJB37583.1|  hypothetical protein B456_006G211800                  49.7    4e-12   Gossypium raimondii
gb|EPS64399.1|  hypothetical protein M569_10383                       53.5    5e-12   Genlisea aurea
ref|XP_011033882.1|  PREDICTED: methylsterol monooxygenase 1-1-like   51.6    5e-12   Populus euphratica
gb|KHN40569.1|  Methylsterol monooxygenase 1-1                        52.4    5e-12   Glycine soja [wild soybean]
ref|XP_002304440.1|  STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein  51.2    5e-12   
ref|XP_010055545.1|  PREDICTED: methylsterol monooxygenase 1-1-like   51.2    5e-12   Eucalyptus grandis [rose gum]
ref|XP_007209426.1|  hypothetical protein PRUPE_ppa009470mg           50.4    6e-12   
ref|XP_008238656.1|  PREDICTED: methylsterol monooxygenase 1-1-like   50.4    9e-12   Prunus mume [ume]
ref|NP_001276171.1|  uncharacterized protein LOC100793153             50.1    2e-11   Glycine max [soybeans]
ref|XP_009413771.1|  PREDICTED: methylsterol monooxygenase 1-1        51.2    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799517.1|  PREDICTED: methylsterol monooxygenase 1-1-li...  48.1    3e-11   Phoenix dactylifera
ref|NP_001190801.1|  sterol 4-alpha methyl oxidase 1-3                48.1    3e-11   
ref|XP_010433997.1|  PREDICTED: methylsterol monooxygenase 1-3        48.1    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008805720.1|  PREDICTED: methylsterol monooxygenase 1-1-like   48.5    3e-11   Phoenix dactylifera
ref|XP_008799518.1|  PREDICTED: methylsterol monooxygenase 1-1-li...  48.1    3e-11   Phoenix dactylifera
ref|XP_010439290.1|  PREDICTED: methylsterol monooxygenase 1-3-like   48.1    3e-11   Camelina sativa [gold-of-pleasure]
emb|CAA16560.1|  predicted protein                                    47.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136100.1|  PREDICTED: methylsterol monooxygenase 1-3        48.1    4e-11   Brassica rapa
ref|XP_010108130.1|  Methylsterol monooxygenase 1-1                   48.1    4e-11   Morus notabilis
gb|KHN29450.1|  Methylsterol monooxygenase 1-1                        49.7    4e-11   Glycine soja [wild soybean]
ref|XP_007051947.1|  Sterol-4alpha-methyl oxidase 1-1                 48.1    4e-11   
ref|NP_567669.1|  sterol 4-alpha methyl oxidase 1-3                   48.1    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283414.1|  hypothetical protein CARUB_v10004463mg           48.1    6e-11   
ref|XP_006363724.1|  PREDICTED: methylsterol monooxygenase 1-1-like   69.7    6e-11   Solanum tuberosum [potatoes]
ref|XP_006851841.1|  hypothetical protein AMTR_s00041p00076350        48.5    6e-11   
ref|XP_010909206.1|  PREDICTED: methylsterol monooxygenase 1-1-like   51.2    7e-11   Elaeis guineensis
ref|NP_001148698.1|  LOC100282314                                     47.0    7e-11   Zea mays [maize]
ref|XP_002867753.1|  hypothetical protein ARALYDRAFT_329352           48.1    8e-11   
ref|XP_002467559.1|  hypothetical protein SORBIDRAFT_01g030160        47.4    8e-11   Sorghum bicolor [broomcorn]
ref|XP_010436432.1|  PREDICTED: methylsterol monooxygenase 1-3-like   48.1    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004983772.1|  PREDICTED: methylsterol monooxygenase 1-1-like   47.0    9e-11   Setaria italica
ref|XP_009401815.1|  PREDICTED: methylsterol monooxygenase 1-1-li...  48.1    9e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB51950.1|  hypothetical protein B456_008G240000                  47.8    1e-10   Gossypium raimondii
gb|KFK28859.1|  hypothetical protein AALP_AA7G057800                  48.1    1e-10   Arabis alpina [alpine rockcress]
emb|CDY71421.1|  BnaAnng37370D                                        47.8    1e-10   Brassica napus [oilseed rape]
ref|XP_006413626.1|  hypothetical protein EUTSA_v10024722mg           48.1    1e-10   
ref|XP_004492635.1|  PREDICTED: methylsterol monooxygenase 1-1-like   46.6    1e-10   Cicer arietinum [garbanzo]
gb|KFK28850.1|  hypothetical protein AALP_AA7G056500                  48.1    2e-10   Arabis alpina [alpine rockcress]
gb|KEH23319.1|  C-4 methylsterol oxidase                              49.3    2e-10   Medicago truncatula
ref|XP_011469129.1|  PREDICTED: methylsterol monooxygenase 1-1-like   46.2    3e-10   Fragaria vesca subsp. vesca
ref|XP_010451257.1|  PREDICTED: methylsterol monooxygenase 1-3-like   48.1    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008356733.1|  PREDICTED: methylsterol monooxygenase 1-2-like   45.4    5e-10   Malus domestica [apple tree]
ref|XP_010439291.1|  PREDICTED: methylsterol monooxygenase 1-3-like   48.1    5e-10   
ref|XP_011081107.1|  PREDICTED: methylsterol monooxygenase 1-1-like   67.0    6e-10   Sesamum indicum [beniseed]
ref|XP_009385252.1|  PREDICTED: methylsterol monooxygenase 1-1-like   48.5    6e-10   
ref|XP_002975864.1|  hypothetical protein SELMODRAFT_104109           47.0    6e-10   
ref|XP_002968617.1|  hypothetical protein SELMODRAFT_170047           47.0    6e-10   Selaginella moellendorffii
ref|XP_003574284.1|  PREDICTED: methylsterol monooxygenase 1-1-like   47.4    7e-10   Brachypodium distachyon [annual false brome]
ref|XP_007219067.1|  hypothetical protein PRUPE_ppa014786mg           47.4    8e-10   Prunus persica
ref|XP_011069892.1|  PREDICTED: methylsterol monooxygenase 1-1-like   66.6    8e-10   Sesamum indicum [beniseed]
ref|XP_011093218.1|  PREDICTED: methylsterol monooxygenase 1-1-like   46.2    8e-10   Sesamum indicum [beniseed]
ref|XP_002270978.3|  PREDICTED: methylsterol monooxygenase 1-1        65.9    1e-09   Vitis vinifera
gb|AAQ94118.1|  sterol-4-alpha methyl oxidase                         45.8    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010906755.1|  PREDICTED: methylsterol monooxygenase 1-1-like   46.2    2e-09   
dbj|BAJ99813.1|  predicted protein                                    47.0    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87077.1|  predicted protein                                    47.0    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009338115.1|  PREDICTED: methylsterol monooxygenase 1-2-like   45.8    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_009368695.1|  PREDICTED: methylsterol monooxygenase 1-2-like   45.8    2e-09   Pyrus x bretschneideri [bai li]
gb|EMT24395.1|  Putative C-4 methylsterol oxidase                     46.2    2e-09   
gb|EMT26728.1|  Putative C-4 methylsterol oxidase                     47.0    2e-09   
dbj|BAK02768.1|  predicted protein                                    46.2    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008232718.1|  PREDICTED: methylsterol monooxygenase 1-1-like   46.2    2e-09   Prunus mume [ume]
ref|XP_006368716.1|  STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein  65.5    2e-09   
gb|AFK37077.1|  unknown                                               65.1    2e-09   Medicago truncatula
gb|KDP25588.1|  hypothetical protein JCGZ_20744                       65.1    2e-09   Jatropha curcas
gb|EMS58692.1|  C-4 methylsterol oxidase                              45.8    3e-09   Triticum urartu
ref|XP_003608797.1|  Sterol-4-methyl-oxidase                          65.1    3e-09   Medicago truncatula
ref|XP_010448846.1|  PREDICTED: methylsterol monooxygenase 1-3-like   48.1    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_001765160.1|  predicted protein                                45.4    4e-09   
ref|XP_011034330.1|  PREDICTED: methylsterol monooxygenase 1-1-like   43.9    4e-09   Populus euphratica
ref|XP_001780893.1|  predicted protein                                45.8    4e-09   
ref|XP_002320723.2|  hypothetical protein POPTR_0014s06510g           43.9    7e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011029101.1|  PREDICTED: methylsterol monooxygenase 1-1-like   63.5    8e-09   Populus euphratica
ref|XP_003577766.1|  PREDICTED: methylsterol monooxygenase 1-2-like   48.9    8e-09   Brachypodium distachyon [annual false brome]
ref|XP_008232660.1|  PREDICTED: probable protein S-acyltransferas...  48.9    1e-08   Prunus mume [ume]
ref|NP_001065206.1|  Os10g0545200                                     44.7    1e-08   
ref|XP_006662024.1|  PREDICTED: methylsterol monooxygenase 1-1-like   43.5    1e-08   Oryza brachyantha
gb|EAZ16865.1|  hypothetical protein OsJ_32341                        44.3    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KJB49389.1|  hypothetical protein B456_008G116500                  43.5    2e-08   Gossypium raimondii
ref|XP_007052057.1|  Sterol-4alpha-methyl oxidase 1-1                 43.1    2e-08   
ref|XP_007039995.1|  Sterol-4alpha-methyl oxidase 1-1 isoform 1       62.8    2e-08   
gb|EYU30461.1|  hypothetical protein MIMGU_mgv1a011047mg              62.4    2e-08   Erythranthe guttata [common monkey flower]
gb|KHG16538.1|  Methylsterol monooxygenase 1-1 -like protein          62.4    2e-08   Gossypium arboreum [tree cotton]
ref|XP_002509623.1|  C-4 methyl sterol oxidase, putative              61.2    3e-08   
emb|CAB40952.1|  putative C-4 sterol methyl oxidase                   61.6    4e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09875.1|  unnamed protein product                              61.6    5e-08   Coffea canephora [robusta coffee]
ref|XP_004515763.1|  PREDICTED: methylsterol monooxygenase 1-1-like   61.6    5e-08   Cicer arietinum [garbanzo]
ref|XP_007140005.1|  hypothetical protein PHAVU_008G076300g           42.7    6e-08   Phaseolus vulgaris [French bean]
ref|XP_010230028.1|  PREDICTED: methylsterol monooxygenase 1-1-like   42.0    8e-08   
gb|KHG07507.1|  Methylsterol monooxygenase 1-1 -like protein          60.5    1e-07   Gossypium arboreum [tree cotton]
gb|KJB25670.1|  hypothetical protein B456_004G203200                  60.5    1e-07   Gossypium raimondii
ref|XP_006413625.1|  hypothetical protein EUTSA_v10025849mg           60.1    1e-07   Eutrema salsugineum [saltwater cress]
gb|AAN62786.1|  Putative C-4 sterol methyl oxidase                    43.9    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88222.1|  hypothetical protein OsI_09673                        43.5    2e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_192948.1|  sterol-4alpha-methyl oxidase 1-1                    59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048701.1|  Os03g0108500                                     43.5    2e-07   
gb|AAQ13424.1|AF039199_1  sterol-4-methyl-oxidase                     59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288336.1|  hypothetical protein CARUB_v10001581mg           59.7    2e-07   Capsella rubella
gb|AAM64961.1|  putative C-4 sterol methyl oxidase                    59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04397.1|  BnaC02g28510D                                        59.3    3e-07   
ref|XP_009128630.1|  PREDICTED: methylsterol monooxygenase 1-1        59.3    3e-07   Brassica rapa
ref|XP_010676653.1|  PREDICTED: methylsterol monooxygenase 1-1-like   59.3    3e-07   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX97357.1|  BnaA02g21480D                                        58.9    3e-07   
ref|XP_002872644.1|  hypothetical protein ARALYDRAFT_911602           58.9    3e-07   Arabidopsis lyrata subsp. lyrata
gb|KDP28753.1|  hypothetical protein JCGZ_14524                       45.1    5e-07   Jatropha curcas
ref|XP_009346393.1|  PREDICTED: methylsterol monooxygenase 1-1-like   58.5    5e-07   Pyrus x bretschneideri [bai li]
gb|KDO63741.1|  hypothetical protein CISIN_1g021962mg                 58.2    8e-07   Citrus sinensis [apfelsine]
ref|XP_004245702.1|  PREDICTED: methylsterol monooxygenase 1-1        57.8    8e-07   
ref|XP_006396795.1|  hypothetical protein EUTSA_v10028846mg           57.8    1e-06   Eutrema salsugineum [saltwater cress]
dbj|BAJ85088.1|  predicted protein                                    41.6    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002455692.1|  hypothetical protein SORBIDRAFT_03g021040        43.9    1e-06   Sorghum bicolor [broomcorn]
ref|XP_010422182.1|  PREDICTED: methylsterol monooxygenase 1-1        57.0    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDX94121.1|  BnaC07g37550D                                        56.6    2e-06   
ref|XP_008448914.1|  PREDICTED: methylsterol monooxygenase 1-2-like   57.0    2e-06   Cucumis melo [Oriental melon]
ref|XP_010540031.1|  PREDICTED: methylsterol monooxygenase 1-1-like   57.0    2e-06   Tarenaya hassleriana [spider flower]
emb|CDX82968.1|  BnaC01g14180D                                        57.4    2e-06   
ref|XP_010433735.1|  PREDICTED: methylsterol monooxygenase 1-1-like   57.0    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004159506.1|  PREDICTED: methylsterol monooxygenase 1-2-like   57.0    2e-06   
ref|XP_010433996.1|  PREDICTED: methylsterol monooxygenase 1-2-like   56.6    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010448845.1|  PREDICTED: methylsterol monooxygenase 1-2        56.6    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010439289.1|  PREDICTED: methylsterol monooxygenase 1-2-like   56.6    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008672295.1|  PREDICTED: hypothetical protein isoform X1       42.7    3e-06   Zea mays [maize]
gb|EYU30561.1|  hypothetical protein MIMGU_mgv11b0246252mg            39.7    4e-06   Erythranthe guttata [common monkey flower]
ref|NP_001136959.1|  hypothetical protein                             42.7    4e-06   Zea mays [maize]
ref|XP_006477294.1|  PREDICTED: methylsterol monooxygenase 1-2-li...  55.8    4e-06   
ref|XP_008369506.1|  PREDICTED: methylsterol monooxygenase 1-1-like   55.8    5e-06   
ref|XP_009373356.1|  PREDICTED: methylsterol monooxygenase 1-1-like   55.8    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_006440422.1|  hypothetical protein CICLE_v10021364mg           55.8    5e-06   Citrus clementina [clementine]
ref|XP_006283986.1|  hypothetical protein CARUB_v10005108mg           55.8    5e-06   
gb|KFK28860.1|  hypothetical protein AALP_AA7G057900                  55.5    5e-06   Arabis alpina [alpine rockcress]
emb|CDY41294.1|  BnaA01g12450D                                        55.1    8e-06   Brassica napus [oilseed rape]
ref|XP_009136152.1|  PREDICTED: methylsterol monooxygenase 1-2        55.1    8e-06   Brassica rapa
ref|XP_010538766.1|  PREDICTED: methylsterol monooxygenase 1-1        54.7    1e-05   Tarenaya hassleriana [spider flower]
gb|KFK31958.1|  hypothetical protein AALP_AA6G181900                  54.7    1e-05   Arabis alpina [alpine rockcress]
gb|AAK61361.1|  putative sterol 4-alpha-methyl-oxidase                54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65428.1|  putative C-4 sterol methyl oxidase                    54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567670.1|  sterol C4-methyl oxidase 1-2                        54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007134847.1|  hypothetical protein PHAVU_010G081300g           53.9    2e-05   Phaseolus vulgaris [French bean]
dbj|BAC57961.1|  putative C-4 sterol methyl oxidase                   38.9    3e-05   Tripolium pannonicum [sea starwort]
gb|EMT21555.1|  Putative C-4 methylsterol oxidase                     38.1    3e-05   
gb|KHN09765.1|  Methylsterol monooxygenase 1-1                        51.2    9e-05   Glycine soja [wild soybean]
gb|AAQ83691.1|  C-4 sterol methyl oxidase 1                           51.6    1e-04   Nicotiana benthamiana
gb|KHN04765.1|  Methylsterol monooxygenase 1-1                        50.8    1e-04   Glycine soja [wild soybean]
ref|XP_010276506.1|  PREDICTED: methylsterol monooxygenase 1-1-like   51.6    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009401921.1|  PREDICTED: methylsterol monooxygenase 1-1-like   51.2    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY79403.1|  hypothetical protein OsI_34531                        41.6    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002970545.1|  hypothetical protein SELMODRAFT_231600           40.8    2e-04   Selaginella moellendorffii
ref|XP_010053398.1|  PREDICTED: methylsterol monooxygenase 1-2-like   50.8    2e-04   Eucalyptus grandis [rose gum]
ref|XP_001758083.1|  predicted protein                                42.0    3e-04   
ref|XP_010325726.1|  PREDICTED: methylsterol monooxygenase 1-1-like   50.4    3e-04   
ref|XP_001770841.1|  predicted protein                                41.6    3e-04   
ref|XP_003525772.2|  PREDICTED: methylsterol monooxygenase 1-1-li...  50.4    3e-04   
gb|AAX95419.1|  4-alpha-methyl-sterol C4-methyl-oxidase               41.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002973214.1|  hypothetical protein SELMODRAFT_173304           43.5    5e-04   
gb|ACL53689.1|  unknown                                               41.6    5e-04   Zea mays [maize]
ref|XP_004978537.1|  PREDICTED: methylsterol monooxygenase 2-1-like   41.2    5e-04   Setaria italica
ref|XP_004969155.1|  PREDICTED: methylsterol monooxygenase 2-2-li...  41.2    5e-04   Setaria italica
ref|XP_002465927.1|  hypothetical protein SORBIDRAFT_01g048370        41.2    5e-04   Sorghum bicolor [broomcorn]
ref|XP_003577193.1|  PREDICTED: methylsterol monooxygenase 2-2-like   41.2    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_002976636.1|  hypothetical protein SELMODRAFT_151304           43.1    6e-04   Selaginella moellendorffii
ref|NP_001105744.1|  LOC542766                                        41.2    6e-04   
ref|XP_009381067.1|  PREDICTED: methylsterol monooxygenase 2-1-li...  41.6    6e-04   
ref|NP_001068557.1|  Os11g0707600                                     41.2    6e-04   
ref|NP_001266521.1|  C-4 methylsterol oxidase                         41.2    6e-04   
emb|CDX82967.1|  BnaC01g14170D                                        49.7    6e-04   
gb|AFW60058.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  41.2    6e-04   
ref|XP_009381066.1|  PREDICTED: methylsterol monooxygenase 2-1-li...  41.2    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145282.1|  PREDICTED: methylsterol monooxygenase 2-2-like   40.0    7e-04   
gb|ACN36082.1|  unknown                                               41.6    8e-04   Zea mays [maize]
gb|EMT30465.1|  Putative C-4 methylsterol oxidase                     40.8    9e-04   
ref|XP_006339428.1|  PREDICTED: methylsterol monooxygenase 1-1-like   48.9    0.001   Solanum tuberosum [potatoes]



>ref|XP_004147981.1| PREDICTED: methylsterol monooxygenase 1-2-like [Cucumis sativus]
Length=273

 Score = 53.5 bits (127),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDKVCI  393
            GG SHSNFASVFTYCDYIYGTDKV I
Sbjct  245  GGQSHSNFASVFTYCDYIYGTDKVVI  270


 Score = 47.8 bits (112),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PW+ TK+IPFYGG DHHDYH YV
Sbjct  219  YDFPWSLTKFIPFYGGADHHDYHHYV  244



>ref|XP_007039998.1| Sterol-4alpha-methyl oxidase 1-1 isoform 4 [Theobroma cacao]
 gb|EOY24499.1| Sterol-4alpha-methyl oxidase 1-1 isoform 4 [Theobroma cacao]
Length=279

 Score = 50.8 bits (120),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PWTPT+YIPFYGG D+HDYH YV       F
Sbjct  219  YDFPWTPTRYIPFYGGADYHDYHHYVGGQSQSNF  252


 Score = 49.7 bits (117),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDKV  399
            GG S SNFASVFTYCDYIYGTDKV
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDKV  268



>ref|XP_010676652.1| PREDICTED: methylsterol monooxygenase 1-1-like [Beta vulgaris 
subsp. vulgaris]
Length=282

 Score = 50.8 bits (120),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFASVFTYCDYIYGTDK
Sbjct  245  GGQSHSNFASVFTYCDYIYGTDK  267


 Score = 48.5 bits (114),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PW+PTKYIPFYGG ++HDYH YV
Sbjct  219  YDFPWSPTKYIPFYGGAEYHDYHHYV  244



>ref|XP_011463780.1| PREDICTED: methylsterol monooxygenase 1-1 [Fragaria vesca subsp. 
vesca]
Length=302

 Score = 50.1 bits (118),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GGLS SNFASVFTYCDYIYGTDK
Sbjct  245  GGLSQSNFASVFTYCDYIYGTDK  267


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PWTPTKYIPFYGG ++HDYH YV
Sbjct  219  YDFPWTPTKYIPFYGGAEYHDYHHYV  244



>ref|XP_007039997.1| Sterol-4alpha-methyl oxidase 1-1 isoform 3 [Theobroma cacao]
 gb|EOY24498.1| Sterol-4alpha-methyl oxidase 1-1 isoform 3 [Theobroma cacao]
Length=306

 Score = 51.2 bits (121),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PWTPT+YIPFYGG D+HDYH YV       F
Sbjct  219  YDFPWTPTRYIPFYGGADYHDYHHYVGGQSQSNF  252


 Score = 47.8 bits (112),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267



>ref|XP_007039996.1| Sterol-4alpha-methyl oxidase 1-1 isoform 2 [Theobroma cacao]
 gb|EOY24497.1| Sterol-4alpha-methyl oxidase 1-1 isoform 2 [Theobroma cacao]
Length=309

 Score = 50.8 bits (120),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PWTPT+YIPFYGG D+HDYH YV       F
Sbjct  219  YDFPWTPTRYIPFYGGADYHDYHHYVGGQSQSNF  252


 Score = 47.8 bits (112),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267



>ref|XP_009624558.1| PREDICTED: methylsterol monooxygenase 1-1-like [Nicotiana tomentosiformis]
Length=300

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 54/119 (45%), Gaps = 39/119 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YDLPWT TKYIPFYGGPD+HDYH YV       F                          
Sbjct  219  YDLPWTITKYIPFYGGPDYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEED  196
                           F+Y  ++    +GYRYQKKVLQQ + AS +N EQNG S    +D
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKVLQQLKGASNVNCEQNGVSAKDCKD  299



>ref|XP_009778106.1| PREDICTED: methylsterol monooxygenase 1-1-like [Nicotiana sylvestris]
Length=300

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 54/119 (45%), Gaps = 39/119 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YDLPWT TKYIPFYGGPD+HDYH YV       F                          
Sbjct  219  YDLPWTITKYIPFYGGPDYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEED  196
                           F+Y  ++    +GYRYQKKVLQQ + AS +N EQNG S    +D
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKVLQQLKGASNVNGEQNGVSAKDLKD  299



>gb|KJB37583.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=523

 Score = 49.7 bits (117),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PWTPT++IPFYGG D+HDYH YV       F
Sbjct  219  YDFPWTPTRFIPFYGGADYHDYHHYVGGQSQSNF  252


 Score = 48.1 bits (113),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267



>gb|EPS64399.1| hypothetical protein M569_10383, partial [Genlisea aurea]
Length=289

 Score = 53.5 bits (127),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YDLPW+PTKYIPFYGGPD+HDYH YV
Sbjct  230  YDLPWSPTKYIPFYGGPDYHDYHHYV  255


 Score = 44.3 bits (103),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDY+YGTDK
Sbjct  256  GKQSQSNFASVFTYCDYLYGTDK  278



>ref|XP_011033882.1| PREDICTED: methylsterol monooxygenase 1-1-like [Populus euphratica]
Length=304

 Score = 51.6 bits (122),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWTPTKYIPFYGG D+HDYH YV       F 
Sbjct  219  YDFPWTPTKYIPFYGGADYHDYHHYVGGQSQSNFA  253


 Score = 46.2 bits (108),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCD+IYGTDK
Sbjct  245  GGQSQSNFASVFTYCDFIYGTDK  267



>gb|KHN40569.1| Methylsterol monooxygenase 1-1 [Glycine soja]
Length=170

 Score = 52.4 bits (124),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -1

Query  552  RYDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            RYD PW+PTKYIPFYGGP +HDYH YV       F 
Sbjct  89   RYDFPWSPTKYIPFYGGPAYHDYHHYVGGKSQSNFA  124


 Score = 45.4 bits (106),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGT K
Sbjct  116  GGKSQSNFASVFTYCDYIYGTHK  138



>ref|XP_002304440.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa]
 gb|EEE79419.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa]
Length=285

 Score = 51.2 bits (121),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWTPTKYIPFYGG D+HDYH YV       F 
Sbjct  219  YDFPWTPTKYIPFYGGADYHDYHHYVGGQSQSNFA  253


 Score = 46.2 bits (108),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCD+IYGTDK
Sbjct  245  GGQSQSNFASVFTYCDFIYGTDK  267



>ref|XP_010055545.1| PREDICTED: methylsterol monooxygenase 1-1-like [Eucalyptus grandis]
 gb|KCW72030.1| hypothetical protein EUGRSUZ_E00478 [Eucalyptus grandis]
Length=305

 Score = 51.2 bits (121),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YDLPW+PTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YDLPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253


 Score = 46.2 bits (108),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCD+IYGTDK
Sbjct  245  GGQSQSNFASVFTYCDFIYGTDK  267



>ref|XP_007209426.1| hypothetical protein PRUPE_ppa009470mg [Prunus persica]
 gb|EMJ10625.1| hypothetical protein PRUPE_ppa009470mg [Prunus persica]
Length=291

 Score = 50.4 bits (119),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWTPTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YDFPWTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253


 Score = 47.0 bits (110),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDKV  399
            GG S SNFASVFTYCD+IYGTDK+
Sbjct  245  GGQSQSNFASVFTYCDFIYGTDKL  268



>ref|XP_008238656.1| PREDICTED: methylsterol monooxygenase 1-1-like [Prunus mume]
Length=302

 Score = 50.4 bits (119),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWTPTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YDFPWTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253


 Score = 46.2 bits (108),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCD+IYGTDK
Sbjct  245  GGQSQSNFASVFTYCDFIYGTDK  267



>ref|NP_001276171.1| uncharacterized protein LOC100793153 [Glycine max]
 gb|ACU17994.1| unknown [Glycine max]
Length=293

 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW+PTKYIPFYGGP +HDYH YV       F 
Sbjct  219  YDFPWSPTKYIPFYGGPAYHDYHHYVGGKSQSNFA  253


 Score = 45.4 bits (106),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGT K
Sbjct  245  GGKSQSNFASVFTYCDYIYGTHK  267



>ref|XP_009413771.1| PREDICTED: methylsterol monooxygenase 1-1 [Musa acuminata subsp. 
malaccensis]
Length=300

 Score = 51.2 bits (121),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFASVFTYCDYIYGTDK
Sbjct  245  GGQSHSNFASVFTYCDYIYGTDK  267


 Score = 44.3 bits (103),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD P TPTKYIPFYGG + HDYH YV
Sbjct  219  YDFPRTPTKYIPFYGGAEFHDYHHYV  244



>ref|XP_008799517.1| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Phoenix 
dactylifera]
Length=321

 Score = 48.1 bits (113),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267


 Score = 47.0 bits (110),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD P +PTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YDFPLSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253



>ref|NP_001190801.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
 gb|AEE84650.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
Length=581

 Score = 48.1 bits (113),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 47.0 bits (110),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK IPFYGGP++HDYH YV       F
Sbjct  217  YDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNF  250



>ref|XP_010433997.1| PREDICTED: methylsterol monooxygenase 1-3 [Camelina sativa]
Length=291

 Score = 48.1 bits (113),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 47.0 bits (110),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWT TK+IPFYGG ++HDYH YV       F 
Sbjct  217  YDFPWTLTKFIPFYGGAEYHDYHHYVGGQSQSNFA  251



>ref|XP_008805720.1| PREDICTED: methylsterol monooxygenase 1-1-like [Phoenix dactylifera]
Length=302

 Score = 48.5 bits (114),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267


 Score = 46.6 bits (109),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD P +PTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YDFPLSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253



>ref|XP_008799518.1| PREDICTED: methylsterol monooxygenase 1-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score = 48.1 bits (113),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267


 Score = 47.0 bits (110),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD P +PTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YDFPLSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253



>ref|XP_010439290.1| PREDICTED: methylsterol monooxygenase 1-3-like [Camelina sativa]
Length=291

 Score = 48.1 bits (113),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 46.6 bits (109),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWT TK+IPFYGG ++HDYH YV       F 
Sbjct  217  YDFPWTLTKFIPFYGGAEYHDYHHYVGGQSQSNFA  251



>emb|CAA16560.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79230.1| predicted protein [Arabidopsis thaliana]
Length=820

 Score = 47.8 bits (112),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  462  GGQSQSNFASVFTYCDYIYGTDK  484


 Score = 47.0 bits (110),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK IPFYGGP++HDYH YV       F
Sbjct  436  YDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNF  469


 Score = 47.8 bits (112),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  257  GGQSQSNFASVFTYCDYIYGTDK  279


 Score = 46.6 bits (109),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TKYIPFYGG ++HDYH YV       F
Sbjct  231  YDFPWSLTKYIPFYGGAEYHDYHHYVGGQSQSNF  264



>ref|XP_009136100.1| PREDICTED: methylsterol monooxygenase 1-3 [Brassica rapa]
Length=290

 Score = 48.1 bits (113),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGKSQSNFASVFTYCDYIYGTDK  265


 Score = 46.6 bits (109),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YDLPWT TK +PFYGG ++HDYH YV       F 
Sbjct  217  YDLPWTLTKLVPFYGGAEYHDYHHYVGGKSQSNFA  251



>ref|XP_010108130.1| Methylsterol monooxygenase 1-1 [Morus notabilis]
 gb|EXC17862.1| Methylsterol monooxygenase 1-1 [Morus notabilis]
Length=302

 Score = 48.1 bits (113),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y+ PW+PTKYIPFYGG ++HDYH YV       F 
Sbjct  219  YEFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253


 Score = 46.6 bits (109),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCD+IYGTDK
Sbjct  245  GGQSQSNFASVFTYCDFIYGTDK  267



>gb|KHN29450.1| Methylsterol monooxygenase 1-1 [Glycine soja]
Length=147

 Score = 49.7 bits (117),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW+PTKYIPFYGGP +HDYH YV       F 
Sbjct  73   YDFPWSPTKYIPFYGGPAYHDYHHYVGGKSQSNFA  107


 Score = 44.7 bits (104),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGT K
Sbjct  99   GGKSQSNFASVFTYCDYIYGTHK  121



>ref|XP_007051947.1| Sterol-4alpha-methyl oxidase 1-1 [Theobroma cacao]
 gb|EOX96104.1| Sterol-4alpha-methyl oxidase 1-1 [Theobroma cacao]
Length=310

 Score = 48.1 bits (113),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  248  GGQSQSNFASVFTYCDYIYGTDK  270


 Score = 46.2 bits (108),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D PW+PTK+IPFYGG ++HDYH +V       F 
Sbjct  222  FDFPWSPTKFIPFYGGAEYHDYHHFVGGQSQSNFA  256



>ref|NP_567669.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
 sp|F4JLZ6.1|SMO13_ARATH RecName: Full=Methylsterol monooxygenase 1-3; AltName: Full=Sterol 
4-alpha-methyl-oxidase 1-3; Short=AtSMO1-3 [Arabidopsis 
thaliana]
 gb|AEE84649.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
Length=291

 Score = 48.1 bits (113),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 46.2 bits (108),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW+ TK IPFYGGP++HDYH YV       F 
Sbjct  217  YDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNFA  251



>ref|XP_006283414.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
 gb|EOA16312.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
Length=574

 Score = 48.1 bits (113),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 45.8 bits (107),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PWT TK IPFYGG ++HDYH YV       F
Sbjct  217  YDFPWTLTKLIPFYGGAEYHDYHHYVGGQSQSNF  250



>ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum tuberosum]
Length=303

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 54/123 (44%), Gaps = 39/123 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YDLPW+ TKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDLPWSLTKYIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +GYRYQKKVLQQ + AS  N EQNG S    +D 
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKVLQQLKGASNANGEQNGGSVTFAKDC  300

Query  192  KVD  184
            K D
Sbjct  301  KDD  303



>ref|XP_006851841.1| hypothetical protein AMTR_s00041p00076350 [Amborella trichopoda]
 gb|ERN13308.1| hypothetical protein AMTR_s00041p00076350 [Amborella trichopoda]
Length=291

 Score = 48.5 bits (114),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  234  GGQSQSNFASVFTYCDYIYGTDK  256


 Score = 45.4 bits (106),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y+ PW+ TK+IPFYGG +HHDYH +V       F 
Sbjct  208  YEFPWSLTKFIPFYGGAEHHDYHHFVGGQSQSNFA  242



>ref|XP_010909206.1| PREDICTED: methylsterol monooxygenase 1-1-like [Elaeis guineensis]
Length=287

 Score = 51.2 bits (121),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFASVFTYCDYIYGTDK
Sbjct  245  GGKSHSNFASVFTYCDYIYGTDK  267


 Score = 42.4 bits (98),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD   TPTKYIPFYGG ++HDYH YV
Sbjct  219  YDFSQTPTKYIPFYGGAEYHDYHHYV  244



>ref|NP_001148698.1| LOC100282314 [Zea mays]
 gb|ACF83557.1| unknown [Zea mays]
 gb|ACG32570.1| C-4 methylsterol oxidase [Zea mays]
 gb|ACG42034.1| C-4 methylsterol oxidase [Zea mays]
 tpg|DAA46160.1| TPA: c-4 methylsterol oxidase [Zea mays]
Length=301

 Score = 47.0 bits (110),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTDK
Sbjct  245  GGQSQSNFASVFTYCDYLYGTDK  267


 Score = 46.6 bits (109),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P+TPTKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253



>ref|XP_002867753.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44012.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score = 48.1 bits (113),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDKV  399
            GG S SNFASVFTYCDYIYGTDK+
Sbjct  454  GGQSQSNFASVFTYCDYIYGTDKL  477


 Score = 45.1 bits (105),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK+IPFYGG ++HDYH YV       F
Sbjct  428  YDFPWSLTKFIPFYGGAEYHDYHHYVGGQSQSNF  461



>ref|XP_002467559.1| hypothetical protein SORBIDRAFT_01g030160 [Sorghum bicolor]
 gb|EER94557.1| hypothetical protein SORBIDRAFT_01g030160 [Sorghum bicolor]
Length=301

 Score = 47.4 bits (111),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P+TPTKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253


 Score = 46.2 bits (108),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTD+
Sbjct  245  GGQSQSNFASVFTYCDYLYGTDR  267



>ref|XP_010436432.1| PREDICTED: methylsterol monooxygenase 1-3-like [Camelina sativa]
Length=289

 Score = 48.1 bits (113),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 45.4 bits (106),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWT TKYIPFYGG ++HDYH +V       F 
Sbjct  217  YDFPWTLTKYIPFYGGAEYHDYHHHVGGQSQSNFA  251



>ref|XP_004983772.1| PREDICTED: methylsterol monooxygenase 1-1-like [Setaria italica]
Length=301

 Score = 47.0 bits (110),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P+TPTKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253


 Score = 46.2 bits (108),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTD+
Sbjct  245  GGQSQSNFASVFTYCDYLYGTDR  267



>ref|XP_009401815.1| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=312

 Score = 48.1 bits (113),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  245  GGQSQSNFASVFTYCDYIYGTDK  267


 Score = 45.4 bits (106),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD P +PTK+IPFYGG ++HDYH YV       F
Sbjct  219  YDFPLSPTKFIPFYGGAEYHDYHHYVGGQSQSNF  252



>gb|KJB51950.1| hypothetical protein B456_008G240000 [Gossypium raimondii]
Length=317

 Score = 47.8 bits (112),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PW PT++IPFYGG D+HDYH YV
Sbjct  219  YDFPWAPTRFIPFYGGADYHDYHHYV  244


 Score = 45.4 bits (106),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDYIYGTDK
Sbjct  245  GEQSQSNFASVFTYCDYIYGTDK  267



>gb|KFK28859.1| hypothetical protein AALP_AA7G057800 [Arabis alpina]
Length=291

 Score = 48.1 bits (113),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YDLPWT TKYIPFYGG ++HDYH YV
Sbjct  217  YDLPWTITKYIPFYGGAEYHDYHHYV  242


 Score = 45.4 bits (106),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDYIYGTDK
Sbjct  243  GRQSQSNFASVFTYCDYIYGTDK  265



>emb|CDY71421.1| BnaAnng37370D [Brassica napus]
Length=182

 Score = 47.8 bits (112),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  135  GGKSQSNFASVFTYCDYIYGTDK  157


 Score = 45.4 bits (106),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YDLPWT TK +PFYGG  +HDYH YV       F 
Sbjct  109  YDLPWTLTKLVPFYGGAGYHDYHHYVGGKSQSNFA  143



>ref|XP_006413626.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
 gb|ESQ55079.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
Length=599

 Score = 48.1 bits (113),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGKSQSNFASVFTYCDYIYGTDK  265


 Score = 44.7 bits (104),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK IPFYGG ++HDYH YV       F
Sbjct  217  YDFPWSLTKCIPFYGGAEYHDYHHYVGGKSQSNF  250



>ref|XP_004492635.1| PREDICTED: methylsterol monooxygenase 1-1-like [Cicer arietinum]
Length=293

 Score = 46.6 bits (109),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S  NFASVFTYCDYIYGTDK
Sbjct  245  GGRSQGNFASVFTYCDYIYGTDK  267


 Score = 46.2 bits (108),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PW PTKYIPFYGG  +HDYH YV
Sbjct  219  YDFPWNPTKYIPFYGGSAYHDYHHYV  244



>gb|KFK28850.1| hypothetical protein AALP_AA7G056500 [Arabis alpina]
Length=222

 Score = 48.1 bits (113),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  189  GGKSQSNFASVFTYCDYIYGTDK  211


 Score = 43.9 bits (102),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW+  KYIPFYGG + HDYH YV       F 
Sbjct  163  YDFPWSLAKYIPFYGGAEFHDYHHYVGGKSQSNFA  197



>gb|KEH23319.1| C-4 methylsterol oxidase [Medicago truncatula]
Length=293

 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y+LPW+PTKYIPFYGGP +HDYH YV
Sbjct  219  YELPWSPTKYIPFYGGPAYHDYHHYV  244


 Score = 42.7 bits (99),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S  NFASVFTYCDYIYGT K
Sbjct  245  GGRSQGNFASVFTYCDYIYGTIK  267



>ref|XP_011469129.1| PREDICTED: methylsterol monooxygenase 1-1-like [Fragaria vesca 
subsp. vesca]
Length=297

 Score = 46.2 bits (108),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y+ PW+P+KYIPFYGG ++HDYH YV       F 
Sbjct  219  YNFPWSPSKYIPFYGGAEYHDYHHYVGEQSQSNFA  253


 Score = 45.8 bits (107),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDYIYGTDK
Sbjct  245  GEQSQSNFASVFTYCDYIYGTDK  267



>ref|XP_010451257.1| PREDICTED: methylsterol monooxygenase 1-3-like [Camelina sativa]
Length=280

 Score = 48.1 bits (113),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 43.5 bits (101),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK+IPFYGG ++HDYH YV       F
Sbjct  217  YDFPWSLTKWIPFYGGSEYHDYHHYVGGQSQSNF  250



>ref|XP_008356733.1| PREDICTED: methylsterol monooxygenase 1-2-like [Malus domestica]
Length=281

 Score = 45.4 bits (106),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y+ PW+PTK+IPFYGG  +HDYH YV
Sbjct  219  YNFPWSPTKFIPFYGGAKYHDYHHYV  244


 Score = 45.4 bits (106),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGT K
Sbjct  245  GGRSKSNFASVFTYCDYIYGTHK  267



>ref|XP_010439291.1| PREDICTED: methylsterol monooxygenase 1-3-like [Camelina sativa]
Length=280

 Score = 48.1 bits (113),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  243  GGQSQSNFASVFTYCDYIYGTDK  265


 Score = 42.7 bits (99),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWT TK+IPFYGG ++HDYH +V       F 
Sbjct  217  YDFPWTLTKWIPFYGGAEYHDYHHHVGGQSQSNFA  251



>ref|XP_011081107.1| PREDICTED: methylsterol monooxygenase 1-1-like [Sesamum indicum]
Length=304

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 54/124 (44%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YDLPWTPTKYIPFYGGPD+HDYH YV       F                          
Sbjct  219  YDLPWTPTKYIPFYGGPDYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH-AGEED  196
                           F+Y  ++    +GYRYQKKVL+Q R+  K N EQ    H    + 
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKVLEQLRDGLKTNGEQIRVPHDVSTQG  300

Query  195  VKVD  184
             KVD
Sbjct  301  HKVD  304



>ref|XP_009385252.1| PREDICTED: methylsterol monooxygenase 1-1-like [Musa acuminata 
subsp. malaccensis]
Length=305

 Score = 48.5 bits (114),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  SHSNFASVFTYCDYIYGTDK
Sbjct  245  GEKSHSNFASVFTYCDYIYGTDK  267


 Score = 42.0 bits (97),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD P TPTKYIPFY G ++HDYH YV
Sbjct  219  YDFPQTPTKYIPFYVGAEYHDYHHYV  244



>ref|XP_002975864.1| hypothetical protein SELMODRAFT_104109 [Selaginella moellendorffii]
 gb|EFJ22769.1| hypothetical protein SELMODRAFT_104109 [Selaginella moellendorffii]
Length=288

 Score = 47.0 bits (110),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTDK
Sbjct  245  GGKSQSNFASVFTYCDYLYGTDK  267


 Score = 43.5 bits (101),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK+IPFYGG ++HDYH +V       F
Sbjct  219  YDFPWSFTKFIPFYGGAEYHDYHHFVGGKSQSNF  252



>ref|XP_002968617.1| hypothetical protein SELMODRAFT_170047 [Selaginella moellendorffii]
 gb|EFJ30871.1| hypothetical protein SELMODRAFT_170047 [Selaginella moellendorffii]
Length=300

 Score = 47.0 bits (110),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTDK
Sbjct  245  GGKSQSNFASVFTYCDYLYGTDK  267


 Score = 43.5 bits (101),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ TK+IPFYGG ++HDYH +V       F
Sbjct  219  YDFPWSFTKFIPFYGGAEYHDYHHFVGGKSQSNF  252



>ref|XP_003574284.1| PREDICTED: methylsterol monooxygenase 1-1-like [Brachypodium 
distachyon]
Length=301

 Score = 47.4 bits (111),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTDK
Sbjct  245  GGQSQSNFASVFTYCDYLYGTDK  267


 Score = 42.7 bits (99),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P++ TKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253



>ref|XP_007219067.1| hypothetical protein PRUPE_ppa014786mg [Prunus persica]
 gb|EMJ20266.1| hypothetical protein PRUPE_ppa014786mg [Prunus persica]
Length=282

 Score = 47.4 bits (111),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y LPWTPTKYIPFYGG ++HDYH +V
Sbjct  219  YLLPWTPTKYIPFYGGAEYHDYHHFV  244


 Score = 42.7 bits (99),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFAS+FTYCDYIYGT+K
Sbjct  245  GEQSKSNFASIFTYCDYIYGTNK  267



>ref|XP_011069892.1| PREDICTED: methylsterol monooxygenase 1-1-like [Sesamum indicum]
Length=300

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 52/123 (42%), Gaps = 42/123 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGGPD+HDYH YV       F                          
Sbjct  219  YDFPWTPTKYIPFYGGPDYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  +L    +GYRYQKKVLQQ RE  K N   +  S    E  
Sbjct  254  -------------SVFTYCDYLYGTDKGYRYQKKVLQQLREGVKSNGTMHEVS---AESQ  297

Query  192  KVD  184
            KVD
Sbjct  298  KVD  300



>ref|XP_011093218.1| PREDICTED: methylsterol monooxygenase 1-1-like [Sesamum indicum]
Length=285

 Score = 46.2 bits (108),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGT+K
Sbjct  245  GGKSQSNFASVFTYCDYIYGTNK  267


 Score = 43.9 bits (102),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 20/35 (57%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW P KYIPFYGG   HDYH +V       F 
Sbjct  219  YDFPWNPLKYIPFYGGAIFHDYHHFVGGKSQSNFA  253



>ref|XP_002270978.3| PREDICTED: methylsterol monooxygenase 1-1 [Vitis vinifera]
Length=304

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 55/124 (44%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG DHHDYH YV       F                          
Sbjct  219  YDFPWSPTKYIPFYGGADHHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAG-EED  196
                           F+Y  ++    +GYRYQKK+L + +E  K N +QNG S+    +D
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKLLAKLKEDLKSNGQQNGVSYQNLTQD  300

Query  195  VKVD  184
            +K D
Sbjct  301  LKSD  304



>gb|AAQ94118.1| sterol-4-alpha methyl oxidase [Arabidopsis thaliana]
Length=273

 Score = 45.8 bits (107),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW+ TK IPFYGGP++HDYH YV       F 
Sbjct  217  YDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNFA  251


 Score = 43.5 bits (101),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 1/24 (4%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYI-YGTDK  402
            GG S SNFASVFTYCDYI YGTDK
Sbjct  243  GGQSQSNFASVFTYCDYISYGTDK  266



>ref|XP_010906755.1| PREDICTED: methylsterol monooxygenase 1-1-like [Elaeis guineensis]
Length=335

 Score = 46.2 bits (108),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDYIYGTDK
Sbjct  302  GSRSQSNFASVFTYCDYIYGTDK  324


 Score = 43.1 bits (100),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y+ P  PTKYIPFYGG ++HDYH YV       F 
Sbjct  276  YEFPLNPTKYIPFYGGAEYHDYHHYVGSRSQSNFA  310



>dbj|BAJ99813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score = 47.0 bits (110),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFA VFTYCDYIYGTDK
Sbjct  245  GGQSKSNFAPVFTYCDYIYGTDK  267


 Score = 42.0 bits (97),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            + LP+   KYIPFYGG +HHDYH Y+       F 
Sbjct  219  FKLPFNAEKYIPFYGGAEHHDYHHYIGGQSKSNFA  253



>dbj|BAJ87077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score = 47.0 bits (110),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFA VFTYCDYIYGTDK
Sbjct  245  GGQSKSNFAPVFTYCDYIYGTDK  267


 Score = 42.0 bits (97),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            + LP+   KYIPFYGG +HHDYH Y+       F 
Sbjct  219  FKLPFNAEKYIPFYGGAEHHDYHHYIGGQSKSNFA  253



>ref|XP_009338115.1| PREDICTED: methylsterol monooxygenase 1-2-like [Pyrus x bretschneideri]
Length=281

 Score = 45.8 bits (107),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y  PW+PTKYIPFYGG ++HDYH YV
Sbjct  219  YMFPWSPTKYIPFYGGAEYHDYHHYV  244


 Score = 43.5 bits (101),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G LS  NFASVFTYCDYIYGT K
Sbjct  245  GKLSKGNFASVFTYCDYIYGTHK  267



>ref|XP_009368695.1| PREDICTED: methylsterol monooxygenase 1-2-like [Pyrus x bretschneideri]
Length=281

 Score = 45.8 bits (107),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y  PW+PTKYIPFYGG ++HDYH YV
Sbjct  219  YMFPWSPTKYIPFYGGAEYHDYHHYV  244


 Score = 43.5 bits (101),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G LS  NFASVFTYCDYIYGT K
Sbjct  245  GKLSKGNFASVFTYCDYIYGTHK  267



>gb|EMT24395.1| Putative C-4 methylsterol oxidase [Aegilops tauschii]
Length=284

 Score = 46.2 bits (108),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTD+
Sbjct  228  GGQSQSNFASVFTYCDYLYGTDR  250


 Score = 42.7 bits (99),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P++ TKYIPFYGG ++HDYH YV       F 
Sbjct  202  FDFPFSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA  236



>gb|EMT26728.1| Putative C-4 methylsterol oxidase [Aegilops tauschii]
Length=301

 Score = 47.0 bits (110),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFA VFTYCDYIYGTDK
Sbjct  245  GGQSKSNFAPVFTYCDYIYGTDK  267


 Score = 42.4 bits (98),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            + LP+   KYIPFYGG +HHDYH Y+       F 
Sbjct  219  FKLPFNAEKYIPFYGGAEHHDYHHYIGGQSKSNFA  253



>dbj|BAK02768.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score = 46.2 bits (108),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDY+YGTD+
Sbjct  245  GGQSQSNFASVFTYCDYLYGTDR  267


 Score = 42.4 bits (98),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P++ TKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA  253



>ref|XP_008232718.1| PREDICTED: methylsterol monooxygenase 1-1-like [Prunus mume]
Length=176

 Score = 46.2 bits (108),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y LPWTPTKYIPFYGG + HDYH +V
Sbjct  113  YLLPWTPTKYIPFYGGAEFHDYHHFV  138


 Score = 42.4 bits (98),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFAS+FTYCDYIYGT+K
Sbjct  139  GEHSKSNFASIFTYCDYIYGTNK  161



>ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa]
 gb|ERP65285.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa]
Length=304

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 55/124 (44%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            Y+ PWTPTKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YNFPWTPTKYIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFS-HAGEED  196
                           F+Y  F+    +GYR+QKK+L++ +E  +   EQNG S H   +D
Sbjct  254  -------------SVFTYCDFIYGTDKGYRFQKKLLRKLKEGVENGGEQNGGSYHIATQD  300

Query  195  VKVD  184
            +K D
Sbjct  301  LKSD  304



>gb|AFK37077.1| unknown [Medicago truncatula]
Length=303

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 55/123 (45%), Gaps = 39/123 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW PTKYIPFYGG +HHDYH YV       F                          
Sbjct  219  YDFPWNPTKYIPFYGGAEHHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +G+RYQKK+LQ+ +E S   + QNG S++ +E+ 
Sbjct  254  -------------SVFTYCDYIYGTDKGFRYQKKILQKLKEDSTNGAAQNGRSYSEQENY  300

Query  192  KVD  184
            K +
Sbjct  301  KFE  303



>gb|KDP25588.1| hypothetical protein JCGZ_20744 [Jatropha curcas]
Length=302

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 55/123 (45%), Gaps = 40/123 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWTPTKYIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  F+    +GYRYQKKVL + +E  + + EQNG S+   +D+
Sbjct  254  -------------SVFTYCDFIYGTDKGYRYQKKVLAKLKEGLRSDGEQNGGSYY-VQDL  299

Query  192  KVD  184
            K D
Sbjct  300  KSD  302



>gb|EMS58692.1| C-4 methylsterol oxidase [Triticum urartu]
Length=179

 Score = 45.8 bits (107),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFA VFTYCDYIYGTDK
Sbjct  123  GGQSKSNFAPVFTYCDYIYGTDK  145


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            + LP+   KYIPFYGG +HHDYH Y+       F 
Sbjct  97   FKLPFNAEKYIPFYGGAEHHDYHHYIGGQSKSNFA  131



>ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula]
 gb|AES90994.1| sterol C4-methyl oxidase 1-2 [Medicago truncatula]
Length=303

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 55/123 (45%), Gaps = 39/123 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW PTKYIPFYGG +HHDYH YV       F                          
Sbjct  219  YDFPWNPTKYIPFYGGAEHHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +G+RYQKK+LQ+ +E S   + QNG S++ +E+ 
Sbjct  254  -------------SVFTYCDYIYGTDKGFRYQKKILQKLKEDSTNGAAQNGRSYSEQENY  300

Query  192  KVD  184
            K +
Sbjct  301  KSE  303



>ref|XP_010448846.1| PREDICTED: methylsterol monooxygenase 1-3-like [Camelina sativa]
Length=290

 Score = 48.1 bits (113),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  242  GGQSQSNFASVFTYCDYIYGTDK  264


 Score = 40.0 bits (92),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (63%), Gaps = 1/35 (3%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PWT TK+IP YGG ++HDYH YV       F 
Sbjct  217  YDFPWTLTKFIP-YGGAEYHDYHHYVGGQSQSNFA  250



>ref|XP_001765160.1| predicted protein [Physcomitrella patens]
 gb|EDQ69888.1| predicted protein [Physcomitrella patens]
Length=314

 Score = 45.4 bits (106),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW PT+ IPFYGG ++HDYH +V    S  F 
Sbjct  219  YDFPWNPTRLIPFYGGAEYHDYHHFVGAKCSSNFA  253


 Score = 42.4 bits (98),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G    SNFASVFTYCD+IYGTDK
Sbjct  245  GAKCSSNFASVFTYCDWIYGTDK  267



>ref|XP_011034330.1| PREDICTED: methylsterol monooxygenase 1-1-like [Populus euphratica]
Length=305

 Score = 43.9 bits (102),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD  W+PT++IPFYGG  +HDYH YV
Sbjct  219  YDFSWSPTRFIPFYGGAKYHDYHHYV  244


 Score = 43.9 bits (102),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDY+YGTDK
Sbjct  245  GRHSQSNFASVFTYCDYLYGTDK  267



>ref|XP_001780893.1| predicted protein [Physcomitrella patens]
 gb|EDQ54299.1| predicted protein [Physcomitrella patens]
Length=314

 Score = 45.8 bits (107),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW PT+ IPFYGG ++HDYH +V    S  F 
Sbjct  219  YDFPWNPTRLIPFYGGAEYHDYHHFVGAKCSSNFA  253


 Score = 42.0 bits (97),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G    SNFASVFTYCD++YGTDK
Sbjct  245  GAKCSSNFASVFTYCDWLYGTDK  267



>ref|XP_002320723.2| hypothetical protein POPTR_0014s06510g [Populus trichocarpa]
 gb|EEE99038.2| hypothetical protein POPTR_0014s06510g [Populus trichocarpa]
Length=305

 Score = 43.9 bits (102),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDY+YGTDK
Sbjct  245  GRHSQSNFASVFTYCDYLYGTDK  267


 Score = 43.1 bits (100),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD  W+PT+++PFYGG  +HDYH YV       F 
Sbjct  219  YDFSWSPTRFVPFYGGARYHDYHHYVGRHSQSNFA  253



>ref|XP_011029101.1| PREDICTED: methylsterol monooxygenase 1-1-like [Populus euphratica]
Length=304

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 54/124 (44%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            Y+ PW PTKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YNFPWAPTKYIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFS-HAGEED  196
                           F+Y  F+    +GYR+QKK+L++ +E  +   EQNG S H   +D
Sbjct  254  -------------SVFTYCDFIYGTDKGYRFQKKLLRKLKEGVENGGEQNGGSYHIATQD  300

Query  195  VKVD  184
            +K D
Sbjct  301  LKSD  304



>ref|XP_003577766.1| PREDICTED: methylsterol monooxygenase 1-2-like [Brachypodium 
distachyon]
Length=298

 Score = 48.9 bits (115),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFA VFT+CDYIYGTDK
Sbjct  245  GGQSHSNFAPVFTHCDYIYGTDK  267


 Score = 37.7 bits (86),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            + LP+    YIPFYGG +HHDYH Y+
Sbjct  219  FKLPFNLENYIPFYGGAEHHDYHHYI  244



>ref|XP_008232660.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Prunus 
mume]
Length=581

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            Y LPWTPTKYIPFYGG ++HDYH +V     + F
Sbjct  219  YLLPWTPTKYIPFYGGAEYHDYHHFVGEQSKRNF  252


 Score = 37.7 bits (86),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S  NFAS+FTYC YIYGT+K
Sbjct  245  GEQSKRNFASIFTYCYYIYGTNK  267



>ref|NP_001065206.1| Os10g0545200 [Oryza sativa Japonica Group]
 gb|AAK20047.1|AC025783_7 putative C-4 sterol methyl oxidase [Oryza sativa Japonica Group]
 gb|AAP54879.1| Sterol desaturase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27120.1| Os10g0545200 [Oryza sativa Japonica Group]
 dbj|BAG93792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00667.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score = 44.7 bits (104),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDY+YGTDK
Sbjct  245  GRQSQSNFASVFTYCDYLYGTDK  267


 Score = 41.6 bits (96),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P+  TKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFNLTKYIPFYGGAEYHDYHHYVGRQSQSNFA  253



>ref|XP_006662024.1| PREDICTED: methylsterol monooxygenase 1-1-like [Oryza brachyantha]
Length=301

 Score = 43.5 bits (101),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDY+YGTD+
Sbjct  245  GRQSQSNFASVFTYCDYLYGTDR  267


 Score = 42.4 bits (98),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P++ TKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFSLTKYIPFYGGAEYHDYHHYVGRQSQSNFA  253



>gb|EAZ16865.1| hypothetical protein OsJ_32341 [Oryza sativa Japonica Group]
Length=240

 Score = 44.3 bits (103),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDY+YGTDK
Sbjct  184  GRQSQSNFASVFTYCDYLYGTDK  206


 Score = 41.6 bits (96),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P+  TKYIPFYGG ++HDYH YV       F 
Sbjct  158  FDFPFNLTKYIPFYGGAEYHDYHHYVGRQSQSNFA  192



>gb|KJB49389.1| hypothetical protein B456_008G116500 [Gossypium raimondii]
Length=279

 Score = 43.5 bits (101),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y+ PW+PTK IP+YGGP++HD+H +V
Sbjct  219  YNFPWSPTKLIPYYGGPEYHDFHHFV  244


 Score = 42.4 bits (98),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G    SNFAS+FTYCDY+YGTDK
Sbjct  245  GRQCQSNFASIFTYCDYLYGTDK  267



>ref|XP_007052057.1| Sterol-4alpha-methyl oxidase 1-1 [Theobroma cacao]
 gb|EOX96214.1| Sterol-4alpha-methyl oxidase 1-1 [Theobroma cacao]
Length=283

 Score = 43.1 bits (100),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            ++ PW+PTK+IPFY G ++HDYH YV       F 
Sbjct  220  FEFPWSPTKFIPFYVGAEYHDYHHYVGGQSQSNFA  254


 Score = 42.7 bits (99),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASV TYCD+IYGT+K
Sbjct  246  GGQSQSNFASVLTYCDFIYGTNK  268



>ref|XP_007039995.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theobroma cacao]
 gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theobroma cacao]
Length=304

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 50/114 (44%), Gaps = 39/114 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPT+YIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWTPTRYIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH  211
                           F+Y  ++    +GYRY KKVL++ +E S+ N  QNG S+
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYHKKVLRKLKEESRTNGAQNGGSY  294



>gb|EYU30461.1| hypothetical protein MIMGU_mgv1a011047mg [Erythranthe guttata]
Length=294

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 46/111 (41%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWTLTKYIPFYGGSDYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  +L    +GYRYQKKVLQQ RE    N EQN 
Sbjct  254  -------------SVFTYCDYLYGTDKGYRYQKKVLQQFREGLNNNVEQNN  291



>gb|KHG16538.1| Methylsterol monooxygenase 1-1 -like protein [Gossypium arboreum]
Length=304

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 51/114 (45%), Gaps = 39/114 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPT++IPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWTPTRFIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH  211
                           F+Y  ++    +GYRY KKVL++ +E SK++  QNG S+
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYHKKVLRKLKEGSKVDGAQNGGSY  294



>ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus communis]
 gb|EEF51010.1| C-4 methyl sterol oxidase, putative [Ricinus communis]
Length=243

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 54/124 (44%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGG D+HDYH YV       F                          
Sbjct  158  YDFPWTPTKYIPFYGGADYHDYHHYVGGQSQSNFA-------------------------  192

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFS-HAGEED  196
                           F+Y  F+    +GYR+QKKV+++ +E  +    QNG S +   +D
Sbjct  193  -------------SVFTYCDFIYGTDKGYRFQKKVIKKLKEGLENGGNQNGGSYYDSTQD  239

Query  195  VKVD  184
            +K D
Sbjct  240  LKSD  243



>emb|CAB40952.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
 emb|CAB78254.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
Length=303

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 32/110 (29%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                V+     IY 
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA--------------SVFTYCDYIY-  265

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNG  220
            G+          D+ + Y       QGYR+QKK+L+Q +E+SK +++ NG
Sbjct  266  GT----------DKMWLY-------QGYRFQKKLLEQIKESSKKSNKHNG  298


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDKVCI  393
            GG S SNFASVFTYCDYIYGTDK+ +
Sbjct  247  GGQSQSNFASVFTYCDYIYGTDKMWL  272



>emb|CDP09875.1| unnamed protein product [Coffea canephora]
Length=304

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 56/124 (45%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YDLPWTPTKYIPFYGG D+HDYH YV                                  
Sbjct  219  YDLPWTPTKYIPFYGGSDYHDYHHYV----------------------------------  244

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH-AGEED  196
            G +  S+        F+Y  ++    +GYRYQKKVLQQ R+    + +Q G       E 
Sbjct  245  GGLSQSNF----ASVFTYCDYIYGTDKGYRYQKKVLQQLRDGLGNDGDQYGVPFDTSSES  300

Query  195  VKVD  184
            +KVD
Sbjct  301  LKVD  304


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GGLS SNFASVFTYCDYIYGTDK
Sbjct  245  GGLSQSNFASVFTYCDYIYGTDK  267



>ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-like [Cicer arietinum]
Length=303

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 53/123 (43%), Gaps = 39/123 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW PTKYIPFYGG +HHDYH YV       F                          
Sbjct  219  YDFPWNPTKYIPFYGGAEHHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +GYRYQKK+L++ +E     + QNG S+  +++ 
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKILRKLKEELTNGAAQNGGSYNAQDNY  300

Query  192  KVD  184
            K +
Sbjct  301  KSE  303



>ref|XP_007140005.1| hypothetical protein PHAVU_008G076300g [Phaseolus vulgaris]
 gb|ESW11999.1| hypothetical protein PHAVU_008G076300g [Phaseolus vulgaris]
Length=289

 Score = 42.7 bits (99),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFASVFTYCDYIYGT K
Sbjct  245  GEKSRSNFASVFTYCDYIYGTHK  267


 Score = 41.2 bits (95),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PW+ TK++PFYGG   HDYH YV
Sbjct  219  YDFPWSFTKFLPFYGGAAFHDYHHYV  244



>ref|XP_010230028.1| PREDICTED: methylsterol monooxygenase 1-1-like [Brachypodium 
distachyon]
Length=297

 Score = 42.0 bits (97),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNF+++FT+CDY+YGTDK
Sbjct  251  GGQSQSNFSTIFTFCDYLYGTDK  273


 Score = 41.2 bits (95),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            +  P  PTK+IPFYGG +HHDYH  V       F
Sbjct  225  FSFPLNPTKFIPFYGGAEHHDYHHRVGGQSQSNF  258



>gb|KHG07507.1| Methylsterol monooxygenase 1-1 -like protein [Gossypium arboreum]
Length=304

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 53/122 (43%), Gaps = 40/122 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWTPTKYIPFYGGADYHDYHHYVGQQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFS-HAGEED  196
                           F+Y  ++    +GYRY KKVL++    S+I   QNG S +A  +D
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYHKKVLRKLNVQSRIYGTQNGGSYYASTQD  300

Query  195  VK  190
            +K
Sbjct  301  LK  302



>gb|KJB25670.1| hypothetical protein B456_004G203200 [Gossypium raimondii]
Length=304

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 55/124 (44%), Gaps = 40/124 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWTPTKYIPFYGGADYHDYHHYVGQQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFS-HAGEED  196
                           F+Y  ++    +GYRY KKVL++ +  S+I   QNG S +A  +D
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYHKKVLRKLKVQSRIYGTQNGGSYYAFTQD  300

Query  195  VKVD  184
            +K +
Sbjct  301  LKSE  304



>ref|XP_006413625.1| hypothetical protein EUTSA_v10025849mg [Eutrema salsugineum]
 gb|ESQ55078.1| hypothetical protein EUTSA_v10025849mg [Eutrema salsugineum]
Length=298

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 50/111 (45%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+LQQ +E SK +++QNG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKEESKKSNKQNG  293



>gb|AAN62786.1| Putative C-4 sterol methyl oxidase [Oryza sativa Japonica Group]
Length=284

 Score = 43.9 bits (102),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNF+SVFT+CDYIYGTD+
Sbjct  244  GGHSQSNFSSVFTFCDYIYGTDR  266


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            + LP+ PTKYIP YGG ++HDYH +V
Sbjct  218  FKLPFDPTKYIPLYGGVEYHDYHHFV  243



>gb|EAY88222.1| hypothetical protein OsI_09673 [Oryza sativa Indica Group]
Length=300

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNF+SVFT+CDYIYGTD+
Sbjct  244  GGHSQSNFSSVFTFCDYIYGTDR  266


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            + LP+ PTKYIP YGG ++HDYH +V
Sbjct  218  FKLPFDPTKYIPLYGGVEYHDYHHFV  243



>ref|NP_192948.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana]
 sp|Q8L7W5.1|SMO11_ARATH RecName: Full=Methylsterol monooxygenase 1-1; AltName: Full=Sterol 
4-alpha-methyl-oxidase 1-1; Short=AtSMO1-1 [Arabidopsis 
thaliana]
 gb|AAM78091.1| AT4g12110/F16J13_180 [Arabidopsis thaliana]
 gb|AAN18115.1| At4g12110/F16J13_180 [Arabidopsis thaliana]
 gb|AEE83097.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana]
Length=298

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG  293



>ref|NP_001048701.1| Os03g0108500 [Oryza sativa Japonica Group]
 gb|ABF93565.1| Sterol desaturase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10615.1| Os03g0108500 [Oryza sativa Japonica Group]
 dbj|BAG98497.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58181.1| hypothetical protein OsJ_09112 [Oryza sativa Japonica Group]
Length=300

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNF+SVFT+CDYIYGTD+
Sbjct  244  GGHSQSNFSSVFTFCDYIYGTDR  266


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            + LP+ PTKYIP YGG ++HDYH +V
Sbjct  218  FKLPFDPTKYIPLYGGVEYHDYHHFV  243



>gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis thaliana]
Length=298

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG  293



>ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Capsella rubella]
 gb|EOA21234.1| hypothetical protein CARUB_v10001581mg [Capsella rubella]
Length=298

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG  293



>gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
Length=298

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG  293



>emb|CDY04397.1| BnaC02g28510D [Brassica napus]
Length=298

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ NG
Sbjct  256  -------------SVFTYCDYVYGTEKGYRFQKKLLEQIKESSKKSNKHNG  293



>ref|XP_009128630.1| PREDICTED: methylsterol monooxygenase 1-1 [Brassica rapa]
Length=298

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG  293



>ref|XP_010676653.1| PREDICTED: methylsterol monooxygenase 1-1-like [Beta vulgaris 
subsp. vulgaris]
Length=295

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 48/112 (43%), Gaps = 39/112 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  219  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGF  217
                           F+Y  ++    +G+RYQKK+L + +E S  N +QNG 
Sbjct  254  -------------SVFTYCDYIYGTDKGFRYQKKLLAKLKEGSSSNDQQNGL  292



>emb|CDX97357.1| BnaA02g21480D [Brassica napus]
Length=280

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  203  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  237

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK ++  NG
Sbjct  238  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNRHNG  275



>ref|XP_002872644.1| hypothetical protein ARALYDRAFT_911602 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48903.1| hypothetical protein ARALYDRAFT_911602 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK  ++ NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKGNKHNG  293



>gb|KDP28753.1| hypothetical protein JCGZ_14524 [Jatropha curcas]
Length=220

 Score = 45.1 bits (105),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFAS+FTYCDYIYGTDK
Sbjct  179  GAQSQSNFASIFTYCDYIYGTDK  201


 Score = 35.8 bits (81),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD+  + TKYIPFYGG ++HDYH  V       F 
Sbjct  153  YDIARSFTKYIPFYGGAEYHDYHHCVGAQSQSNFA  187



>ref|XP_009346393.1| PREDICTED: methylsterol monooxygenase 1-1-like [Pyrus x bretschneideri]
Length=297

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 51/123 (41%), Gaps = 45/123 (37%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGG ++HDYH YV       F                          
Sbjct  219  YDFPWTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +GYR+QKK+L+      K+N E  G  + G  D+
Sbjct  254  -------------SVFTYCDYIYGTEKGYRFQKKILK------KLNEETAGVQNGGSVDL  294

Query  192  KVD  184
            K D
Sbjct  295  KSD  297



>gb|KDO63741.1| hypothetical protein CISIN_1g021962mg [Citrus sinensis]
Length=305

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 50/115 (43%), Gaps = 39/115 (34%)
 Frame = -1

Query  552  RYDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIY  373
            RYD PW  TKYIPFYGG D+HDYH YV       F                         
Sbjct  223  RYDFPWGFTKYIPFYGGADYHDYHHYVGEQSHSNFA------------------------  258

Query  372  IGSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH  211
                            F+Y  FL    +GYRYQKK+L++ +E  + + EQNG S+
Sbjct  259  --------------SVFTYCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNGGSY  299



>ref|XP_004245702.1| PREDICTED: methylsterol monooxygenase 1-1 [Solanum lycopersicum]
Length=296

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 47/113 (42%), Gaps = 39/113 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YDLPW+ TKY+PFYGG D+HDYH YV       F                          
Sbjct  219  YDLPWSLTKYVPFYGGADYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFS  214
                           F+Y  ++    +GYRYQKKVLQQ + AS  N     F+
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKVLQQLKGASNANGGSATFA  293



>ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum]
 gb|ESQ38248.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum]
Length=298

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 51/111 (46%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ +G
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNQHSG  293



>dbj|BAJ85088.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score = 41.6 bits (96),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNFAS FT+CDYIYGTDK
Sbjct  245  GRKSQSNFASFFTFCDYIYGTDK  267


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 18/35 (51%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P  P K IPFYGG  HHDYH  V       F 
Sbjct  219  FDFPLNPAKLIPFYGGAPHHDYHHRVGRKSQSNFA  253



>ref|XP_002455692.1| hypothetical protein SORBIDRAFT_03g021040 [Sorghum bicolor]
 gb|EES00812.1| hypothetical protein SORBIDRAFT_03g021040 [Sorghum bicolor]
Length=293

 Score = 43.9 bits (102),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  473  SGGLSHSNFASVFTYCDYIYGTDK  402
            +GG S SNFA +FTYCDYIY TDK
Sbjct  244  AGGRSQSNFAPLFTYCDYIYRTDK  267


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y  P++P++ IPFYGG  +HDYH Y 
Sbjct  219  YHFPFSPSRLIPFYGGAAYHDYHHYA  244



>ref|XP_010422182.1| PREDICTED: methylsterol monooxygenase 1-1 [Camelina sativa]
 ref|XP_010455654.1| PREDICTED: methylsterol monooxygenase 1-1 [Camelina sativa]
Length=298

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 50/110 (45%), Gaps = 39/110 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQN  223
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ N
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHN  292



>emb|CDX94121.1| BnaC07g37550D [Brassica napus]
Length=247

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 49/110 (45%), Gaps = 37/110 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT T YIPFYGG ++HDYH YV       F                V+     IY 
Sbjct  170  YDFPWTLTNYIPFYGGAEYHDYHHYVGGQSQSNFA--------------SVFTYCDYIY-  214

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNG  220
            G+                       +GYR QKK+LQQ +E SK +++QNG
Sbjct  215  GT----------------------DKGYRLQKKLLQQIKEDSKKSNKQNG  242


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG S SNFASVFTYCDYIYGTDK
Sbjct  196  GGQSQSNFASVFTYCDYIYGTDK  218



>ref|XP_008448914.1| PREDICTED: methylsterol monooxygenase 1-2-like [Cucumis melo]
Length=301

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 56/122 (46%), Gaps = 39/122 (32%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TK+IPFYGG DHHDYH YV       F                V+     IY 
Sbjct  219  YDFPWSLTKFIPFYGGADHHDYHHYVGGQSHSNFA--------------SVFTYCDYIY-  263

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDVK  190
                 +D                  +GYRYQKK+LQ+ +E  K NSE++ + +   ++VK
Sbjct  264  ----GTD------------------KGYRYQKKILQKLKEEVK-NSEESSYYNTA-QNVK  299

Query  189  VD  184
             D
Sbjct  300  SD  301


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFASVFTYCDYIYGTDK
Sbjct  245  GGQSHSNFASVFTYCDYIYGTDK  267



>ref|XP_010540031.1| PREDICTED: methylsterol monooxygenase 1-1-like [Tarenaya hassleriana]
Length=296

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 49/111 (44%), Gaps = 41/111 (37%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+LQ+ +E  K  S+QNG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQKMKEEEK--SKQNG  291



>emb|CDX82968.1| BnaC01g14180D [Brassica napus]
Length=376

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 50/110 (45%), Gaps = 37/110 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TK+IPFYGG ++HDYH YV       F                V+     IY 
Sbjct  221  YDFPWTLTKFIPFYGGAEYHDYHHYVGGQSQSNF--------------ASVFTYCDYIY-  265

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNG  220
                 +D                  +GYR+QKK+LQQ ++ SK ++ QNG
Sbjct  266  ----GTD------------------KGYRFQKKLLQQIKQESKKSNMQNG  293



>ref|XP_010433735.1| PREDICTED: methylsterol monooxygenase 1-1-like [Camelina sativa]
Length=298

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 50/110 (45%), Gaps = 39/110 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQN  223
                           F+Y  ++    +GYR+QKK+L+Q +E+SK +++ N
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHN  292



>ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-like [Cucumis sativus]
 gb|KGN55922.1| hypothetical protein Csa_3G036480 [Cucumis sativus]
Length=300

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 57/122 (47%), Gaps = 40/122 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TK+IPFYGG DHHDYH YV       F                V+     IY 
Sbjct  219  YDFPWSLTKFIPFYGGADHHDYHHYVGGQSHSNFA--------------SVFTYCDYIY-  263

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDVK  190
                 +D                  +GYRYQKK+LQ+ +E  K NSE++ ++ A  ++VK
Sbjct  264  ----GTD------------------KGYRYQKKILQKLKEEVK-NSEESYYNTA--QNVK  298

Query  189  VD  184
             D
Sbjct  299  SD  300


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFASVFTYCDYIYGTDK
Sbjct  245  GGQSHSNFASVFTYCDYIYGTDK  267



>ref|XP_010433996.1| PREDICTED: methylsterol monooxygenase 1-2-like [Camelina sativa]
Length=299

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 51/112 (46%), Gaps = 40/112 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQ-NG  220
                           F+Y  ++    +GYR+QKK+LQQ +E+SK +++Q NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKESSKKSNKQING  294



>ref|XP_010448845.1| PREDICTED: methylsterol monooxygenase 1-2 [Camelina sativa]
Length=299

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 51/112 (46%), Gaps = 40/112 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQ-NG  220
                           F+Y  ++    +GYR+QKK+LQQ +E+SK +++Q NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKESSKKSNKQVNG  294



>ref|XP_010439289.1| PREDICTED: methylsterol monooxygenase 1-2-like [Camelina sativa]
Length=299

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 51/112 (46%), Gaps = 40/112 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQ-NG  220
                           F+Y  ++    +GYR+QKK+LQQ +E+SK +++Q NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKESSKKSNKQING  294



>ref|XP_008672295.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=281

 Score = 42.7 bits (99),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  473  SGGLSHSNFASVFTYCDYIYGTDK  402
            +GG S SNFA +FTYCDY+Y TDK
Sbjct  219  AGGRSQSNFAPLFTYCDYLYRTDK  242


 Score = 35.0 bits (79),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            Y  P++P + IPFYGG  +HDYH Y        F
Sbjct  194  YHFPFSPCRLIPFYGGAAYHDYHHYAGGRSQSNF  227



>gb|EYU30561.1| hypothetical protein MIMGU_mgv11b0246252mg, partial [Erythranthe 
guttata]
Length=63

 Score = 39.7 bits (91),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG   SNFASV TYCDYIYGT+K
Sbjct  27   GGKRQSNFASVNTYCDYIYGTNK  49


 Score = 38.1 bits (87),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = -1

Query  546  DLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            D PW+P K IPFYGG   HD H +V   +   F 
Sbjct  2    DFPWSPLKNIPFYGGAHLHDNHHFVGGKRQSNFA  35



>ref|NP_001136959.1| hypothetical protein [Zea mays]
 gb|ACF82967.1| unknown [Zea mays]
 tpg|DAA54868.1| TPA: hypothetical protein ZEAMMB73_684331 [Zea mays]
Length=306

 Score = 42.7 bits (99),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  473  SGGLSHSNFASVFTYCDYIYGTDK  402
            +GG S SNFA +FTYCDY+Y TDK
Sbjct  244  AGGRSQSNFAPLFTYCDYLYRTDK  267


 Score = 35.0 bits (79),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            Y  P++P + IPFYGG  +HDYH Y 
Sbjct  219  YHFPFSPCRLIPFYGGAAYHDYHHYA  244



>ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477295.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006477296.1| PREDICTED: methylsterol monooxygenase 1-2-like [Citrus sinensis]
 gb|KDO63742.1| hypothetical protein CISIN_1g021962mg [Citrus sinensis]
Length=300

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 49/114 (43%), Gaps = 39/114 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW  TKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWGFTKYIPFYGGADYHDYHHYVGEQSHSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH  211
                           F+Y  FL    +GYRYQKK+L++ +E  + + EQNG S+
Sbjct  254  -------------SVFTYCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNGGSY  294



>ref|XP_008369506.1| PREDICTED: methylsterol monooxygenase 1-1-like [Malus domestica]
Length=297

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 50/123 (41%), Gaps = 45/123 (37%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTK+IPFYGG ++HDYH YV       F                          
Sbjct  219  YDFPWTPTKHIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +GYRYQKK+L+      K+N E  G  + G  D 
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKILK------KLNEEPAGVQNGGSIDF  294

Query  192  KVD  184
            K D
Sbjct  295  KTD  297



>ref|XP_009373356.1| PREDICTED: methylsterol monooxygenase 1-1-like [Pyrus x bretschneideri]
Length=297

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 50/123 (41%), Gaps = 45/123 (37%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWTPTK+IPFYGG ++HDYH YV       F                          
Sbjct  219  YDFPWTPTKHIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +GYRYQKK+L+      K+N E  G  + G  D 
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKILK------KLNEEPAGVQNGGSIDF  294

Query  192  KVD  184
            K D
Sbjct  295  KTD  297



>ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citrus clementina]
 gb|ESR53662.1| hypothetical protein CICLE_v10021364mg [Citrus clementina]
Length=300

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 49/114 (43%), Gaps = 39/114 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW  TKYIPFYGG D+HDYH YV       F                          
Sbjct  219  YDFPWGFTKYIPFYGGADYHDYHHYVGEQSHSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH  211
                           F+Y  FL    +GYRYQKK+L++ +E  + + EQNG S+
Sbjct  254  -------------SVFTYCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNGGSY  294



>ref|XP_006283986.1| hypothetical protein CARUB_v10005108mg [Capsella rubella]
 gb|EOA16884.1| hypothetical protein CARUB_v10005108mg [Capsella rubella]
Length=362

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 39/109 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TKYIPFYGG ++HDYH YV       F                          
Sbjct  284  YDFPWTLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  318

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQ  226
                           F+Y  ++    +GYR+QKK+LQQ +E+SK +++Q
Sbjct  319  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKESSKKSNKQ  354



>gb|KFK28860.1| hypothetical protein AALP_AA7G057900 [Arabis alpina]
Length=287

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 49/111 (44%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TKYIP YGG ++HDYH YV       F                          
Sbjct  210  YDFPWSLTKYIPLYGGAEYHDYHHYVGGQSQSNFA-------------------------  244

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E SK +++QNG
Sbjct  245  -------------SVFTYCDYIYGTDKGYRFQKKLLKQIKEESKKSNKQNG  282



>emb|CDY41294.1| BnaA01g12450D [Brassica napus]
Length=298

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 49/111 (44%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TK+IPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTLTKFIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+LQQ ++ SK ++ Q+G
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKQESKKSNMQDG  293



>ref|XP_009136152.1| PREDICTED: methylsterol monooxygenase 1-2 [Brassica rapa]
Length=298

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 49/111 (44%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PWT TK+IPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWTLTKFIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+LQQ ++ SK ++ Q+G
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQIKQESKKSNMQDG  293



>ref|XP_010538766.1| PREDICTED: methylsterol monooxygenase 1-1 [Tarenaya hassleriana]
Length=298

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 49/111 (44%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            Y+ PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YEFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+LQ+ +  S+ + +QNG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQEMKGESEKSRKQNG  293



>gb|KFK31958.1| hypothetical protein AALP_AA6G181900 [Arabis alpina]
Length=295

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 42/111 (38%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+PTKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYR+QKK+L+Q +E+SK   + NG
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSK---KSNG  290



>gb|AAK61361.1| putative sterol 4-alpha-methyl-oxidase [Arabidopsis thaliana]
Length=299

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 50/118 (42%), Gaps = 42/118 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEE  199
                           F+Y  ++    +GYR+QKK+LQQ +E SK   + N   + GE+
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQMKEKSK---KSNKLVNGGEK  297



>gb|AAM65428.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
Length=299

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 50/118 (42%), Gaps = 42/118 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEE  199
                           F+Y  ++    +GYR+QKK+LQQ +E SK   + N   + GE+
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQMKEKSK---KSNKLVNGGEK  297



>ref|NP_567670.1| sterol C4-methyl oxidase 1-2 [Arabidopsis thaliana]
 sp|Q1EC69.1|SMO12_ARATH RecName: Full=Methylsterol monooxygenase 1-2; AltName: Full=Sterol 
4-alpha-methyl-oxidase 1-2; Short=AtSMO1-2 [Arabidopsis 
thaliana]
 gb|ABF85767.1| At4g22756 [Arabidopsis thaliana]
 dbj|BAF01201.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84653.1| sterol C4-methyl oxidase 1-2 [Arabidopsis thaliana]
Length=299

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 50/118 (42%), Gaps = 42/118 (36%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TKYIPFYGG ++HDYH YV       F                          
Sbjct  221  YDFPWSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA-------------------------  255

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEE  199
                           F+Y  ++    +GYR+QKK+LQQ +E SK   + N   + GE+
Sbjct  256  -------------SVFTYCDYIYGTDKGYRFQKKLLQQMKEKSK---KSNKLVNGGEK  297



>ref|XP_007134847.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris]
 gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris]
Length=302

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 53/123 (43%), Gaps = 40/123 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+ TKYIPFYGG ++HDYH YV       F                          
Sbjct  219  YDFPWSITKYIPFYGGAEYHDYHHYVGKQSHSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSHAGEEDV  193
                           F+Y  ++    +GYRYQKK+LQ+ +E      +QNG S+  ++ +
Sbjct  254  -------------SVFTYCDYIYGTDKGYRYQKKILQKLKEDLTYGEQQNGGSYKTQQ-I  299

Query  192  KVD  184
            K D
Sbjct  300  KSD  302



>dbj|BAC57961.1| putative C-4 sterol methyl oxidase [Aster tripolium]
Length=297

 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YD PWT  K+IPF  G ++HDYH YV
Sbjct  219  YDFPWTYKKFIPFSAGAEYHDYHHYV  244


 Score = 35.8 bits (81),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = -2

Query  470  GGLSHSNFA-SVFTYCDYIYGTDKVCI*NXKXSILDQFXTAIYIGRKTK  327
            G  S SNF   +FTYCDY+YGTDK    N K  +  Q   +   G++ K
Sbjct  245  GEKSQSNFWHPIFTYCDYLYGTDKGYR-NRKKLLAQQERWSKSEGKRAK  292



>gb|EMT21555.1| Putative C-4 methylsterol oxidase [Aegilops tauschii]
Length=185

 Score = 38.1 bits (87),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +  P+ PT YIPFYGG ++HDYH +V       F 
Sbjct  109  FKFPFNPTNYIPFYGGAEYHDYHHFVGEHSQSNFS  143


 Score = 36.6 bits (83),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            G  S SNF+S+FT+CDY++GTDK
Sbjct  135  GEHSQSNFSSLFTFCDYLHGTDK  157



>gb|KHN09765.1| Methylsterol monooxygenase 1-1 [Glycine soja]
Length=196

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 45/111 (41%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD P + TKYIPFYGG ++HDYH YV       F                          
Sbjct  118  YDFPRSITKYIPFYGGAEYHDYHHYVGRQSQSNFA-------------------------  152

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYRYQKK+LQ+ +E      EQNG
Sbjct  153  -------------SVFTYCDYIYGTDKGYRYQKKILQKLKEELANGVEQNG  190



>gb|AAQ83691.1| C-4 sterol methyl oxidase 1 [Nicotiana benthamiana]
Length=244

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYV  472
            YDLPWT TKYIPFYGGPD+HDYH YV
Sbjct  219  YDLPWTITKYIPFYGGPDYHDYHHYV  244



>gb|KHN04765.1| Methylsterol monooxygenase 1-1 [Glycine soja]
Length=207

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 47/114 (41%), Gaps = 39/114 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD P + TKYIPFYGG ++HDYH YV       F                          
Sbjct  129  YDFPRSITKYIPFYGGAEYHDYHHYVGRQSQSNFA-------------------------  163

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNGFSH  211
                           F+Y  ++    +GYRYQKK+LQ+ +E      EQNG S+
Sbjct  164  -------------SVFTYCDYIYGTDKGYRYQKKILQKLKEELANGVEQNGGSY  204



>ref|XP_010276506.1| PREDICTED: methylsterol monooxygenase 1-1-like [Nelumbo nucifera]
Length=304

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 46/111 (41%), Gaps = 39/111 (35%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD PW+P+KYIPFYGG +HHDYH +V       F                          
Sbjct  219  YDFPWSPSKYIPFYGGAEHHDYHHFVGGQSHSNFA-------------------------  253

Query  369  GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQXREASKINSEQNG  220
                           F+Y  ++    +GYRY K+ L+  +E    +SEQNG
Sbjct  254  -------------SIFTYCDYIYGTDKGYRYHKETLKMLKEKWSSSSEQNG  291


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFAS+FTYCDYIYGTDK
Sbjct  245  GGQSHSNFASIFTYCDYIYGTDK  267



>ref|XP_009401921.1| PREDICTED: methylsterol monooxygenase 1-1-like [Musa acuminata 
subsp. malaccensis]
Length=300

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GG SHSNFASVFTYCDYIYGTDK
Sbjct  245  GGRSHSNFASVFTYCDYIYGTDK  267



>gb|EAY79403.1| hypothetical protein OsI_34531 [Oryza sativa Indica Group]
Length=298

 Score = 41.6 bits (96),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            +D P+  TKYIPFYGG ++HDYH YV       F 
Sbjct  219  FDFPFNLTKYIPFYGGAEYHDYHHYVGRQSQSNFA  253


 Score = 30.8 bits (68),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCD  423
            G  S SNFASVFTYCD
Sbjct  245  GRQSQSNFASVFTYCD  260



>ref|XP_002970545.1| hypothetical protein SELMODRAFT_231600 [Selaginella moellendorffii]
 ref|XP_002978624.1| hypothetical protein SELMODRAFT_233175 [Selaginella moellendorffii]
 gb|EFJ20610.1| hypothetical protein SELMODRAFT_233175 [Selaginella moellendorffii]
 gb|EFJ28675.1| hypothetical protein SELMODRAFT_231600 [Selaginella moellendorffii]
Length=265

 Score = 40.8 bits (94),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            YD PW+ ++++P YGG D HDYH  + + KS  + 
Sbjct  200  YDFPWSLSRFLPIYGGADFHDYHHRLLFTKSGNYA  234


 Score = 31.2 bits (69),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS FTY D+I+GTDK
Sbjct  232  NYASTFTYMDWIFGTDK  248



>ref|XP_010053398.1| PREDICTED: methylsterol monooxygenase 1-2-like [Eucalyptus grandis]
 gb|KCW77678.1| hypothetical protein EUGRSUZ_D01979 [Eucalyptus grandis]
Length=294

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -2

Query  470  GGLSHSNFASVFTYCDYIYGTDK  402
            GGLSHSNFASVFTYCD+IYG+DK
Sbjct  245  GGLSHSNFASVFTYCDFIYGSDK  267



>ref|XP_001758083.1| predicted protein [Physcomitrella patens]
 gb|EDQ76905.1| predicted protein [Physcomitrella patens]
Length=275

 Score = 42.0 bits (97),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ ++Y+P YGG D HDYH  + + KS  +
Sbjct  201  YDFPWSLSRYLPIYGGADFHDYHHRLLYTKSGNY  234


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N++S FTY D+I+GTDK
Sbjct  233  NYSSTFTYMDWIFGTDK  249



>ref|XP_010325726.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum lycopersicum]
Length=300

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 50/110 (45%), Gaps = 37/110 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            Y+ PW+P+KYIPFYGG  +HDYH +V      + C S         N   V+     IY 
Sbjct  220  YEFPWSPSKYIPFYGGAIYHDYHHFV-----GESCHS---------NFASVFTYCDYIY-  264

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNG  220
                 +D                  +GYRYQK+V ++ RE  K+  + NG
Sbjct  265  ----GTD------------------KGYRYQKEVFEKRREKLKMEEKVNG  292



>ref|XP_001770841.1| predicted protein [Physcomitrella patens]
 gb|EDQ64365.1| predicted protein [Physcomitrella patens]
Length=330

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+ ++Y+P YGG D HDYH  + + KS  +
Sbjct  256  YDFPWSLSRYLPIYGGADFHDYHHRLLYTKSGNY  289


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N++S FTY D+I+GTDK
Sbjct  288  NYSSTFTYMDWIFGTDK  304



>ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Glycine 
max]
Length=359

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 47/112 (42%), Gaps = 37/112 (33%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            YD P + TKYIPFYGG ++HDYH YV       F                V+     IY 
Sbjct  281  YDFPRSITKYIPFYGGAEYHDYHHYVGRQSQSNFA--------------SVFTYCDYIY-  325

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNGFS  214
                 +D                  +GYRYQKK+LQ+ +E      EQNG S
Sbjct  326  ----GTD------------------KGYRYQKKILQKLKEELANGVEQNGGS  355



>gb|AAX95419.1| 4-alpha-methyl-sterol C4-methyl-oxidase [Oryza sativa Japonica 
Group]
Length=293

 Score = 41.6 bits (96),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  229  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  263


 Score = 28.9 bits (63),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  261  NYASTFVYMDWLFGTDK  277



>ref|XP_002973214.1| hypothetical protein SELMODRAFT_173304 [Selaginella moellendorffii]
 gb|EFJ25588.1| hypothetical protein SELMODRAFT_173304 [Selaginella moellendorffii]
Length=304

 Score = 43.5 bits (101),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+P+K++P YGG + HDYH  + + KS  +
Sbjct  213  YDFPWSPSKFLPLYGGAEFHDYHHRLLYTKSGNY  246


 Score = 27.3 bits (59),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTD  405
            N++S FTY D+I+GTD
Sbjct  245  NYSSTFTYMDWIFGTD  260



>gb|ACL53689.1| unknown [Zea mays]
 gb|AFW60059.1| c-4 methylsterol oxidase [Zea mays]
Length=268

 Score = 41.6 bits (96),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  204  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  238


 Score = 28.9 bits (63),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  236  NYASTFVYMDWLFGTDK  252



>ref|XP_004978537.1| PREDICTED: methylsterol monooxygenase 2-1-like [Setaria italica]
Length=268

 Score = 41.2 bits (95),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  204  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  238


 Score = 28.9 bits (63),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  236  NYASTFVYMDWLFGTDK  252



>ref|XP_004969155.1| PREDICTED: methylsterol monooxygenase 2-2-like isoform X2 [Setaria 
italica]
Length=268

 Score = 41.2 bits (95),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  204  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  238


 Score = 28.9 bits (63),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  236  NYASTFVYMDWLFGTDK  252



>ref|XP_002465927.1| hypothetical protein SORBIDRAFT_01g048370 [Sorghum bicolor]
 gb|EER92925.1| hypothetical protein SORBIDRAFT_01g048370 [Sorghum bicolor]
Length=268

 Score = 41.2 bits (95),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  204  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  238


 Score = 28.9 bits (63),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  236  NYASTFVYMDWLFGTDK  252



>ref|XP_003577193.1| PREDICTED: methylsterol monooxygenase 2-2-like [Brachypodium 
distachyon]
Length=267

 Score = 41.2 bits (95),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  203  YHFPWSPSNFLPLYGGSDFHDYHHRVLFTKSGNYA  237


 Score = 28.9 bits (63),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  235  NYASTFVYMDWLFGTDK  251



>ref|XP_002976636.1| hypothetical protein SELMODRAFT_151304 [Selaginella moellendorffii]
 gb|EFJ22305.1| hypothetical protein SELMODRAFT_151304 [Selaginella moellendorffii]
Length=294

 Score = 43.1 bits (100),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+P+K++P YGG + HDYH  + + KS  +
Sbjct  203  YDFPWSPSKFLPLYGGAEFHDYHHRLLYTKSGNY  236


 Score = 27.3 bits (59),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTD  405
            N++S FTY D+I+GTD
Sbjct  235  NYSSTFTYMDWIFGTD  250



>ref|NP_001105744.1| LOC542766 [Zea mays]
 gb|AAL82576.1| putative sterol 4-alpha-methyl-oxidase [Zea mays]
Length=264

 Score = 41.2 bits (95),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  200  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  234


 Score = 28.9 bits (63),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  232  NYASTFVYMDWLFGTDK  248



>ref|XP_009381067.1| PREDICTED: methylsterol monooxygenase 2-1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=257

 Score = 41.6 bits (96),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  193  YHFPWSPSNFLPLYGGADFHDYHHRVLYTKSGNYA  227


 Score = 28.9 bits (63),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  225  NYASTFVYMDWLFGTDK  241



>ref|NP_001068557.1| Os11g0707600 [Oryza sativa Japonica Group]
 gb|ABA95528.1| Sterol desaturase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28920.1| Os11g0707600 [Oryza sativa Japonica Group]
 dbj|BAG95792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68657.1| hypothetical protein OsI_37101 [Oryza sativa Indica Group]
 gb|EEE52583.1| hypothetical protein OsJ_34885 [Oryza sativa Japonica Group]
Length=266

 Score = 41.2 bits (95),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  202  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  236


 Score = 28.9 bits (63),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  234  NYASTFVYMDWLFGTDK  250



>ref|NP_001266521.1| C-4 methylsterol oxidase [Zea mays]
 gb|ACG34890.1| C-4 methylsterol oxidase [Zea mays]
Length=268

 Score = 41.2 bits (95),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  204  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  238


 Score = 28.9 bits (63),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  236  NYASTFVYMDWLFGTDK  252



>emb|CDX82967.1| BnaC01g14170D [Brassica napus]
Length=583

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSI  436
            YDLPWT TK +PFYGG  +HDYH Y+    +   CF +
Sbjct  217  YDLPWTLTKLVPFYGGAGYHDYHHYLKMVSASLLCFDL  254



>gb|AFW60058.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_526621, partial 
[Zea mays]
Length=279

 Score = 41.2 bits (95),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  204  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  238


 Score = 28.9 bits (63),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  236  NYASTFVYMDWLFGTDK  252



>ref|XP_009381066.1| PREDICTED: methylsterol monooxygenase 2-1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=265

 Score = 41.2 bits (95),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  201  YHFPWSPSNFLPLYGGADFHDYHHRVLYTKSGNYA  235


 Score = 28.9 bits (63),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  233  NYASTFVYMDWLFGTDK  249



>ref|XP_004145282.1| PREDICTED: methylsterol monooxygenase 2-2-like [Cucumis sativus]
 ref|XP_004154053.1| PREDICTED: methylsterol monooxygenase 2-2-like [Cucumis sativus]
 ref|XP_004163802.1| PREDICTED: methylsterol monooxygenase 2-2-like [Cucumis sativus]
 gb|KGN65753.1| hypothetical protein Csa_1G524750 [Cucumis sativus]
Length=262

 Score = 40.0 bits (92),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQF  448
            YD PW+P+ +IP YGG   HDYH  + + KS  +
Sbjct  201  YDFPWSPSNFIPLYGGAYFHDYHHRLLYTKSGNY  234


 Score = 29.6 bits (65),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N++S FTY D+I+GTDK
Sbjct  233  NYSSTFTYMDWIFGTDK  249



>gb|ACN36082.1| unknown [Zea mays]
Length=79

 Score = 41.6 bits (96),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  15   YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  49


 Score = 28.1 bits (61),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  47   NYASTFVYMDWLFGTDK  63



>gb|EMT30465.1| Putative C-4 methylsterol oxidase [Aegilops tauschii]
Length=211

 Score = 40.8 bits (94),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFC  445
            Y  PW+P+ ++P YGG D HDYH  V + KS  + 
Sbjct  147  YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNYA  181


 Score = 28.5 bits (62),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  452  NFASVFTYCDYIYGTDK  402
            N+AS F Y D+++GTDK
Sbjct  179  NYASTFVYMDWLFGTDK  195



>ref|XP_006339428.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum tuberosum]
Length=300

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 50/110 (45%), Gaps = 37/110 (34%)
 Frame = -1

Query  549  YDLPWTPTKYIPFYGGPDHHDYHXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKLXXIYI  370
            Y+ PW+P+KYIPFYGG  +HDYH +V      + C S         N   V+     IY 
Sbjct  220  YEFPWSPSKYIPFYGGAIYHDYHHFV-----GESCHS---------NFASVFTYCDYIY-  264

Query  369  GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQXREASKINSEQNG  220
                 +D                  +G+RYQK+V ++ RE  ++  + NG
Sbjct  265  ----GTD------------------KGFRYQKEVFEKRREKLRMEEKVNG  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380