BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF015D02

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU42442.1|  hypothetical protein MIMGU_mgv1a0056111mg               377   2e-128   Erythranthe guttata [common monkey flower]
emb|CDP02939.1|  unnamed protein product                                379   3e-126   Coffea canephora [robusta coffee]
ref|XP_002532409.1|  Xylose isomerase, putative                         379   3e-126   Ricinus communis
ref|XP_006343543.1|  PREDICTED: xylose isomerase-like                   378   7e-126   Solanum tuberosum [potatoes]
ref|XP_009801815.1|  PREDICTED: xylose isomerase                        377   2e-125   Nicotiana sylvestris
ref|XP_011079316.1|  PREDICTED: xylose isomerase                        376   2e-125   Sesamum indicum [beniseed]
ref|XP_009606829.1|  PREDICTED: xylose isomerase                        376   3e-125   Nicotiana tomentosiformis
gb|EYU34279.1|  hypothetical protein MIMGU_mgv1a005575mg                376   4e-125   Erythranthe guttata [common monkey flower]
ref|XP_004242672.1|  PREDICTED: xylose isomerase                        375   6e-125   Solanum lycopersicum
ref|XP_010688509.1|  PREDICTED: xylose isomerase isoform X2             374   2e-124   
ref|XP_010688511.1|  PREDICTED: xylose isomerase isoform X3             374   2e-124   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP43806.1|  hypothetical protein JCGZ_23014                         372   7e-124   Jatropha curcas
ref|XP_010688508.1|  PREDICTED: xylose isomerase isoform X1             374   7e-124   
ref|XP_002277520.2|  PREDICTED: xylose isomerase                        369   1e-122   Vitis vinifera
gb|KGN61107.1|  hypothetical protein Csa_2G049960                       368   3e-122   Cucumis sativus [cucumbers]
emb|CBI17768.3|  unnamed protein product                                370   3e-122   Vitis vinifera
ref|XP_004149070.1|  PREDICTED: xylose isomerase-like                   368   3e-122   
emb|CAN65150.1|  hypothetical protein VITISV_037086                     367   9e-122   Vitis vinifera
ref|XP_008452100.1|  PREDICTED: xylose isomerase                        367   1e-121   Cucumis melo [Oriental melon]
ref|XP_011069881.1|  PREDICTED: xylose isomerase-like                   367   1e-121   Sesamum indicum [beniseed]
ref|XP_006453438.1|  hypothetical protein CICLE_v10008154mg             366   3e-121   Citrus clementina [clementine]
ref|XP_003549495.1|  PREDICTED: xylose isomerase                        365   4e-121   Glycine max [soybeans]
gb|KDO62435.1|  hypothetical protein CISIN_1g0373932mg                  366   4e-121   Citrus sinensis [apfelsine]
ref|XP_011018165.1|  PREDICTED: xylose isomerase                        365   5e-121   Populus euphratica
gb|KHN17567.1|  Xylose isomerase                                        365   6e-121   Glycine soja [wild soybean]
ref|XP_002324488.1|  hypothetical protein POPTR_0018s10460g             365   8e-121   Populus trichocarpa [western balsam poplar]
ref|XP_008223675.1|  PREDICTED: xylose isomerase                        364   1e-120   Prunus mume [ume]
gb|ACJ84879.1|  unknown                                                 358   2e-120   Medicago truncatula
ref|XP_007222807.1|  hypothetical protein PRUPE_ppa005065mg             363   3e-120   Prunus persica
dbj|BAD95103.1|  xylose isomerase                                       353   9e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02217.1|  Xylose isomerase -like protein                          362   1e-119   Gossypium arboreum [tree cotton]
ref|XP_007011128.1|  Xylose isomerase family protein isoform 2          362   1e-119   
ref|XP_010102992.1|  Xylose isomerase                                   362   1e-119   
ref|XP_009348411.1|  PREDICTED: xylose isomerase-like                   361   2e-119   Pyrus x bretschneideri [bai li]
ref|XP_010102993.1|  Xylose isomerase                                   362   3e-119   
gb|KJB60240.1|  hypothetical protein B456_009G296100                    360   4e-119   Gossypium raimondii
gb|KJB60238.1|  hypothetical protein B456_009G296100                    360   4e-119   Gossypium raimondii
ref|XP_004507817.1|  PREDICTED: xylose isomerase-like isoform X3        360   4e-119   Cicer arietinum [garbanzo]
ref|XP_007154797.1|  hypothetical protein PHAVU_003G148700g             359   1e-118   Phaseolus vulgaris [French bean]
ref|XP_009336656.1|  PREDICTED: xylose isomerase-like                   359   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_003610179.1|  Xylose isomerase                                   359   1e-118   
ref|XP_007011127.1|  Xylose isomerase family protein isoform 1          361   1e-118   
ref|XP_010259769.1|  PREDICTED: xylose isomerase isoform X2             359   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_008365436.1|  PREDICTED: xylose isomerase-like                   358   2e-118   Malus domestica [apple tree]
gb|AES92376.2|  xylose isomerase                                        358   2e-118   Medicago truncatula
gb|EPS67638.1|  xylose isomerase                                        358   4e-118   Genlisea aurea
ref|XP_010259768.1|  PREDICTED: xylose isomerase isoform X1             359   4e-118   Nelumbo nucifera [Indian lotus]
gb|KJB60239.1|  hypothetical protein B456_009G296100                    357   1e-117   Gossypium raimondii
ref|XP_010938719.1|  PREDICTED: xylose isomerase                        356   2e-117   Elaeis guineensis
gb|AFK39166.1|  unknown                                                 355   4e-117   Medicago truncatula
ref|XP_009391575.1|  PREDICTED: xylose isomerase-like                   355   7e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297371.1|  PREDICTED: xylose isomerase                        354   9e-117   Fragaria vesca subsp. vesca
ref|XP_008796228.1|  PREDICTED: xylose isomerase isoform X2             354   2e-116   Phoenix dactylifera
ref|XP_004958625.1|  PREDICTED: xylose isomerase-like                   353   3e-116   Setaria italica
ref|XP_004958079.1|  PREDICTED: xylose isomerase-like                   353   4e-116   Setaria italica
ref|XP_008796227.1|  PREDICTED: xylose isomerase isoform X1             354   6e-116   Phoenix dactylifera
ref|XP_010065878.1|  PREDICTED: xylose isomerase-like isoform X3        352   1e-115   Eucalyptus grandis [rose gum]
dbj|BAE98492.1|  xylose isomerase                                       350   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568861.3|  xylose isomerase                                      350   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539451.1|  PREDICTED: xylose isomerase                        350   6e-115   Tarenaya hassleriana [spider flower]
ref|XP_009417936.1|  PREDICTED: xylose isomerase-like                   349   8e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401183.1|  hypothetical protein EUTSA_v10013406mg             350   8e-115   Eutrema salsugineum [saltwater cress]
ref|XP_010443465.1|  PREDICTED: xylose isomerase                        349   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_006280396.1|  hypothetical protein CARUB_v10026323mg             349   1e-114   Capsella rubella
emb|CDY25894.1|  BnaC09g32660D                                          350   1e-114   Brassica napus [oilseed rape]
ref|XP_009120281.1|  PREDICTED: xylose isomerase                        349   1e-114   Brassica rapa
emb|CDY49729.1|  BnaA10g11590D                                          349   1e-114   Brassica napus [oilseed rape]
ref|XP_002864523.1|  xylose isomerase family protein                    348   2e-114   Arabidopsis lyrata subsp. lyrata
dbj|BAJ34093.1|  unnamed protein product                                348   2e-114   Eutrema halophilum
ref|XP_006658089.1|  PREDICTED: xylose isomerase-like                   348   3e-114   Oryza brachyantha
gb|EEC82655.1|  hypothetical protein OsI_27268                          347   8e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001060585.1|  Os07g0669100                                       347   8e-114   
ref|XP_010483295.1|  PREDICTED: xylose isomerase-like                   347   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_003562496.1|  PREDICTED: xylose isomerase                        347   1e-113   Brachypodium distachyon [annual false brome]
ref|NP_001132889.1|  putative xylose isomerase family protein pre...    346   1e-113   Zea mays [maize]
gb|AAM61519.1|  xylose isomerase                                        346   2e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54617.1|  xylose isomerase                                        346   2e-113   Phaseolus vulgaris [French bean]
ref|XP_010452612.1|  PREDICTED: xylose isomerase-like                   346   2e-113   Camelina sativa [gold-of-pleasure]
gb|EMS46439.1|  Xylose isomerase                                        345   2e-113   Triticum urartu
gb|ACG42142.1|  xylose isomerase                                        345   7e-113   Zea mays [maize]
ref|XP_006845583.1|  hypothetical protein AMTR_s00019p00197750          343   2e-112   Amborella trichopoda
gb|ACG35698.1|  xylose isomerase                                        343   3e-112   Zea mays [maize]
ref|NP_001132653.1|  uncharacterized protein LOC100194128 precursor     343   4e-112   Zea mays [maize]
dbj|BAJ96683.1|  predicted protein                                      342   4e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004507815.1|  PREDICTED: xylose isomerase-like isoform X1        342   7e-112   
ref|XP_008650947.1|  PREDICTED: uncharacterized protein LOC100194...    343   8e-112   Zea mays [maize]
gb|KJB60241.1|  hypothetical protein B456_009G296100                    341   1e-111   Gossypium raimondii
tpg|DAA64057.1|  TPA: putative xylose isomerase family protein          343   2e-111   
gb|KCW63564.1|  hypothetical protein EUGRSUZ_G01193                     340   6e-111   Eucalyptus grandis [rose gum]
gb|EMT06905.1|  Xylose isomerase                                        338   7e-111   
sp|Q40082.1|XYLA_HORVU  RecName: Full=Xylose isomerase                  338   3e-110   Hordeum vulgare [barley]
dbj|BAB08802.1|  xylose isomerase                                       332   6e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16225.1|  unknown                                                 306   5e-99    Picea sitchensis
ref|XP_002991242.1|  hypothetical protein SELMODRAFT_229601             302   2e-96    
ref|XP_002991182.1|  hypothetical protein SELMODRAFT_161472             302   2e-96    
ref|XP_001774702.1|  predicted protein                                  300   1e-95    
emb|CAA64544.1|  xylose isomerase                                       286   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005646804.1|  xylose isomerase                                   253   2e-77    Coccomyxa subellipsoidea C-169
ref|XP_002506620.1|  predicted protein                                  248   2e-76    Micromonas commoda
ref|XP_010065874.1|  PREDICTED: xylose isomerase-like isoform X1        249   7e-76    
gb|KIZ04907.1|  xylose isomerase                                        248   1e-75    Monoraphidium neglectum
ref|WP_034568836.1|  xylose isomerase                                   239   2e-72    Clostridiales bacterium oral taxon 876
gb|ERI94441.1|  xylose isomerase                                        239   4e-72    Clostridiales bacterium oral taxon 876 str. F0540
gb|ETK93389.1|  xylose isomerase                                        233   5e-72    Phytophthora parasitica
gb|ETK93384.1|  xylose isomerase                                        233   7e-72    Phytophthora parasitica
gb|ETL46794.1|  xylose isomerase                                        233   2e-71    Phytophthora parasitica
ref|XP_001633389.1|  predicted protein                                  234   5e-71    Nematostella vectensis
gb|ETI53522.1|  xylose isomerase                                        233   5e-71    Phytophthora parasitica P1569
ref|XP_008900733.1|  xylose isomerase                                   235   9e-71    Phytophthora parasitica INRA-310
ref|XP_010738383.1|  PREDICTED: xylose isomerase-like isoform X2        231   4e-70    
ref|XP_010792168.1|  PREDICTED: xylose isomerase-like                   229   7e-70    Notothenia coriiceps [yellowbelly rockcod]
gb|ETI53536.1|  xylose isomerase                                        233   9e-70    Phytophthora parasitica P1569
gb|ETP51333.1|  xylose isomerase                                        233   9e-70    Phytophthora parasitica P10297
gb|ETL77578.1|  xylose isomerase                                        232   1e-69    Phytophthora parasitica
gb|ETO82214.1|  xylose isomerase                                        232   1e-69    Phytophthora parasitica P1976
emb|CAF93733.1|  unnamed protein product                                231   2e-69    Tetraodon nigroviridis
ref|XP_010738382.1|  PREDICTED: xylose isomerase-like isoform X1        231   4e-69    
ref|XP_003965907.1|  PREDICTED: xylose isomerase-like                   230   4e-69    
ref|WP_010588344.1|  xylose isomerase                                   230   5e-69    Schlesneria paludicola
ref|WP_017895180.1|  xylose isomerase                                   230   6e-69    Clostridium tyrobutyricum
ref|XP_009537176.1|  hypothetical protein PHYSODRAFT_565503             229   9e-69    Phytophthora sojae
ref|WP_036097976.1|  xylose isomerase                                   229   1e-68    Listeria floridensis
ref|WP_026658263.1|  Xylose isomerase                                   229   1e-68    
ref|XP_002904118.1|  xylose isomerase 1                                 230   1e-68    Phytophthora infestans T30-4
ref|WP_016205623.1|  xylose isomerase                                   229   1e-68    Clostridium
emb|CDQ80418.1|  unnamed protein product                                229   2e-68    Oncorhynchus mykiss
ref|XP_008321922.1|  PREDICTED: xylose isomerase-like isoform X2        228   2e-68    
ref|XP_006636149.1|  PREDICTED: xylose isomerase-like                   227   2e-68    
ref|XP_008290598.1|  PREDICTED: xylose isomerase-like                   228   3e-68    Stegastes partitus
ref|WP_044593090.1|  xylose isomerase                                   221   4e-68    
gb|ADD61976.1|  putative protein                                        223   4e-68    uncultured organism
emb|CBK25455.2|  unnamed protein product                                227   7e-68    Blastocystis hominis
ref|XP_010883508.1|  PREDICTED: xylose isomerase-like                   229   7e-68    
ref|XP_002739772.1|  PREDICTED: xylose isomerase-like                   219   8e-68    Saccoglossus kowalevskii
ref|WP_039037140.1|  xylose isomerase                                   227   1e-67    Pseudoalteromonas
gb|EQF74127.1|  xylose isomerase                                        222   1e-67    Clostridioides difficile CD212
ref|XP_008321921.1|  PREDICTED: xylose isomerase-like isoform X1        227   1e-67    Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_020532079.1|  hypothetical protein                               226   2e-67    Flexithrix dorotheae
ref|XP_009537174.1|  hypothetical protein PHYSODRAFT_306712             229   3e-67    Phytophthora sojae
gb|ELU13203.1|  hypothetical protein CAPTEDRAFT_149382                  225   4e-67    Capitella teleta
ref|XP_004356776.1|  xylose isomerase                                   225   6e-67    Acanthamoeba castellanii str. Neff
ref|WP_019027960.1|  xylose isomerase                                   224   7e-67    Colwellia piezophila
ref|XP_003387079.1|  PREDICTED: xylose isomerase-like                   225   8e-67    
gb|EFX66553.1|  hypothetical protein DAPPUDRAFT_218978                  223   8e-67    Daphnia pulex
ref|WP_007061694.1|  xylose isomerase                                   224   9e-67    Clostridium carboxidivorans
gb|ERM41646.1|  xylose isomerase                                        221   9e-67    Clostridioides difficile P68
ref|WP_010556356.1|  xylose isomerase                                   224   1e-66    Pseudoalteromonas marina
ref|WP_016710605.1|  xylose isomerase                                   224   1e-66    Pseudoalteromonas
ref|WP_008131330.1|  xylose isomerase                                   224   1e-66    Pseudoalteromonas sp. BSi20480
gb|AAR09155.1|  xylose isomerase                                        218   1e-66    Mannheimia granulomatis
ref|WP_039882234.1|  xylose isomerase                                   224   1e-66    Mesotoga
emb|CCU83726.1|  Xylose isomerase                                       224   2e-66    Mesotoga infera
ref|WP_014731027.1|  xylose isomerase                                   224   2e-66    Mesotoga prima
gb|EFP62823.1|  putative xylose isomerase                               219   2e-66    Erysipelotrichaceae bacterium 3_1_53
ref|WP_018756053.1|  xylose isomerase                                   223   2e-66    Paenibacillus terrigena
ref|WP_028537509.1|  MULTISPECIES: xylose isomerase                     223   2e-66    Paenibacillus
gb|EOS54587.1|  xylose isomerase                                        223   2e-66    Paenibacillus barengoltzii G22
gb|EES74125.1|  xylose isomerase                                        223   2e-66    Paenibacillus sp. oral taxon 786 str. D14
ref|WP_036644393.1|  xylose isomerase                                   223   2e-66    Paenibacillus sp. oral taxon 786
ref|WP_038164239.1|  xylose isomerase                                   223   2e-66    Verrucomicrobium sp. BvORR106
ref|WP_010074860.1|  xylose isomerase                                   223   4e-66    Clostridium cellulovorans
ref|WP_009959227.1|  xylose isomerase                                   223   4e-66    Verrucomicrobium spinosum
ref|XP_005090167.1|  PREDICTED: xylose isomerase-like                   219   4e-66    
ref|WP_026462632.1|  xylose isomerase                                   223   5e-66    Adhaeribacter aquaticus
ref|WP_018751681.1|  xylose isomerase                                   222   5e-66    Paenibacillus sanguinis
ref|WP_032079132.1|  xylose isomerase                                   222   5e-66    Clostridium drakei
ref|WP_043090972.1|  xylose isomerase                                   215   6e-66    
gb|EGI71574.1|  xylose isomerase                                        218   6e-66    Pseudoalteromonas distincta
ref|WP_013626379.1|  xylose isomerase                                   222   8e-66    Rubinisphaera brasiliensis
ref|WP_038670249.1|  xylose isomerase                                   222   8e-66    Ruminococcus
ref|WP_022287212.1|  xylose isomerase                                   222   8e-66    Ruminococcus
ref|WP_036626617.1|  xylose isomerase                                   221   1e-65    Paenibacillus
ref|WP_013238479.1|  MULTISPECIES: xylose isomerase                     221   1e-65    Clostridium
ref|WP_029450677.1|  xylose isomerase                                   221   1e-65    Clostridium algidicarnis
ref|WP_016601082.1|  xylose isomerase                                   218   1e-65    Yersinia pestis
ref|WP_037562869.1|  xylose isomerase                                   221   1e-65    Alkalispirochaeta odontotermitis
ref|WP_038172460.1|  xylose isomerase                                   221   2e-65    Verrucomicrobium sp. BvORR106
ref|WP_028514448.1|  xylose isomerase                                   221   2e-65    Ruminococcus flavefaciens
ref|WP_024599023.1|  xylose isomerase                                   221   2e-65    Pseudoalteromonas
ref|WP_024594232.1|  xylose isomerase                                   221   2e-65    Pseudoalteromonas sp. TB13
ref|WP_007585153.1|  xylose isomerase                                   221   2e-65    Pseudoalteromonas sp. BSi20429
ref|WP_005654109.1|  xylose isomerase                                   221   2e-65    Bacteroides stercoris
ref|WP_021376347.1|  xylose isomerase                                   221   2e-65    Clostridioides difficile
ref|WP_034536238.1|  xylose isomerase                                   221   2e-65    Bacteroides stercoris
ref|WP_007375167.1|  MULTISPECIES: xylose isomerase                     221   2e-65    Pseudoalteromonas
ref|WP_013289876.1|  xylose isomerase                                   221   2e-65    Caldicellulosiruptor obsidiansis
ref|WP_009959507.1|  xylose isomerase                                   221   3e-65    Verrucomicrobium spinosum
ref|WP_013411463.1|  xylose isomerase                                   221   3e-65    Caldicellulosiruptor owensensis
ref|WP_022103428.1|  xylose isomerase                                   221   3e-65    
gb|EPH17343.1|  xylose isomerase                                        221   3e-65    Bacteroides stercoris CC31F
ref|WP_035132135.1|  xylose isomerase                                   220   3e-65    Flavobacterium beibuense
ref|WP_009089925.1|  xylose isomerase                                   220   4e-65    Elizabethkingia anophelis
ref|WP_008302073.1|  xylose isomerase                                   220   4e-65    Paraglaciecola agarilytica
ref|WP_014625278.1|  xylose isomerase                                   220   4e-65    Spirochaeta thermophila
ref|WP_009891378.1|  xylose isomerase                                   220   4e-65    Clostridiales
ref|WP_021369126.1|  xylose isomerase                                   220   4e-65    Clostridioides difficile
ref|WP_009898127.1|  xylose isomerase                                   220   4e-65    Clostridiales
ref|WP_029487833.1|  xylose isomerase                                   220   4e-65    Epulopiscium sp. 'N.t. morphotype B'
ref|WP_021423576.1|  xylose isomerase                                   220   4e-65    Clostridioides difficile
ref|WP_022428254.1|  xylose isomerase                                   214   4e-65    
ref|WP_021421788.1|  xylose isomerase                                   220   5e-65    Clostridioides difficile
ref|WP_014757233.1|  MULTISPECIES: xylose isomerase                     220   5e-65    Thermoanaerobacterium aotearoense
ref|WP_012570371.1|  xylose isomerase                                   220   5e-65    Coxiella burnetii
ref|WP_044878597.1|  xylose isomerase                                   220   5e-65    Paenibacillus sp. IHBB 10380
ref|WP_007985011.1|  MULTISPECIES: xylose isomerase                     220   5e-65    Alteromonadaceae
ref|WP_013043164.1|  xylose isomerase                                   219   5e-65    Coraliomargarita akajimensis
ref|WP_028405759.1|  xylose isomerase                                   219   6e-65    Bacillus sp. J13
gb|EHJ36230.1|  xylose isomerase                                        220   6e-65    Clostridioides difficile 70-100-2010
ref|WP_012816370.1|  xylose isomerase                                   220   6e-65    
ref|WP_021388228.1|  xylose isomerase                                   220   6e-65    Clostridioides difficile
ref|WP_009906213.1|  xylose isomerase                                   220   6e-65    Clostridioides difficile
ref|WP_021361041.1|  xylose isomerase                                   220   6e-65    Clostridioides difficile
ref|WP_021393548.1|  xylose isomerase                                   220   6e-65    Clostridioides difficile
ref|WP_007131701.1|  xylose isomerase                                   219   7e-65    Paenibacillus lactis
ref|WP_029501331.1|  xylose isomerase                                   219   7e-65    Lachnoclostridium phytofermentans
ref|WP_006450750.1|  hypothetical protein                               213   7e-65    
ref|WP_022019645.1|  xylose isomerase                                   219   8e-65    
ref|WP_015923669.1|  xylose isomerase                                   219   8e-65    Halothermothrix orenii
ref|WP_029228039.1|  xylose isomerase                                   219   8e-65    Caldicellulosiruptor acetigenus
ref|WP_007106886.1|  xylose isomerase                                   219   8e-65    Paraglaciecola polaris
ref|WP_013433194.1|  xylose isomerase                                   219   9e-65    Caldicellulosiruptor kristjanssonii
ref|WP_044003575.1|  xylose isomerase                                   219   9e-65    Hymenobacter swuensis
ref|XP_002591809.1|  hypothetical protein BRAFLDRAFT_123544             211   9e-65    Branchiostoma floridae
gb|EFH05881.1|  xylose isomerase                                        219   9e-65    Clostridioides difficile NAP08
ref|WP_006990989.1|  MULTISPECIES: xylose isomerase                     219   1e-64    Alteromonadales
gb|AIF26293.1|  putative xylose isomerase                               217   1e-64    uncultured bacterium Lq_025_E06
gb|EHJ32437.1|  xylose isomerase                                        219   1e-64    Clostridioides difficile 002-P50-2011
ref|WP_015392438.1|  xylose isomerase XylA                              219   1e-64    Clostridium saccharoperbutylacetonicum
ref|WP_014041981.1|  xylose isomerase                                   219   1e-64    Caldicellulosiruptor lactoaceticus
ref|WP_037440177.1|  xylose isomerase                                   219   1e-64    Pedobacter antarcticus
ref|WP_024860181.1|  xylose isomerase                                   219   1e-64    Ruminococcus flavefaciens
ref|WP_022618581.1|  Xylose isomerase                                   219   1e-64    Clostridioides difficile
ref|WP_038506942.1|  xylose isomerase                                   219   1e-64    Cellulophaga lytica
ref|WP_005769174.1|  xylose isomerase                                   219   1e-64    Coxiella burnetii
ref|WP_021412148.1|  xylose isomerase                                   219   1e-64    Clostridioides difficile
ref|WP_034646410.1|  xylose isomerase                                   219   1e-64    Cellulophaga
ref|WP_012341741.1|  xylose isomerase                                   219   1e-64    Histophilus somni
ref|WP_027072689.1|  xylose isomerase                                   219   1e-64    Luteimonas sp. J29
ref|WP_028518112.1|  xylose isomerase                                   219   1e-64    Ruminococcus flavefaciens
ref|WP_044480420.1|  xylose isomerase                                   219   1e-64    Paenibacillus antibioticophila
gb|EFF45521.1|  xylose isomerase                                        211   1e-64    Xanthomonas citri pv. aurantifolii str. ICPB 11122
ref|WP_012064875.1|  xylose isomerase                                   218   2e-64    Alkaliphilus metalliredigens
ref|WP_034634309.1|  xylose isomerase                                   211   2e-64    
ref|WP_011576446.1|  xylose isomerase                                   218   2e-64    Pseudoalteromonas atlantica
ref|WP_035133012.1|  xylose isomerase                                   218   2e-64    Flavobacterium beibuense
gb|EHJ34457.1|  xylose isomerase                                        219   2e-64    Clostridioides difficile 050-P50-2011
ref|WP_035601129.1|  xylose isomerase                                   218   2e-64    Haloferula sp. BvORR071
ref|WP_013298905.1|  xylose isomerase                                   218   2e-64    Thermoanaerobacterium thermosaccharolyticum
ref|WP_035688493.1|  xylose isomerase                                   218   2e-64    Avibacterium paragallinarum
ref|WP_002997116.1|  xylose isomerase                                   218   2e-64    Sphingobacterium spiritivorum
ref|WP_041604097.1|  xylose isomerase                                   218   2e-64    Histophilus somni
ref|WP_009186695.1|  xylose isomerase                                   218   2e-64    Cecembia lonarensis
gb|ABI24864.1|  D-xylose isomerase                                      218   2e-64    Histophilus somni 129PT
ref|WP_028525170.1|  xylose isomerase                                   218   2e-64    Runella limosa
ref|WP_016679053.1|  xylose isomerase                                   217   2e-64    Yersinia pestis
ref|WP_043088301.1|  xylose isomerase                                   212   2e-64    
ref|WP_013430944.1|  xylose isomerase                                   218   2e-64    Caldicellulosiruptor kronotskyensis
ref|WP_041252697.1|  xylose isomerase                                   218   2e-64    Flavobacteriaceae bacterium 3519-10
ref|WP_012058599.1|  xylose isomerase                                   218   2e-64    Clostridium beijerinckii
ref|WP_022971245.1|  xylose isomerase                                   218   3e-64    Xanthomonas maliensis
ref|WP_017167923.1|  xylose isomerase                                   211   3e-64    
ref|WP_007414259.1|  xylose isomerase                                   218   3e-64    Pedosphaera parvula
ref|WP_043106581.1|  xylose isomerase                                   212   3e-64    
ref|WP_013314408.1|  xylose isomerase                                   218   3e-64    Spirochaeta thermophila
ref|WP_022587522.1|  xylose isomerase                                   218   3e-64    Caldanaerobacter subterraneus
ref|WP_021846289.1|  xylose isomerase                                   218   3e-64    
gb|ACU08186.1|  Xylose isomerase                                        218   3e-64    Flavobacteriaceae bacterium 3519-10
ref|WP_028510817.1|  xylose isomerase                                   218   3e-64    Ruminococcus sp. NK3A76
ref|WP_042674505.1|  xylose isomerase                                   211   3e-64    
gb|KGP56503.1|  xylose isomerase                                        211   3e-64    
ref|WP_007173223.1|  xylose isomerase                                   218   4e-64    Prevotella bergensis
ref|WP_026292827.1|  xylose isomerase                                   218   4e-64    Rubritalea marina
ref|WP_015737501.1|  MULTISPECIES: xylose isomerase                     218   4e-64    Paenibacillus
ref|WP_025863290.1|  xylose isomerase                                   218   4e-64    Prolixibacter bellariivorans
ref|WP_009594057.1|  xylose isomerase                                   218   4e-64    Paenibacillus sp. HGF5
ref|WP_039417914.1|  xylose isomerase                                   211   4e-64    
ref|WP_018978264.1|  xylose isomerase                                   217   4e-64    Saccharibacillus kuerlensis
ref|WP_033837048.1|  xylose isomerase                                   210   4e-64    
ref|WP_036583977.1|  xylose isomerase                                   217   5e-64    Paenibacillus darwinianus
ref|WP_033847877.1|  MULTISPECIES: xylose isomerase                     217   5e-64    
ref|WP_044271094.1|  xylose isomerase                                   217   5e-64    
ref|WP_009120973.1|  MULTISPECIES: xylose isomerase                     217   5e-64    
ref|WP_028673307.1|  MULTISPECIES: xylose isomerase                     217   5e-64    
ref|WP_012230197.1|  xylose isomerase                                   217   5e-64    
ref|WP_032466856.1|  xylose isomerase                                   217   5e-64    
ref|WP_041897212.1|  xylose isomerase                                   217   5e-64    
ref|WP_015312541.1|  xylose isomerase                                   217   5e-64    
ref|WP_017162694.1|  xylose isomerase                                   210   5e-64    
ref|WP_019637313.1|  xylose isomerase                                   217   5e-64    
ref|WP_002209593.1|  MULTISPECIES: xylose isomerase                     217   5e-64    
ref|WP_022495570.1|  xylose isomerase                                   217   5e-64    
ref|WP_010134855.1|  xylose isomerase                                   217   6e-64    
ref|WP_017209278.1|  xylose isomerase                                   217   6e-64    
ref|WP_017692238.1|  xylose isomerase                                   217   6e-64    
ref|WP_024631388.1|  MULTISPECIES: xylose isomerase                     217   6e-64    
ref|WP_007415126.1|  xylose isomerase                                   217   6e-64    
sp|P30435.1|XYLA_THESA  RecName: Full=Xylose isomerase                  217   6e-64    
ref|WP_034748529.1|  xylose isomerase                                   217   6e-64    
ref|WP_021896825.1|  xylose isomerase                                   217   7e-64    
ref|WP_026990078.1|  xylose isomerase                                   217   7e-64    
ref|WP_011997245.1|  xylose isomerase                                   217   7e-64    
ref|WP_036606941.1|  MULTISPECIES: xylose isomerase                     217   7e-64    
ref|WP_044644489.1|  xylose isomerase                                   217   7e-64    
ref|WP_019678379.1|  xylose isomerase                                   217   7e-64    
ref|WP_012374578.1|  xylose isomerase                                   217   8e-64    
ref|WP_006978554.1|  xylose isomerase                                   217   8e-64    
ref|WP_024063558.1|  xylose isomerase                                   217   8e-64    
gb|ABX77269.1|  xylose isomerase                                        216   8e-64    
ref|WP_029828866.1|  xylose isomerase                                   211   8e-64    
ref|WP_012896352.1|  xylose isomerase                                   217   8e-64    
ref|WP_012199251.1|  xylose isomerase                                   216   8e-64    
ref|WP_027073399.1|  xylose isomerase                                   217   8e-64    
gb|KHC94878.1|  xylose isomerase                                        217   8e-64    
ref|WP_038033066.1|  MULTISPECIES: xylose isomerase                     217   9e-64    
ref|WP_025381905.1|  xylose isomerase                                   216   9e-64    
ref|WP_039279877.1|  xylose isomerase                                   216   9e-64    
ref|WP_013788885.1|  xylose isomerase                                   216   9e-64    
ref|WP_028520139.1|  xylose isomerase                                   216   9e-64    
ref|WP_004290957.1|  MULTISPECIES: xylose isomerase                     216   9e-64    
ref|WP_000904406.1|  xylose isomerase                                   209   9e-64    
ref|WP_018887275.1|  MULTISPECIES: xylose isomerase                     216   1e-63    
ref|WP_015907182.1|  xylose isomerase                                   216   1e-63    
ref|WP_039463449.1|  xylose isomerase                                   216   1e-63    
ref|WP_023976124.1|  MULTISPECIES: xylose isomerase                     216   1e-63    
ref|WP_028668460.1|  xylose isomerase                                   216   1e-63    
ref|WP_036676605.1|  xylose isomerase                                   216   1e-63    
ref|WP_026887251.1|  xylose isomerase                                   216   1e-63    
ref|WP_025423857.1|  xylose isomerase                                   216   1e-63    
pdb|1A0E|A  Chain A, Xylose Isomerase From Thermotoga Neapolitana       216   1e-63    
ref|WP_010040427.1|  xylose isomerase                                   216   1e-63    
ref|WP_015919215.1|  MULTISPECIES: xylose isomerase                     216   1e-63    
ref|WP_013622653.1|  xylose isomerase                                   216   1e-63    
ref|WP_032233807.1|  xylose isomerase                                   210   1e-63    
ref|WP_015846708.1|  xylose isomerase                                   216   1e-63    
ref|WP_033164816.1|  xylose isomerase                                   216   2e-63    
ref|WP_017173630.1|  xylose isomerase                                   208   2e-63    
ref|WP_002560285.1|  MULTISPECIES: xylose isomerase                     216   2e-63    
ref|WP_025680737.1|  xylose isomerase                                   216   2e-63    
ref|WP_044825629.1|  xylose isomerase                                   216   2e-63    
ref|WP_036643496.1|  xylose isomerase                                   216   2e-63    
ref|WP_029192355.1|  xylose isomerase                                   216   2e-63    
ref|WP_006212727.1|  xylose isomerase                                   216   2e-63    
gb|KEQ26959.1|  xylose isomerase                                        216   2e-63    
ref|WP_018199100.1|  hypothetical protein                               216   2e-63    
gb|EGD17061.1|  xylose isomerase                                        212   2e-63    
ref|WP_023563217.1|  xylose isomerase                                   210   2e-63    
ref|WP_013403911.1|  xylose isomerase                                   216   2e-63    
ref|WP_015068489.1|  xylose isomerase                                   216   2e-63    
ref|WP_043091886.1|  xylose isomerase                                   216   2e-63    
ref|WP_006569355.1|  xylose isomerase                                   216   2e-63    
ref|WP_043910707.1|  xylose isomerase                                   211   2e-63    
ref|WP_040373941.1|  xylose isomerase                                   216   2e-63    
ref|WP_025845578.1|  xylose isomerase                                   215   2e-63    
ref|WP_010754998.1|  xylose isomerase                                   215   3e-63    
ref|WP_019183279.1|  xylose isomerase                                   216   3e-63    
ref|WP_012439637.1|  xylose isomerase                                   216   3e-63    
ref|WP_007806216.1|  xylose isomerase                                   215   3e-63    
ref|WP_010664371.1|  xylose isomerase                                   215   3e-63    
ref|WP_003128196.1|  xylose isomerase                                   215   3e-63    
ref|WP_006037628.1|  xylose isomerase                                   215   3e-63    
ref|WP_044704476.1|  xylose isomerase                                   209   3e-63    
ref|WP_010519961.1|  xylose isomerase                                   215   3e-63    
ref|WP_027431549.1|  xylose isomerase                                   215   3e-63    
ref|WP_014913698.1|  xylose isomerase                                   215   3e-63    
ref|WP_015358602.1|  MULTISPECIES: xylose isomerase XylA                215   3e-63    
ref|WP_014509528.1|  xylose isomerase                                   215   3e-63    
ref|WP_021013961.1|  Xylose isomerase                                   215   3e-63    
ref|WP_039413113.1|  xylose isomerase                                   209   4e-63    
ref|WP_018381088.1|  xylose isomerase                                   215   4e-63    
ref|WP_014507520.1|  xylose isomerase                                   215   4e-63    
ref|WP_014278132.1|  xylose isomerase                                   215   4e-63    
gb|KHI92157.1|  xylose isomerase                                        209   4e-63    
sp|Q9KGU2.1|XYLA_THEYO  RecName: Full=Xylose isomerase                  215   4e-63    
ref|WP_011943656.1|  xylose isomerase                                   215   4e-63    
ref|WP_015842241.1|  xylose isomerase                                   215   4e-63    
gb|AGU12289.1|  Xylose isomerase-like TIM barrel                        215   4e-63    
ref|WP_042165947.1|  xylose isomerase                                   215   4e-63    
ref|WP_042131068.1|  MULTISPECIES: xylose isomerase                     215   4e-63    
ref|WP_004082185.1|  MULTISPECIES: xylose isomerase                     215   4e-63    
ref|WP_042598928.1|  xylose isomerase                                   215   4e-63    
ref|WP_040648148.1|  xylose isomerase                                   215   4e-63    
ref|WP_013311966.1|  MULTISPECIES: xylose isomerase                     215   5e-63    
ref|WP_029683770.1|  xylose isomerase                                   215   5e-63    
ref|WP_040043960.1|  xylose isomerase                                   215   5e-63    
ref|WP_039273722.1|  xylose isomerase                                   214   5e-63    
ref|WP_023990311.1|  xylose isomerase                                   214   5e-63    
ref|WP_039444927.1|  xylose isomerase                                   211   5e-63    
ref|WP_012310984.1|  xylose isomerase                                   215   5e-63    
emb|CDK79554.1|  Xylose isomerase                                       208   5e-63    
ref|WP_016905129.1|  xylose isomerase                                   212   5e-63    
ref|WP_039284980.1|  xylose isomerase                                   214   5e-63    
ref|WP_039490220.1|  xylose isomerase                                   214   6e-63    
ref|WP_038698780.1|  xylose isomerase                                   214   6e-63    
ref|WP_025235120.1|  xylose isomerase                                   214   6e-63    
ref|WP_039521824.1|  xylose isomerase                                   214   6e-63    
ref|WP_018972597.1|  xylose isomerase                                   214   6e-63    
ref|WP_034688673.1|  xylose isomerase                                   214   6e-63    
ref|WP_015028484.1|  xylose isomerase                                   214   7e-63    
ref|WP_022421525.1|  xylose isomerase                                   214   7e-63    
ref|WP_008907517.1|  xylose isomerase                                   214   7e-63    
ref|WP_017117936.1|  xylose isomerase                                   211   7e-63    
ref|WP_042834224.1|  xylose isomerase                                   214   7e-63    
gb|ERJ95007.1|  xylose isomerase                                        215   7e-63    
ref|WP_035145587.1|  xylose isomerase                                   214   7e-63    
ref|WP_039425623.1|  xylose isomerase                                   209   8e-63    
ref|WP_039510331.1|  xylose isomerase                                   214   8e-63    
ref|WP_039419410.1|  xylose isomerase                                   211   8e-63    
ref|WP_042595851.1|  xylose isomerase                                   214   8e-63    
ref|WP_019381289.1|  xylose isomerase                                   214   8e-63    
ref|WP_009334243.1|  xylose isomerase                                   214   8e-63    
ref|WP_002322669.1|  xylose isomerase                                   214   8e-63    
ref|WP_016820313.1|  MULTISPECIES: xylose isomerase                     214   8e-63    
ref|WP_029764725.1|  xylose isomerase                                   210   8e-63    
ref|WP_025684083.1|  xylose isomerase                                   214   8e-63    
ref|WP_031462245.1|  xylose isomerase                                   214   8e-63    
ref|WP_005931926.1|  MULTISPECIES: xylose isomerase                     214   8e-63    
ref|WP_017173982.1|  xylose isomerase                                   206   9e-63    
ref|WP_039316685.1|  xylose isomerase                                   214   9e-63    
ref|WP_007432158.1|  xylose isomerase                                   214   9e-63    
ref|WP_010284187.1|  xylose isomerase                                   214   9e-63    
ref|WP_038052482.1|  xylose isomerase                                   214   9e-63    
ref|WP_003869013.1|  MULTISPECIES: xylose isomerase                     214   9e-63    
ref|WP_036680248.1|  MULTISPECIES: xylose isomerase                     214   9e-63    
ref|WP_013373089.1|  xylose isomerase                                   214   9e-63    
ref|WP_042826898.1|  xylose isomerase                                   210   1e-62    
ref|WP_025365846.1|  xylose isomerase                                   214   1e-62    
ref|WP_011091740.1|  xylose isomerase                                   214   1e-62    
gb|KGU38312.1|  xylose isomerase                                        210   1e-62    
ref|WP_019005667.1|  xylose isomerase                                   214   1e-62    
ref|WP_042525629.1|  xylose isomerase                                   214   1e-62    
gb|KGU38414.1|  xylose isomerase                                        206   1e-62    
ref|WP_013928648.1|  xylose isomerase                                   214   1e-62    
emb|CDZ23165.1|  Xylose isomerase [ [                                   214   1e-62    
pdb|1A0C|A  Chain A, Xylose Isomerase From Thermoanaerobacterium ...    214   1e-62    
ref|WP_039483227.1|  xylose isomerase                                   214   1e-62    
sp|P19148.1|XYLA_THETU  RecName: Full=Xylose isomerase                  214   1e-62    
ref|WP_029519214.1|  xylose isomerase                                   213   1e-62    
ref|WP_044745389.1|  xylose isomerase                                   214   1e-62    
ref|WP_026672598.1|  xylose isomerase                                   214   1e-62    
ref|WP_012994345.1|  MULTISPECIES: xylose isomerase                     213   1e-62    
ref|WP_009110894.1|  xylose isomerase                                   213   1e-62    
ref|WP_014951354.1|  xylose isomerase                                   213   1e-62    
ref|WP_034838066.1|  xylose isomerase [                                 213   1e-62    
ref|WP_010774172.1|  xylose isomerase                                   213   2e-62    
ref|WP_019113753.1|  hypothetical protein                               213   2e-62    
ref|WP_040102865.1|  xylose isomerase                                   213   2e-62    
ref|WP_020151227.1|  hypothetical protein                               213   2e-62    
ref|WP_019110396.1|  hypothetical protein                               213   2e-62    
ref|WP_023520550.1|  xylose isomerase                                   213   2e-62    
ref|WP_010344658.1|  xylose isomerase                                   213   2e-62    
ref|WP_002364888.1|  xylose isomerase                                   213   2e-62    
ref|WP_013970119.1|  xylose isomerase                                   213   2e-62    
ref|WP_013570854.1|  MULTISPECIES: xylose isomerase                     213   2e-62    
ref|WP_002358555.1|  xylose isomerase                                   213   2e-62    
ref|WP_002382853.1|  xylose isomerase                                   213   2e-62    
ref|WP_039508364.1|  xylose isomerase                                   213   2e-62    
ref|WP_018479480.1|  xylose isomerase                                   213   2e-62    
ref|WP_002425670.1|  xylose isomerase                                   213   2e-62    
ref|WP_002363086.1|  xylose isomerase                                   213   2e-62    
ref|WP_035660183.1|  xylose isomerase                                   213   2e-62    
ref|WP_026313111.1|  xylose isomerase                                   213   2e-62    
ref|WP_039501790.1|  xylose isomerase                                   213   2e-62    
ref|WP_019669017.1|  xylose isomerase                                   213   2e-62    
ref|WP_017160614.1|  xylose isomerase                                   211   2e-62    
ref|WP_022825466.1|  xylose isomerase                                   213   2e-62    
ref|WP_011036932.1|  xylose isomerase                                   213   2e-62    
ref|WP_028974176.1|  xylose isomerase                                   213   2e-62    
ref|WP_009051955.1|  MULTISPECIES: xylose isomerase                     213   2e-62    
ref|WP_013203314.1|  xylose isomerase                                   213   2e-62    
ref|WP_023966056.1|  xylose isomerase                                   213   2e-62    
ref|WP_003868244.1|  xylose isomerase                                   213   2e-62    
gb|EGM59330.1|  xylA domain protein                                     206   3e-62    
ref|WP_034928100.1|  xylose isomerase                                   213   3e-62    
ref|WP_024722974.1|  xylose isomerase                                   213   3e-62    
ref|WP_035146022.1|  xylose isomerase                                   213   3e-62    
ref|WP_012914629.1|  xylose isomerase                                   213   3e-62    
ref|WP_039474499.1|  xylose isomerase                                   213   3e-62    
ref|WP_010179490.1|  xylose isomerase                                   213   3e-62    
ref|WP_011039169.1|  xylose isomerase                                   213   3e-62    
gb|KJG71987.1|  xylose isomerase                                        206   3e-62    
ref|WP_010528781.1|  xylose isomerase                                   213   3e-62    
ref|WP_040032255.1|  xylose isomerase                                   213   3e-62    
ref|WP_039533067.1|  xylose isomerase                                   213   3e-62    
ref|WP_013711744.1|  xylose isomerase                                   213   3e-62    
ref|WP_022049791.1|  xylose isomerase                                   213   3e-62    
ref|WP_039546353.1|  xylose isomerase                                   213   3e-62    
ref|WP_039550240.1|  xylose isomerase                                   213   3e-62    
ref|WP_029820765.1|  xylose isomerase                                   213   3e-62    
ref|WP_010296596.1|  xylose isomerase                                   213   3e-62    
ref|WP_019238122.1|  xylose isomerase                                   213   4e-62    
ref|WP_042243058.1|  xylose isomerase                                   213   4e-62    
gb|AAC46145.1|  xylose isomerase                                        213   4e-62    
emb|CDK78581.1|  Xylose isomerase                                       209   4e-62    
ref|WP_041883538.1|  xylose isomerase                                   213   4e-62    
ref|WP_029688173.1|  xylose isomerase                                   212   4e-62    
ref|WP_044637928.1|  xylose isomerase                                   212   4e-62    
ref|WP_025216446.1|  xylose isomerase                                   212   4e-62    
ref|WP_016775947.1|  xylose isomerase                                   212   4e-62    
ref|WP_025608026.1|  xylose isomerase                                   212   4e-62    
ref|WP_005470141.1|  xylose isomerase                                   212   4e-62    



>gb|EYU42442.1| hypothetical protein MIMGU_mgv1a0056111mg, partial [Erythranthe 
guttata]
 gb|EYU42443.1| hypothetical protein MIMGU_mgv1a0056111mg, partial [Erythranthe 
guttata]
Length=261

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLIDEFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  61   QEPTKHQYDWDAATSANFLRKYGLIDEFKLNIECNHATLSGHSCHHEIETARINGLLGNI  120

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MDV EATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  121  DANTGDPQIGWDTDQFMMDVGEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  180

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRYQSFD+ELGA IE GK DF++LEKKA+EW
Sbjct  181  HIAGMDTLARGLRNAAKLIEDGSLDELVRKRYQSFDTELGAQIEAGKTDFDVLEKKAIEW  240

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  241  GEPKVASAKQELAEMIFQSAL  261



>emb|CDP02939.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   379 bits (972),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLIDEFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  278  QEPTKHQYDWDAATSANFLRKYGLIDEFKLNIECNHATLSGHSCHHELETARINGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQTGWDTDQF MD+ EATLVMLSVI+NGGLAPGGFNFDAKLRRESTDVED+FI 
Sbjct  338  DANSGDPQTGWDTDQFLMDIQEATLVMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIG  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL E++RKRYQSFDSELGA IE GKADFELLEKKA EW
Sbjct  398  HIAGMDTLARGLRNAAKLIEDGSLDEIIRKRYQSFDSELGAQIEAGKADFELLEKKAKEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMILQ+AL
Sbjct  458  GEPKVPSAKQELAEMILQAAL  478



>ref|XP_002532409.1| Xylose isomerase, putative [Ricinus communis]
 gb|EEF29973.1| Xylose isomerase, putative [Ricinus communis]
Length=477

 Score =   379 bits (972),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHSCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM+SVI+NGGLAPGGFNFDAKLRRESTDVEDIFIA
Sbjct  337  DANTGDPQIGWDTDQFMTDIAEATLVMMSVIRNGGLAPGGFNFDAKLRRESTDVEDIFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+AAKLIEDGSL ELVRKRY+SFD+E+GA IE GKADFE+LEKKA+EW
Sbjct  397  HIGGMDTLARGLRNAAKLIEDGSLAELVRKRYESFDTEIGAQIEAGKADFEMLEKKAIEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  457  GEPKVPSAKQELAEMIFQSAL  477



>ref|XP_006343543.1| PREDICTED: xylose isomerase-like [Solanum tuberosum]
Length=481

 Score =   378 bits (970),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATL+GHSCHHE+ETARINGLLGNI
Sbjct  281  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLAGHSCHHELETARINGLLGNI  340

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQ GWDTDQF MDVAEATLVM +VIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  341  DANSGDPQIGWDTDQFLMDVAEATLVMQTVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  400

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL +LVRKRYQSFDSELGAAIE GKADFELLEKKALEW
Sbjct  401  HIAGMDTLARGLRNAAKLIEDGSLSDLVRKRYQSFDSELGAAIESGKADFELLEKKALEW  460

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  461  GEPKVPSGKQELAEMIFQSAL  481



>ref|XP_009801815.1| PREDICTED: xylose isomerase [Nicotiana sylvestris]
Length=481

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATL+GHSCHHE+ETARINGLLGNI
Sbjct  281  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLAGHSCHHELETARINGLLGNI  340

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MDVAEATLVM +VIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  341  DANTGDPQVGWDTDQFLMDVAEATLVMQTVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  400

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRYQSFD+ELGAAIE GKADFELLEKKALEW
Sbjct  401  HIAGMDTLARGLRNAAKLIEDGSLGELVRKRYQSFDTELGAAIEAGKADFELLEKKALEW  460

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  461  GEPKVPSGKQELAEMIFQSAL  481



>ref|XP_011079316.1| PREDICTED: xylose isomerase [Sesamum indicum]
 ref|XP_011079317.1| PREDICTED: xylose isomerase [Sesamum indicum]
Length=477

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHSCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MDV EATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDPQIGWDTDQFMMDVGEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRYQSFDSELGA IE GKADFE+LEKKA+ W
Sbjct  397  HIAGMDTLARGLRNAAKLIEDGSLSELVRKRYQSFDSELGAEIEAGKADFEVLEKKAIAW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  457  GEPKVASAKQELAEMIFQSAL  477



>ref|XP_009606829.1| PREDICTED: xylose isomerase [Nicotiana tomentosiformis]
Length=481

 Score =   376 bits (965),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATL+GHSCHHE+ETARINGLLGNI
Sbjct  281  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLAGHSCHHELETARINGLLGNI  340

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MDVAEATLVM +VIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  341  DANTGDPQVGWDTDQFLMDVAEATLVMQTVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  400

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELV+KRYQSFD+ELGAAIE GKADFELLEKKALEW
Sbjct  401  HIAGMDTLARGLRNAAKLIEDGSLSELVKKRYQSFDTELGAAIEAGKADFELLEKKALEW  460

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  461  GEPKVPSGKQELAEMIFQSAL  481



>gb|EYU34279.1| hypothetical protein MIMGU_mgv1a005575mg [Erythranthe guttata]
Length=478

 Score =   376 bits (965),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  278  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHSCHHELETARINGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MDV EATLVML+V+KNGG+APGGFNFDAKLRRESTDVEDIFIA
Sbjct  338  DANTGDPQIGWDTDQFMMDVGEATLVMLTVVKNGGIAPGGFNFDAKLRRESTDVEDIFIA  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRYQSFDSELGA IE GKADFE+LEKKA EW
Sbjct  398  HIAGMDTLARGLRNAAKLIEDGSLNELVRKRYQSFDSELGALIEAGKADFEMLEKKAKEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  458  GEPKVASAKQELAEMIFQSAL  478



>ref|XP_004242672.1| PREDICTED: xylose isomerase [Solanum lycopersicum]
Length=481

 Score =   375 bits (964),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATL+GHSCHHE+ETARINGLLGNI
Sbjct  281  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLAGHSCHHELETARINGLLGNI  340

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQ GWDTDQF MDVAEATLVM +VIKNGGLAPGGFNFDAKLRRESTD+EDIFIA
Sbjct  341  DANSGDPQIGWDTDQFLMDVAEATLVMQTVIKNGGLAPGGFNFDAKLRRESTDIEDIFIA  400

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIE+GSL +LVRKRYQSFDSELG+AIE GKADFELLEKKALEW
Sbjct  401  HIAGMDTLARGLRNAAKLIEEGSLNDLVRKRYQSFDSELGSAIESGKADFELLEKKALEW  460

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  461  GEPKVPSGKQELAEMIFQSAL  481



>ref|XP_010688509.1| PREDICTED: xylose isomerase isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFLRK GLIDEFKLNIECNHATLSGHSCHH++ETARINGLLGNI
Sbjct  286  QEPTKHQYDWDAATTTNFLRKYGLIDEFKLNIECNHATLSGHSCHHDLETARINGLLGNI  345

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQTGWDTDQF  D+AEAT+VMLSVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  346  DANSGDPQTGWDTDQFMTDIAEATMVMLSVIKNGGMAPGGFNFDAKLRRESTDVEDLFIA  405

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            H+ GMDT+ARGLR+AAKLIEDGSL ELV+KRYQSFDSE+GA IE GKADFE LEKKA+EW
Sbjct  406  HVSGMDTMARGLRNAAKLIEDGSLGELVKKRYQSFDSEIGAKIEAGKADFEYLEKKAIEW  465

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  466  GEPKVPSGKQELAEMIFQSAL  486



>ref|XP_010688511.1| PREDICTED: xylose isomerase isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFLRK GLIDEFKLNIECNHATLSGHSCHH++ETARINGLLGNI
Sbjct  275  QEPTKHQYDWDAATTTNFLRKYGLIDEFKLNIECNHATLSGHSCHHDLETARINGLLGNI  334

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQTGWDTDQF  D+AEAT+VMLSVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  335  DANSGDPQTGWDTDQFMTDIAEATMVMLSVIKNGGMAPGGFNFDAKLRRESTDVEDLFIA  394

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            H+ GMDT+ARGLR+AAKLIEDGSL ELV+KRYQSFDSE+GA IE GKADFE LEKKA+EW
Sbjct  395  HVSGMDTMARGLRNAAKLIEDGSLGELVKKRYQSFDSEIGAKIEAGKADFEYLEKKAIEW  454

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  455  GEPKVPSGKQELAEMIFQSAL  475



>gb|KDP43806.1| hypothetical protein JCGZ_23014 [Jatropha curcas]
Length=477

 Score =   372 bits (956),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VMLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDPQIGWDTDQFLTDIAEATMVMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+AA+LIEDGSL ELVRKRYQSFD+E+GA IE GKADFE LEKKA EW
Sbjct  397  HIGGMDTLARGLRNAARLIEDGSLAELVRKRYQSFDTEIGAQIEAGKADFETLEKKAFEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  457  GEPKVPSAKQELAEMIFQSAL  477



>ref|XP_010688508.1| PREDICTED: xylose isomerase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   374 bits (960),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFLRK GLIDEFKLNIECNHATLSGHSCHH++ETARINGLLGNI
Sbjct  317  QEPTKHQYDWDAATTTNFLRKYGLIDEFKLNIECNHATLSGHSCHHDLETARINGLLGNI  376

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQTGWDTDQF  D+AEAT+VMLSVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  377  DANSGDPQTGWDTDQFMTDIAEATMVMLSVIKNGGMAPGGFNFDAKLRRESTDVEDLFIA  436

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            H+ GMDT+ARGLR+AAKLIEDGSL ELV+KRYQSFDSE+GA IE GKADFE LEKKA+EW
Sbjct  437  HVSGMDTMARGLRNAAKLIEDGSLGELVKKRYQSFDSEIGAKIEAGKADFEYLEKKAIEW  496

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPS KQELAEMI QSAL
Sbjct  497  GEPKVPSGKQELAEMIFQSAL  517



>ref|XP_002277520.2| PREDICTED: xylose isomerase [Vitis vinifera]
 ref|XP_010656801.1| PREDICTED: xylose isomerase [Vitis vinifera]
Length=478

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETAR+NGLLGNI
Sbjct  278  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FI+
Sbjct  338  DANTGDPQIGWDTDQFLTDIAEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIS  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL+ LVRKRYQSFD+E+GA IE GKADFE+LEKKA+EW
Sbjct  398  HISGMDTLARGLRNVAKLIEDGSLENLVRKRYQSFDTEIGAQIEAGKADFEMLEKKAMEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  458  GEPKVPSAKQELAEMIFQSAL  478



>gb|KGN61107.1| hypothetical protein Csa_2G049960 [Cucumis sativus]
Length=476

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLIDEF+LNIECNH TLSGHSCHH++ETAR+NG+LG+I
Sbjct  276  QEPTKHQYDWDAATSANFLRKYGLIDEFQLNIECNHVTLSGHSCHHDLETARLNGILGSI  335

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  336  DANTGDPQVGWDTDQFMTDIAEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIA  395

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+ AKL+EDGSL ELVRKRY+SFD+E+GA IE GKADFE LEKKALEW
Sbjct  396  HIGGMDTLARGLRNVAKLLEDGSLTELVRKRYESFDTEIGAQIEAGKADFEFLEKKALEW  455

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  456  GEPKVPSAKQELAEMIFQSAL  476



>emb|CBI17768.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETAR+NGLLGNI
Sbjct  326  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNI  385

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FI+
Sbjct  386  DANTGDPQIGWDTDQFLTDIAEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIS  445

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL+ LVRKRYQSFD+E+GA IE GKADFE+LEKKA+EW
Sbjct  446  HISGMDTLARGLRNVAKLIEDGSLENLVRKRYQSFDTEIGAQIEAGKADFEMLEKKAMEW  505

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  506  GEPKVPSAKQELAEMIFQSAL  526



>ref|XP_004149070.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
 ref|XP_004166789.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
Length=476

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLIDEF+LNIECNH TLSGHSCHH++ETAR+NG+LG+I
Sbjct  276  QEPTKHQYDWDAATSANFLRKYGLIDEFQLNIECNHVTLSGHSCHHDLETARLNGILGSI  335

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  336  DANTGDPQVGWDTDQFMTDIAEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIA  395

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+ AKL+EDGSL ELVRKRY+SFD+E+GA IE GKADFE LEKKALEW
Sbjct  396  HIGGMDTLARGLRNVAKLLEDGSLTELVRKRYESFDTEIGAQIEAGKADFEFLEKKALEW  455

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  456  GEPKVPSAKQELAEMIFQSAL  476



>emb|CAN65150.1| hypothetical protein VITISV_037086 [Vitis vinifera]
Length=462

 Score =   367 bits (941),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETAR+NGLLGNI
Sbjct  262  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNI  321

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FI+
Sbjct  322  DANTGDPQIGWDTDQFLTDIAEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIS  381

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIED SL+ LVRKRYQSFD+E+GA IE GKADFE+LEKKA+EW
Sbjct  382  HISGMDTLARGLRNVAKLIEDXSLENLVRKRYQSFDTEIGAQIEAGKADFEMLEKKAMEW  441

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  442  GEPKVPSAKQELAEMIFQSAL  462



>ref|XP_008452100.1| PREDICTED: xylose isomerase [Cucumis melo]
 ref|XP_008452108.1| PREDICTED: xylose isomerase [Cucumis melo]
Length=476

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLID+F+LNIECNH TLSGHSCHH++ETAR+NG+LG+I
Sbjct  276  QEPTKHQYDWDAATSANFLRKYGLIDDFQLNIECNHVTLSGHSCHHDLETARLNGILGSI  335

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MD++EAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  336  DANTGDPQVGWDTDQFMMDLSEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIA  395

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+ AKL+EDGSL ELVRKRY+SFD+E+GA IE GKADFE LEKKALEW
Sbjct  396  HIGGMDTLARGLRNVAKLLEDGSLTELVRKRYESFDTEIGAQIEAGKADFEFLEKKALEW  455

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  456  GEPKVPSAKQELAEMIFQSAL  476



>ref|XP_011069881.1| PREDICTED: xylose isomerase-like [Sesamum indicum]
Length=475

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  275  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHSCHHELETARINGLLGNI  334

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF MDV+EATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA
Sbjct  335  DANTGDPQIGWDTDQFMMDVSEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  394

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKL+ DG L ELVR+RYQSFD+ELGA IE GK DF+LLEKKA+EW
Sbjct  395  HIAGMDTVARGLRNAAKLLADGLLSELVRQRYQSFDTELGAQIEAGKGDFDLLEKKAIEW  454

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V SAKQELAEMI QSAL
Sbjct  455  GEPTVASAKQELAEMIFQSAL  475



>ref|XP_006453438.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
 ref|XP_006474142.1| PREDICTED: xylose isomerase-like [Citrus sinensis]
 gb|ESR66678.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
Length=478

 Score =   366 bits (939),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI++FKLNIECNHATLSGHSCHH++ETAR+NGLLGNI
Sbjct  278  QEPTKHQYDWDAATAANFLRKYGLINDFKLNIECNHATLSGHSCHHDIETARLNGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EAT +MLSVIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  338  DANTGDPQVGWDTDQFLTDIGEATSIMLSVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQSFDSE+G  IE GKADFE+LEKKA+EW
Sbjct  398  HIVGMDTVARGLRTAAKLIEDGSLPELVRKRYQSFDSEIGQKIEAGKADFEMLEKKAMEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  458  GEPKVPSAKQELAEMIFQSAI  478



>ref|XP_003549495.1| PREDICTED: xylose isomerase [Glycine max]
Length=480

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GL  EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDAATSANFLRKYGLTGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EATL+MLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  340  DANTGDPQVGWDTDQFLVDIQEATLIMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRYQSFD+E+GA IE GKADFELLEKK  EW
Sbjct  400  HIVGMDTLARGLRNAAKLIEDGSLAELVRKRYQSFDTEIGAQIEAGKADFELLEKKVKEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMILQS L
Sbjct  460  GEPKVASAKQELAEMILQSVL  480



>gb|KDO62435.1| hypothetical protein CISIN_1g0373932mg, partial [Citrus sinensis]
Length=487

 Score =   366 bits (939),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI++FKLNIECNHATLSGHSCHH++ETAR+NGLLGNI
Sbjct  287  QEPTKHQYDWDAATAANFLRKYGLINDFKLNIECNHATLSGHSCHHDIETARLNGLLGNI  346

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EAT +MLSVIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  347  DANTGDPQVGWDTDQFLTDIGEATSIMLSVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  406

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQSFDSE+G  IE GKADFE+LEKKA+EW
Sbjct  407  HIVGMDTVARGLRTAAKLIEDGSLPELVRKRYQSFDSEIGQKIEAGKADFEMLEKKAMEW  466

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  467  GEPKVPSAKQELAEMIFQSAI  487



>ref|XP_011018165.1| PREDICTED: xylose isomerase [Populus euphratica]
 ref|XP_011018166.1| PREDICTED: xylose isomerase [Populus euphratica]
Length=477

 Score =   365 bits (938),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D++EAT+VMLSVI+NGGLAPGGFNFDAKLRREST+VEDIF+A
Sbjct  337  DANTGDPQIGWDTDQFMTDISEATMVMLSVIRNGGLAPGGFNFDAKLRRESTEVEDIFLA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLRSAAKLI+DGSL ELVRKRYQSFD+E+GA +E GK DFE LEK A++W
Sbjct  397  HISGMDTLARGLRSAAKLIQDGSLAELVRKRYQSFDTEIGAQVEAGKGDFETLEKLAMKW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  457  GEPKVPSAKQELAEMIFQSAL  477



>gb|KHN17567.1| Xylose isomerase [Glycine soja]
Length=480

 Score =   365 bits (937),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GL  EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDAATSANFLRKYGLTGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EATL+MLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  340  DANTGDPQVGWDTDQFLVDIQEATLIMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRYQSFD+E+GA IE GKADFELLEKK  EW
Sbjct  400  HIVGMDTLARGLRNAAKLIEDGSLAELVRKRYQSFDTEIGAQIEAGKADFELLEKKVKEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMILQS L
Sbjct  460  GEPKVASAKQELAEMILQSVL  480



>ref|XP_002324488.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
 gb|EEF03053.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
Length=477

 Score =   365 bits (936),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D++EAT+VM+SVI+NGGLAPGGFNFDAKLRREST+VEDIF+A
Sbjct  337  DANTGDPQIGWDTDQFMTDISEATMVMISVIRNGGLAPGGFNFDAKLRRESTEVEDIFLA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLRSAAKLI+DGSL ELVRKRYQSFD+E+GA IE GK DFE LEK A++W
Sbjct  397  HISGMDTLARGLRSAAKLIQDGSLAELVRKRYQSFDTEIGAQIEAGKGDFETLEKLAMKW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  457  GEPKVPSAKQELAEMIFQSAL  477



>ref|XP_008223675.1| PREDICTED: xylose isomerase [Prunus mume]
Length=479

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETAR+NGLLGNI
Sbjct  279  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQTGWDTDQF  D+AEATLVML+V+KNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQTGWDTDQFLTDIAEATLVMLTVVKNGGIAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+  KLIEDGSL ELVRKRY+SFD+E+GA IE GK DFE LEKKA+EW
Sbjct  399  HISGMDTLARGLRNVVKLIEDGSLDELVRKRYESFDTEIGAHIEAGKGDFEYLEKKAIEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEM+ QS L
Sbjct  459  GEPKVPSAKQELAEMLFQSVL  479



>gb|ACJ84879.1| unknown [Medicago truncatula]
Length=329

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  129  QEPTKHQYDWDAATAANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  188

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDT+QF +D+ EAT++MLSVI+NGG+APGGFNFD KLRRESTDVED+FIA
Sbjct  189  DANTGDPQVGWDTNQFLVDIQEATMIMLSVIRNGGIAPGGFNFDVKLRRESTDVEDLFIA  248

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQSFD+E+GA IE GKADF+ LEKK  EW
Sbjct  249  HIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQSFDTEIGAQIEAGKADFDFLEKKVKEW  308

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI Q+A+
Sbjct  309  GEPKVASAKQELAEMIFQNAM  329



>ref|XP_007222807.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
 gb|EMJ24006.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
Length=479

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETAR+NGLLGNI
Sbjct  279  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARLNGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQTGWDTDQF  D+AEATLVML+V+KNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQTGWDTDQFLTDIAEATLVMLTVVKNGGIAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+  KLIEDGSL ELVRKRY+SFD+E+GA IE GK DFE LEKKA+EW
Sbjct  399  HISGMDTLARGLRNVVKLIEDGSLDELVRKRYESFDTEIGAHIEAGKGDFEYLEKKAIEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP+VPSAKQELAEM+ QS L
Sbjct  459  GEPRVPSAKQELAEMLFQSVL  479



>dbj|BAD95103.1| xylose isomerase [Arabidopsis thaliana]
Length=233

 Score =   353 bits (906),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  33   QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARINGLLGNI  92

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  93   DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  152

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY ++DSELG  IE GKADFE LEKKA E+
Sbjct  153  HISGMDTMARGLRNAVKILEEGSLSELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEF  212

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  213  GEPKVSSAKQELAEMIFQSAM  233



>gb|KHG02217.1| Xylose isomerase -like protein [Gossypium arboreum]
Length=475

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFLRK GL+ EFKLNIECNHATLSGHSCHH++ETARING+LGNI
Sbjct  275  QEPTKHQYDWDAATTLNFLRKYGLLAEFKLNIECNHATLSGHSCHHDLETARINGMLGNI  334

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  DV EAT+VM+SVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  335  DANTGDPQVGWDTDQFLTDVGEATMVMISVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  394

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELV KRY SFD+ELGA IE GKADFE+LEKKA+EW
Sbjct  395  HISGMDTLARGLRNAAKLIEDGSLAELVSKRYSSFDTELGAQIEAGKADFEMLEKKAMEW  454

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  455  GEPKVASAKQELAEMIFQSAL  475



>ref|XP_007011128.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
 gb|EOY19938.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
Length=471

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GL+ EFKLNIECNHATLSGHSCHH++ETARINGLLGNI
Sbjct  271  QEPTKHQYDWDAATTANFLRKYGLLGEFKLNIECNHATLSGHSCHHDLETARINGLLGNI  330

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EAT+VMLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  331  DANTGDPQIGWDTDQFMTDIGEATMVMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  390

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRY SFD+E+GA IE GKADFE+LEK A EW
Sbjct  391  HISGMDTLARGLRNAAKLIEDGSLVELVRKRYSSFDTEIGAEIEAGKADFEMLEKLAKEW  450

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  451  GEPKVASAKQELAEMIFQSAL  471



>ref|XP_010102992.1| Xylose isomerase [Morus notabilis]
 gb|EXB94559.1| Xylose isomerase [Morus notabilis]
Length=482

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATL+GHSCHHE+ETAR+N LLGNI
Sbjct  282  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLAGHSCHHELETARLNDLLGNI  341

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VM SV+KNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  342  DANTGDPQIGWDTDQFLTDIAEATMVMQSVVKNGGLAPGGFNFDAKLRRESTDVEDLFIA  401

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGL +AAK+IEDGSL ELVRKRY SFD+ELGA IE GKADFELLEKKAL+W
Sbjct  402  HISGMDTLARGLCNAAKIIEDGSLAELVRKRYASFDTELGALIETGKADFELLEKKALQW  461

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  462  GEPKVPSAKQELAEMIFQSAL  482



>ref|XP_009348411.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATLSGHSC+HE+ETAR+NGLLGN+
Sbjct  277  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHSCYHELETARLNGLLGNV  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQTGWDTDQF  D+AEATLVM SV+KNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDPQTGWDTDQFLTDIAEATLVMQSVVKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+ AKL+EDGSL +LVRKRY+SFD+E+GA IE GKADFE LEKKA+EW
Sbjct  397  HIGGMDTLARGLRNVAKLVEDGSLPDLVRKRYKSFDTEVGALIEAGKADFEYLEKKAIEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPSAKQELAEM+ QS L
Sbjct  457  GEPTVPSAKQELAEMLFQSVL  477



>ref|XP_010102993.1| Xylose isomerase [Morus notabilis]
 gb|EXB94560.1| Xylose isomerase [Morus notabilis]
Length=523

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GLI EFKLNIECNHATL+GHSCHHE+ETAR+N LLGNI
Sbjct  323  QEPTKHQYDWDAATTANFLRKYGLIGEFKLNIECNHATLAGHSCHHELETARLNDLLGNI  382

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEAT+VM SV+KNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  383  DANTGDPQIGWDTDQFLTDIAEATMVMQSVVKNGGLAPGGFNFDAKLRRESTDVEDLFIA  442

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGL +AAK+IEDGSL ELVRKRY SFD+ELGA IE GKADFELLEKKAL+W
Sbjct  443  HISGMDTLARGLCNAAKIIEDGSLAELVRKRYASFDTELGALIETGKADFELLEKKALQW  502

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  503  GEPKVPSAKQELAEMIFQSAL  523



>gb|KJB60240.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFL K GL+ EFKLNIECNHATLSGHSCHH++ETARING+LGNI
Sbjct  274  QEPTKHQYDWDAATTLNFLHKYGLLGEFKLNIECNHATLSGHSCHHDLETARINGMLGNI  333

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  DV EAT+VMLSVI+NGGLAPGGFNFDAKLRRES DVED+FIA
Sbjct  334  DANTGDPQVGWDTDQFLTDVGEATMVMLSVIRNGGLAPGGFNFDAKLRRESKDVEDLFIA  393

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRY SFD+ELGA IE GKADFE+LEKKA+EW
Sbjct  394  HISGMDTLARGLRNAAKLIEDGSLAELVRKRYSSFDTELGAQIEAGKADFEMLEKKAMEW  453

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  454  GEPKVASAKQELAEMIFQSAL  474



>gb|KJB60238.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
 gb|KJB60242.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=475

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFL K GL+ EFKLNIECNHATLSGHSCHH++ETARING+LGNI
Sbjct  275  QEPTKHQYDWDAATTLNFLHKYGLLGEFKLNIECNHATLSGHSCHHDLETARINGMLGNI  334

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  DV EAT+VMLSVI+NGGLAPGGFNFDAKLRRES DVED+FIA
Sbjct  335  DANTGDPQVGWDTDQFLTDVGEATMVMLSVIRNGGLAPGGFNFDAKLRRESKDVEDLFIA  394

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRY SFD+ELGA IE GKADFE+LEKKA+EW
Sbjct  395  HISGMDTLARGLRNAAKLIEDGSLAELVRKRYSSFDTELGAQIEAGKADFEMLEKKAMEW  454

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  455  GEPKVASAKQELAEMIFQSAL  475



>ref|XP_004507817.1| PREDICTED: xylose isomerase-like isoform X3 [Cicer arietinum]
Length=479

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GL  EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATTANFLRKYGLEGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EAT++MLSVI+N G+APGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDQFLVDIQEATMIMLSVIRNDGIAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQSFD+E+GA IE GKADF+LLEKKA EW
Sbjct  399  HIVGMDTMARGLRTAAKLIEDGSLAELVRKRYQSFDTEIGAQIEAGKADFDLLEKKAKEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  459  GEPKVASAKQELAEMIFQSAI  479



>ref|XP_007154797.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
 gb|ESW26791.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
Length=479

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GL  EFKLNIECNHATLSGHSC HE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATSANFLRKYGLAGEFKLNIECNHATLSGHSCQHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EATL+MLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDQFLVDIQEATLIMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLI+DGSL ELVRKRYQSFD+E+GA IE GKADFELLEKK  EW
Sbjct  399  HIVGMDTLARGLRNAAKLIKDGSLSELVRKRYQSFDTEIGAQIEAGKADFELLEKKVKEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V SAKQELAEMI QSAL
Sbjct  459  GEPTVASAKQELAEMIFQSAL  479



>ref|XP_009336656.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATLSGHSC+HE+ETAR+NGLLGN+
Sbjct  277  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHSCYHELETARLNGLLGNV  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQTGWDTDQF  D+AEATLVM SV+KNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDPQTGWDTDQFLTDIAEATLVMQSVVKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+ AKL+EDGSL +LVRKRY+SFD+E+GA IE GKADFE LEKKA+EW
Sbjct  397  HIGGMDTLARGLRNVAKLVEDGSLPDLVRKRYKSFDTEVGALIEAGKADFEYLEKKAIEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPSAKQELAEM  QS L
Sbjct  457  GEPTVPSAKQELAEMHFQSVL  477



>ref|XP_003610179.1| Xylose isomerase [Medicago truncatula]
Length=478

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  278  QEPTKHQYDWDAATAANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EAT++MLSVI+NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  338  DANTGDPQVGWDTDQFLVDIQEATMIMLSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIA  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQSFD+E+GA IE GKADF+ LEKK  EW
Sbjct  398  HIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQSFDTEIGAQIEAGKADFDFLEKKVKEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI Q+A+
Sbjct  458  GEPKVASAKQELAEMIFQNAM  478



>ref|XP_007011127.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY19937.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
Length=538

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GL+ EFKLNIECNHATLSGHSCHH++ETARINGLLGNI
Sbjct  338  QEPTKHQYDWDAATTANFLRKYGLLGEFKLNIECNHATLSGHSCHHDLETARINGLLGNI  397

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EAT+VMLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  398  DANTGDPQIGWDTDQFMTDIGEATMVMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  457

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRY SFD+E+GA IE GKADFE+LEK A EW
Sbjct  458  HISGMDTLARGLRNAAKLIEDGSLVELVRKRYSSFDTEIGAEIEAGKADFEMLEKLAKEW  517

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  518  GEPKVASAKQELAEMIFQSAL  538



>ref|XP_010259769.1| PREDICTED: xylose isomerase isoform X2 [Nelumbo nucifera]
Length=479

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTA FLRK  L  EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATTAGFLRKYNLSGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQIGWDTDQFLTDIGEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL ELVRKRY+SFD+E+GA IE GKADFE LE KA+EW
Sbjct  399  HITGMDTLARGLRNVAKLIEDGSLAELVRKRYESFDTEIGAQIEAGKADFEFLETKAMEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEM+ QSAL
Sbjct  459  GEPKVPSAKQELAEMVFQSAL  479



>ref|XP_008365436.1| PREDICTED: xylose isomerase-like [Malus domestica]
 ref|XP_008365437.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=477

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATLSGHSC+HE+ETAR+NGLLGN+
Sbjct  277  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHSCYHELETARLNGLLGNV  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQTGWDTDQF  D+AEATLVM SV+KNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDPQTGWDTDQFLTDIAEATLVMQSVVKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKL+EDGSL +LVRKRY+SFD+E+GA IE GKADFE LEKKA+EW
Sbjct  397  HISGMDTLARGLRNVAKLVEDGSLPDLVRKRYKSFDTEVGALIEAGKADFEYLEKKAIEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPSAKQELAEM+ QS L
Sbjct  457  GEPTVPSAKQELAEMLFQSVL  477



>gb|AES92376.2| xylose isomerase [Medicago truncatula]
Length=480

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDAATAANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EAT++MLSVI+NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  340  DANTGDPQVGWDTDQFLVDIQEATMIMLSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQSFD+E+GA IE GKADF+ LEKK  EW
Sbjct  400  HIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQSFDTEIGAQIEAGKADFDFLEKKVKEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI Q+A+
Sbjct  460  GEPKVASAKQELAEMIFQNAM  480



>gb|EPS67638.1| xylose isomerase [Genlisea aurea]
Length=472

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI+EFKLNIECNHATLSGHSCHHEVETARINGLLGNI
Sbjct  272  QEPTKHQYDWDAATSANFLRKYGLINEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  331

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGDPQ GWDTDQF MDVAEAT+VMLSVIKNGGLAPGGFNFDAKLRRESTDVED+FI 
Sbjct  332  DANSGDPQVGWDTDQFMMDVAEATMVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDMFIG  391

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+A KLIE+G L E+V+KRY+SFDSELG  IE G  DFELLEKKA+E 
Sbjct  392  HIAGMDTLARGLRNARKLIEEGQLSEIVKKRYKSFDSELGGEIEAGNGDFELLEKKAVEL  451

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP+V S KQELAEMI QSAL
Sbjct  452  GEPQVASGKQELAEMIFQSAL  472



>ref|XP_010259768.1| PREDICTED: xylose isomerase isoform X1 [Nelumbo nucifera]
Length=515

 Score =   359 bits (921),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTA FLRK  L  EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  315  QEPTKHQYDWDAATTAGFLRKYNLSGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  374

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EAT+VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  375  DANTGDPQIGWDTDQFLTDIGEATMVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIA  434

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL ELVRKRY+SFD+E+GA IE GKADFE LE KA+EW
Sbjct  435  HITGMDTLARGLRNVAKLIEDGSLAELVRKRYESFDTEIGAQIEAGKADFEFLETKAMEW  494

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEM+ QSAL
Sbjct  495  GEPKVPSAKQELAEMVFQSAL  515



>gb|KJB60239.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 184/201 (92%), Gaps = 1/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFL K GL+ EFKLNIECNHATLSGHSCHH++ETARING+LGNI
Sbjct  275  QEPTKHQYDWDAATTLNFLHKYGLL-EFKLNIECNHATLSGHSCHHDLETARINGMLGNI  333

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  DV EAT+VMLSVI+NGGLAPGGFNFDAKLRRES DVED+FIA
Sbjct  334  DANTGDPQVGWDTDQFLTDVGEATMVMLSVIRNGGLAPGGFNFDAKLRRESKDVEDLFIA  393

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRY SFD+ELGA IE GKADFE+LEKKA+EW
Sbjct  394  HISGMDTLARGLRNAAKLIEDGSLAELVRKRYSSFDTELGAQIEAGKADFEMLEKKAMEW  453

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSAL
Sbjct  454  GEPKVASAKQELAEMIFQSAL  474



>ref|XP_010938719.1| PREDICTED: xylose isomerase [Elaeis guineensis]
Length=479

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GL+ EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATAFAFLQKYGLVGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQIGWDTDQFLTDIAEATLVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL ELVRKRY SFDSE+GA IE GKADFE LEKKA+EW
Sbjct  399  HISGMDTLARGLRNVAKLIEDGSLDELVRKRYSSFDSEIGALIEAGKADFETLEKKAMEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V S KQELAEMI QSAL
Sbjct  459  GEPSVASGKQELAEMIFQSAL  479



>gb|AFK39166.1| unknown [Medicago truncatula]
Length=480

 Score =   355 bits (912),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDAATAANFLRKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDT+QF +D+ EAT++MLSVI+NGG+APGGFNFD KLRRESTDVED+FIA
Sbjct  340  DANTGDPQVGWDTNQFLVDIQEATMIMLSVIRNGGIAPGGFNFDVKLRRESTDVEDLFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKL+EDGSL ELVRKRYQSFD+E+GA IE GKADF+ LEKK  EW
Sbjct  400  HIVGMDTMARGLRNAAKLVEDGSLAELVRKRYQSFDTEIGAQIEAGKADFDFLEKKVKEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI Q+A+
Sbjct  460  GEPKVASAKQELAEMIFQNAM  480



>ref|XP_009391575.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   355 bits (910),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GL+ EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATAYAFLQKYGLLGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EATLVMLSV++NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQIGWDTDQFLTDIGEATLVMLSVVRNGGIAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKL EDGSL ELVRKRYQSFD+E+GA IE GKADFE LEKK +EW
Sbjct  399  HISGMDTLARGLRNVAKLTEDGSLAELVRKRYQSFDTEIGALIEAGKADFETLEKKVMEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEMI QSAL
Sbjct  459  GEPSVPSGKQELAEMIFQSAL  479



>ref|XP_004297371.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
 ref|XP_011463128.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
Length=478

 Score =   354 bits (909),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GL+ EFKLNIECNHATLSGHSCHHE+ETAR+NGLLGNI
Sbjct  278  QEPTKHQYDWDAATTANFLRKYGLLGEFKLNIECNHATLSGHSCHHELETARLNGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D+AEAT VML+V+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  338  DANTGDPQIGWDTDEFLTDIAEATRVMLTVVKNGGLAPGGFNFDAKLRRESTDVEDLFVA  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGL + AKLIEDGSL ELVRKRY+SFD+E+GA IE GK DFE LEKKA+EW
Sbjct  398  HISGMDTLARGLHNVAKLIEDGSLAELVRKRYESFDTEVGAQIEAGKGDFEYLEKKAMEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAE + Q AL
Sbjct  458  GEPKVPSAKQELAERLFQFAL  478



>ref|XP_008796228.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796229.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796230.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
Length=483

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GL+ EFKLNIECNHATLSGHSCHHE+ETARINGLLGN+
Sbjct  283  QEPTKHQYDWDAATAFAFLQKYGLLGEFKLNIECNHATLSGHSCHHELETARINGLLGNV  342

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  343  DANTGDPQIGWDTDQFLTDIAEATLVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDMFIA  402

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGL + AKLIEDGSL ELVRKRY SFD+E+GA +E GKADFE LEKKA+EW
Sbjct  403  HISGMDTLARGLHNVAKLIEDGSLDELVRKRYSSFDTEIGALVEAGKADFETLEKKAMEW  462

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEMI QSAL
Sbjct  463  GEPSVPSGKQELAEMIFQSAL  483



>ref|XP_004958625.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD AT   FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDVATAFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM SV+KNGGLAPGGFNFDAKLRRESTDVEDIFIA
Sbjct  340  DANTGDPQVGWDTDQFMTDIAEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDIFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL ELVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  400  HISGMDTLARGLRNVAKLIEDGSLDELVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  460  GEPTVPSGKQELAEMLFQSAL  480



>ref|XP_004958079.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD AT   FL+K GLI EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDVATAFAFLQKYGLIGEFKINVECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM +V+KNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  340  DANTGDPQVGWDTDQFMTDIAEATLVMSTVVKNGGLAPGGFNFDAKLRRESTDVEDMFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL ELVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  400  HISGMDTLARGLRNVAKLIEDGSLDELVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  460  GEPTVPSGKQELAEMLFQSAL  480



>ref|XP_008796227.1| PREDICTED: xylose isomerase isoform X1 [Phoenix dactylifera]
Length=529

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GL+ EFKLNIECNHATLSGHSCHHE+ETARINGLLGN+
Sbjct  329  QEPTKHQYDWDAATAFAFLQKYGLLGEFKLNIECNHATLSGHSCHHELETARINGLLGNV  388

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  389  DANTGDPQIGWDTDQFLTDIAEATLVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDMFIA  448

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGL + AKLIEDGSL ELVRKRY SFD+E+GA +E GKADFE LEKKA+EW
Sbjct  449  HISGMDTLARGLHNVAKLIEDGSLDELVRKRYSSFDTEIGALVEAGKADFETLEKKAMEW  508

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEMI QSAL
Sbjct  509  GEPSVPSGKQELAEMIFQSAL  529



>ref|XP_010065878.1| PREDICTED: xylose isomerase-like isoform X3 [Eucalyptus grandis]
Length=480

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD D ATTA+FLRK GL+ EFK+N+ECNHATLSGHSCHHE+ETAR+NGL GN+
Sbjct  280  QEPTKHQYDSDVATTASFLRKYGLLGEFKINVECNHATLSGHSCHHELETARLNGLFGNL  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EATLVMLSV++NGGLAPGG NFDAKLRRESTDVED+FIA
Sbjct  340  DANTGDPQIGWDTDQFLTDIGEATLVMLSVVRNGGLAPGGINFDAKLRRESTDVEDLFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDTLARGLR+ AKLIEDGSL ELVRKRY+SFD+E GA IE GK DFE LEKKA+EW
Sbjct  400  HIGGMDTLARGLRNVAKLIEDGSLDELVRKRYESFDTEFGAQIEAGKVDFETLEKKAMEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSAL
Sbjct  460  GEPKVPSAKQELAEMIFQSAL  480



>dbj|BAE98492.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY ++DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLSELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  457  GEPKVSSAKQELAEMIFQSAM  477



>ref|NP_568861.3| xylose isomerase [Arabidopsis thaliana]
 sp|Q9FKK7.2|XYLA_ARATH RecName: Full=Xylose isomerase [Arabidopsis thaliana]
 gb|AAM97134.1| expressed protein; supported by full length cDNA: Ceres: 122798 
[Arabidopsis thaliana]
 gb|AAP31951.1| At5g57655 [Arabidopsis thaliana]
 gb|AED96932.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY ++DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLSELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  457  GEPKVSSAKQELAEMIFQSAM  477



>ref|XP_010539451.1| PREDICTED: xylose isomerase [Tarenaya hassleriana]
Length=477

 Score =   350 bits (897),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ANFLRK GLI EFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  277  QEPTKHQYDWDAATSANFLRKYGLIGEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DANSGD QTGWDTDQF  DVAEAT++M SVIKNGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANSGDAQTGWDTDQFLTDVAEATMIMFSVIKNGGLAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKLIE+G+L E+V KRY S+DSELG  IE GKADFE LEKKA EW
Sbjct  397  HISGMDTMARGLRNAAKLIEEGTLGEVVSKRYSSWDSELGKQIEEGKADFEYLEKKAKEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GE KV SAKQELAEMI QSAL
Sbjct  457  GEMKVASAKQELAEMIFQSAL  477



>ref|XP_009417936.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   349 bits (896),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GLI EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATAFAFLQKYGLIGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EATLVMLSV++NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQIGWDTDQFLTDIGEATLVMLSVVRNGGLAPGGFNFDAKLRRESTDVEDMFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+  KL EDGSL ELVRKRYQSFD+E+G+ IE GKADFE LEK+A+EW
Sbjct  399  HISGMDTLARGLRNVQKLTEDGSLAELVRKRYQSFDTEIGSLIEAGKADFETLEKQAMEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
             EP VPS KQELAEMI QSAL
Sbjct  459  DEPSVPSGKQELAEMIFQSAL  479



>ref|XP_006401183.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
 gb|ESQ42636.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
Length=482

 Score =   350 bits (897),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  282  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  341

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVI+NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  342  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIA  401

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+G L ELVRKRY S+DSE+G  IE GKADFE LEKKA E+
Sbjct  402  HISGMDTIARGLRNAVKILEEGRLSELVRKRYSSWDSEIGKQIEEGKADFEYLEKKAKEF  461

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  462  GEPKVPSAKQELAEMIFQSAM  482



>ref|XP_010443465.1| PREDICTED: xylose isomerase [Camelina sativa]
Length=477

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY S+DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLNELVRKRYASWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  457  GEPKVSSAKQELAEMIFQSAM  477



>ref|XP_006280396.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
 gb|EOA13294.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
Length=477

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVI+NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ RGLR+AAK++E+GSL ELVRKRY S+DSE+G  IE GKADFE LEKKA E 
Sbjct  397  HISGMDTMGRGLRNAAKILEEGSLNELVRKRYASWDSEIGKQIEEGKADFEYLEKKAKEI  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  457  GEPKVPSAKQELAEMIFQSAM  477



>emb|CDY25894.1| BnaC09g32660D [Brassica napus]
Length=491

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI+EFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  291  QEPTKHQYDWDAATAANFLRKYGLINEFKLNIECNHATLSGHTCHHELETARINGLLGNI  350

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  D+ EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  351  DANTGDAQTGWDTDQFLTDLGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  410

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAK++EDG L ELV KRY S+DSELG  IE GKADFE LEKKA E+
Sbjct  411  HISGMDTVARGLRNAAKILEDGRLSELVGKRYSSWDSELGKQIEEGKADFEYLEKKAKEF  470

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  471  GEPKVPSAKQELAEMIFQSAM  491



>ref|XP_009120281.1| PREDICTED: xylose isomerase [Brassica rapa]
 ref|XP_009120282.1| PREDICTED: xylose isomerase [Brassica rapa]
Length=477

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI+EFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLINEFKLNIECNHATLSGHTCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAK++E+G L ELV KRY S+DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTVARGLRNAAKILEEGRLSELVGKRYSSWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  457  GEPKVPSAKQELAEMIFQSAM  477



>emb|CDY49729.1| BnaA10g11590D [Brassica napus]
Length=477

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI+EFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLINEFKLNIECNHATLSGHTCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAK++E+G L ELV KRY S+DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTVARGLRNAAKILEEGRLSELVGKRYSSWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  457  GEPKVPSAKQELAEMIFQSAM  477



>ref|XP_002864523.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40782.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY ++DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLNELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  457  GEPKVSSAKQELAEMIFQSAM  477



>dbj|BAJ34093.1| unnamed protein product [Thellungiella halophila]
Length=482

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETAR+NGLLGN+
Sbjct  282  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARLNGLLGNM  341

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVI+NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  342  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIA  401

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+G L ELVRKRY S+DSE+G  IE GKADFE LEKKA E+
Sbjct  402  HISGMDTIARGLRNAVKILEEGRLSELVRKRYSSWDSEIGKQIEEGKADFEYLEKKAKEF  461

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKVPSAKQELAEMI QSA+
Sbjct  462  GEPKVPSAKQELAEMIFQSAM  482



>ref|XP_006658089.1| PREDICTED: xylose isomerase-like [Oryza brachyantha]
Length=480

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  280  QEPTKHQYDWDVATTFSFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D++EATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  340  DANTGDPQIGWDTDQFLTDISEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+  KL+EDGSL +LVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  400  HISGMDTLARGLRNVVKLMEDGSLDDLVRKRYQSFDSEIGAIIEAGKGDFETLEKKVLEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  460  GEPSVPSGKQELAEMLFQSAL  480



>gb|EEC82655.1| hypothetical protein OsI_27268 [Oryza sativa Indica Group]
 gb|EEE67782.1| hypothetical protein OsJ_25511 [Oryza sativa Japonica Group]
Length=478

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  278  QEPTKHQYDWDVATTFSFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D++EATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  338  DANTGDPQIGWDTDQFLTDISEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLA  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+  KLIEDGSL ELVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  398  HISGMDTLARGLRNVVKLIEDGSLDELVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAE++ Q+AL
Sbjct  458  GEPIVPSGKQELAEILFQAAL  478



>ref|NP_001060585.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAC83596.1| putative xylose isomerase [Oryza sativa Japonica Group]
 dbj|BAF22499.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAG92890.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDVATTFSFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D++EATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  339  DANTGDPQIGWDTDQFLTDISEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+  KLIEDGSL ELVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  399  HISGMDTLARGLRNVVKLIEDGSLDELVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAE++ Q+AL
Sbjct  459  GEPIVPSGKQELAEILFQAAL  479



>ref|XP_010483295.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLI+EFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLINEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVI+NGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIRNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY S+DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLNELVRKRYASWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  457  GEPKVSSAKQELAEMIFQSAM  477



>ref|XP_003562496.1| PREDICTED: xylose isomerase [Brachypodium distachyon]
Length=479

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDVATTFSFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D++EATLVM SV+KN GLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDEFLTDISEATLVMSSVVKNDGLAPGGFNFDAKLRRESTDVEDMFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+ AKLIEDGSL ELVRKRYQSFD+E+GA IE GK DFE LEKK LEW
Sbjct  399  HISGMDTMARGLRNVAKLIEDGSLDELVRKRYQSFDTEIGAMIEAGKGDFETLEKKVLEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  459  GEPIVPSGKQELAEMLFQSAL  479



>ref|NP_001132889.1| putative xylose isomerase family protein precursor [Zea mays]
 gb|ACF81922.1| unknown [Zea mays]
 gb|ACG41148.1| xylose isomerase [Zea mays]
 tpg|DAA41688.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=482

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT  FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  282  QEPTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  341

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM +V+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  342  DANTGDPQVGWDTDQFMTDIAEATLVMSTVVKNGGLAPGGFNFDAKLRRESTDVEDLFLA  401

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL  LVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  402  HISGMDTLARGLRNAAKLIEDGSLDALVRKRYQSFDSEIGALIEAGKGDFEALEKKVLEW  461

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAE++  SAL
Sbjct  462  GEPTVPSGKQELAEILFHSAL  482



>gb|AAM61519.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD  TGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAXTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY ++DSELG  IE G+ADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLSELVRKRYATWDSELGKQIEEGEADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI QSA+
Sbjct  457  GEPKVSSAKQELAEMIFQSAM  477



>gb|AGV54617.1| xylose isomerase [Phaseolus vulgaris]
Length=480

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q P+K QYDWDAAT+ANFLRK GL  EFKLNIECNHA LSGHSC HE+ETARINGLLGNI
Sbjct  280  QEPSKPQYDWDAATSANFLRKYGLAGEFKLNIECNHAPLSGHSCQHELETARINGLLGNI  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EATL+MLSVI+NGGLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  340  DANTGDPQVGWDTDQFLVDIQEATLIMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIA  399

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLI+DGSL ELVRKRYQSFD+E+GA IE GKADFELLEKK  EW
Sbjct  400  HIVGMDTLARGLRNAAKLIKDGSLFELVRKRYQSFDTEIGAQIEAGKADFELLEKKVKEW  459

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V  AKQELAEMI Q AL
Sbjct  460  GEPTVAFAKQELAEMIFQFAL  480



>ref|XP_010452612.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GL++EFKLNIECNHATLSGH+CHHE+ETAR+NGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLVNEFKLNIECNHATLSGHTCHHELETARLNGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY S+DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLNELVRKRYASWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEPKV SAKQELAEMI +SA+
Sbjct  457  GEPKVSSAKQELAEMIFKSAM  477



>gb|EMS46439.1| Xylose isomerase [Triticum urartu]
Length=445

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARIN +LGNI
Sbjct  245  QEPTKHQYDWDVATTFSFLQKFGLTGEFKINVECNHATLSGHSCHHELETARINDILGNI  304

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D++EATL+M SV+KN GLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  305  DANTGDPQVGWDTDEFLTDISEATLIMSSVVKNDGLAPGGFNFDAKLRRESTDVEDLFIA  364

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+ AKLIEDGSL ELVRKRYQSFD+E+GA IE GK DFE LEKK LEW
Sbjct  365  HISGMDTMARGLRNVAKLIEDGSLDELVRKRYQSFDTEIGAMIEAGKGDFETLEKKVLEW  424

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  425  GEPTVPSGKQELAEMLFQSAL  445



>gb|ACG42142.1| xylose isomerase [Zea mays]
Length=484

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT  FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  284  QEPTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  343

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM +V+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  344  DANTGDPQVGWDTDQFMTDIAEATLVMSTVVKNGGLAPGGFNFDAKLRRESTDVEDLFLA  403

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL  LVRKRY+SFDSE+GA IE GK DFE LEKK LEW
Sbjct  404  HISGMDTLARGLRNAAKLIEDGSLDALVRKRYRSFDSEMGALIEAGKGDFEALEKKVLEW  463

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAE++  SAL
Sbjct  464  GEPTVPSGKQELAEILFHSAL  484



>ref|XP_006845583.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
 gb|ERN07258.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
Length=477

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT+ +FL+K GL  EFKLNIECNHATLSGHSCHHE+ETARING LGNI
Sbjct  277  QEPTKHQYDWDAATSLSFLQKYGLAGEFKLNIECNHATLSGHSCHHELETARINGALGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+ EATLVMLSV++NGG+APGGFNFDAKLRRESTDVEDIF+A
Sbjct  337  DANTGDPQIGWDTDQFLTDIGEATLVMLSVVRNGGIAPGGFNFDAKLRRESTDVEDIFLA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+ AKL+EDGSL EL+RKRY SFD+E GA IE GK DFE LEKKA+EW
Sbjct  397  HISGMDTMARGLRNVAKLMEDGSLSELIRKRYASFDTEFGAEIEAGKVDFETLEKKAMEW  456

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V S KQELAEMI +SAL
Sbjct  457  GEPAVASGKQELAEMIFRSAL  477



>gb|ACG35698.1| xylose isomerase [Zea mays]
Length=484

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT  FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  284  QEPTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  343

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+ 
Sbjct  344  DANTGDPQVGWDTDQFMTDIAEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLV  403

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLIEDGSL +LVRKRYQSFDS++GA IE GK DFE LEKK LEW
Sbjct  404  HISGMDTLARGLRNVAKLIEDGSLDDLVRKRYQSFDSDIGALIEAGKGDFETLEKKVLEW  463

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V S KQELAE++ QSAL
Sbjct  464  GEPTVASGKQELAEILFQSAL  484



>ref|NP_001132653.1| uncharacterized protein LOC100194128 precursor [Zea mays]
 ref|XP_008650948.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 ref|XP_008650949.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 gb|ACF81585.1| unknown [Zea mays]
Length=484

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT  FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  284  QEPTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  343

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  344  DANTGDPQVGWDTDQFMTDIAEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLA  403

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLI DGSL +LVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  404  HISGMDTLARGLRNVAKLIGDGSLDDLVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  463

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V S KQELAE++ QSAL
Sbjct  464  GEPTVASGKQELAEILFQSAL  484



>dbj|BAJ96683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARIN +LGNI
Sbjct  279  QEPTKHQYDWDVATTFSFLQKFGLTGEFKINVECNHATLSGHSCHHELETARINDILGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D++EATL+M SV+KN GLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDEFLTDISEATLIMSSVVKNDGLAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+ AKLIEDGSL ELVRKRYQSFD+E+GA IE GK DFE LEKK LEW
Sbjct  399  HISGMDTMARGLRNVAKLIEDGSLDELVRKRYQSFDTEIGAMIETGKGDFETLEKKVLEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  459  GEPTVPSGKQELAEMLFQSAL  479



>ref|XP_004507815.1| PREDICTED: xylose isomerase-like isoform X1 [Cicer arietinum]
 ref|XP_004507816.1| PREDICTED: xylose isomerase-like isoform X2 [Cicer arietinum]
Length=491

 Score =   342 bits (878),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATTANFLRK GL  EFKLNIECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  279  QEPTKHQYDWDAATTANFLRKYGLEGEFKLNIECNHATLSGHSCHHELETARINGLLGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF +D+ EAT++MLSVI+N G+APGGFNFDAKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDQFLVDIQEATMIMLSVIRNDGIAPGGFNFDAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+AAKLIEDGSL ELVRKRYQSFD+E+GA IE GKADF+LLEKKA EW
Sbjct  399  HIVGMDTMARGLRTAAKLIEDGSLAELVRKRYQSFDTEIGAQIEAGKADFDLLEKKAKEW  458

Query  195  GEPKVPSAKQ  166
            GEPKV SAKQ
Sbjct  459  GEPKVASAKQ  468



>ref|XP_008650947.1| PREDICTED: uncharacterized protein LOC100194128 isoform X2 [Zea 
mays]
Length=533

 Score =   343 bits (881),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT  FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  333  QEPTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  392

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  393  DANTGDPQVGWDTDQFMTDIAEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLA  452

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLI DGSL +LVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  453  HISGMDTLARGLRNVAKLIGDGSLDDLVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  512

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V S KQELAE++ QSAL
Sbjct  513  GEPTVASGKQELAEILFQSAL  533



>gb|KJB60241.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=465

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT NFL K GL+ EFKLNIECNHATLSGHSCHH++ETARING+LGNI
Sbjct  275  QEPTKHQYDWDAATTLNFLHKYGLLGEFKLNIECNHATLSGHSCHHDLETARINGMLGNI  334

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  DV EAT+VMLSVI+NGGLAPGGFNFDAKLRRES DVED+FIA
Sbjct  335  DANTGDPQVGWDTDQFLTDVGEATMVMLSVIRNGGLAPGGFNFDAKLRRESKDVEDLFIA  394

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKLIEDGSL ELVRKRY SFD+ELGA IE GKADFE+LEKKA+EW
Sbjct  395  HISGMDTLARGLRNAAKLIEDGSLAELVRKRYSSFDTELGAQIEAGKADFEMLEKKAMEW  454

Query  195  GEPKVPSAKQ  166
            GEPKV SAKQ
Sbjct  455  GEPKVASAKQ  464



>tpg|DAA64057.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=559

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT  FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARINGLLGNI
Sbjct  359  QEPTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNI  418

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D+AEATLVM SV+KNGGLAPGGFNFDAKLRRESTDVED+F+A
Sbjct  419  DANTGDPQVGWDTDQFMTDIAEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLA  478

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+ AKLI DGSL +LVRKRYQSFDSE+GA IE GK DFE LEKK LEW
Sbjct  479  HISGMDTLARGLRNVAKLIGDGSLDDLVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEW  538

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP V S KQELAE++ QSAL
Sbjct  539  GEPTVASGKQELAEILFQSAL  559



>gb|KCW63564.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
 gb|KCW63565.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
Length=495

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 181/216 (84%), Gaps = 15/216 (7%)
 Frame = -2

Query  735  QGPTKHQYD---------------WDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCH  601
            Q PTKHQYD                  ATTA+FLRK GL+ EFK+N+ECNHATLSGHSCH
Sbjct  280  QEPTKHQYDSASVFHESPLLMGVLLHVATTASFLRKYGLLGEFKINVECNHATLSGHSCH  339

Query  600  HEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDA  421
            HE+ETAR+NGL GN+DAN+GDPQ GWDTDQF  D+ EATLVMLSV++NGGLAPGG NFDA
Sbjct  340  HELETARLNGLFGNLDANTGDPQIGWDTDQFLTDIGEATLVMLSVVRNGGLAPGGINFDA  399

Query  420  KLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEG  241
            KLRRESTDVED+FIAHIGGMDTLARGLR+ AKLIEDGSL ELVRKRY+SFD+E GA IE 
Sbjct  400  KLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLIEDGSLDELVRKRYESFDTEFGAQIEA  459

Query  240  GKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  133
            GK DFE LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  460  GKVDFETLEKKAMEWGEPKVPSAKQELAEMIFQSAL  495



>gb|EMT06905.1| Xylose isomerase [Aegilops tauschii]
Length=450

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 178/205 (87%), Gaps = 4/205 (2%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARIN +LGNI
Sbjct  246  QEPTKHQYDWDVATTFSFLQKFGLTGEFKINVECNHATLSGHSCHHELETARINDILGNI  305

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D++EATL+M SV+KN GLAPGGFNFDAKLRRESTDVED+FIA
Sbjct  306  DANTGDPQVGWDTDEFLTDISEATLIMSSVVKNDGLAPGGFNFDAKLRRESTDVEDLFIA  365

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIE----GGKADFELLEKK  208
            HI GMDT+ARGLR+ AKLIEDGSL ELVRKRYQSFD+E+GA IE     GK DFE LEKK
Sbjct  366  HISGMDTMARGLRNVAKLIEDGSLDELVRKRYQSFDTEIGAMIEVHKLAGKGDFETLEKK  425

Query  207  ALEWGEPKVPSAKQELAEMILQSAL  133
             LEWGEP VPS KQELAEM+ QSAL
Sbjct  426  VLEWGEPTVPSGKQELAEMLFQSAL  450



>sp|Q40082.1|XYLA_HORVU RecName: Full=Xylose isomerase [Hordeum vulgare]
 emb|CAA64545.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARIN +LGNI
Sbjct  279  QEPTKHQYDWDVATTFSFLQKFGLTGEFKINVECNHATLSGHSCHHELETARINDILGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D++EATL+M SV+KN GLAPGGFNF AKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDEFLTDISEATLIMSSVVKNDGLAPGGFNFYAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARG R+  KLIEDGSL ELVRKRYQSFD+E+GA IE GK DFE LEKKALEW
Sbjct  399  HISGMDTMARGRRNVVKLIEDGSLDELVRKRYQSFDTEIGAMIEAGKGDFETLEKKALEW  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP VPS KQELAEM+ QSAL
Sbjct  459  GEPTVPSGKQELAEMLFQSAL  479



>dbj|BAB08802.1| xylose isomerase [Arabidopsis thaliana]
Length=472

 Score =   332 bits (850),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT ANFLRK GLIDEFKLNIECNHATLSGH+CHHE+ETARINGLLGNI
Sbjct  277  QEPTKHQYDWDAATAANFLRKYGLIDEFKLNIECNHATLSGHTCHHELETARINGLLGNI  336

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  DV EAT+VM+SVIKNGG+APGGFNFDAKLRRESTDVED+FIA
Sbjct  337  DANTGDAQTGWDTDQFLTDVGEATMVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIA  396

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARGLR+A K++E+GSL ELVRKRY ++DSELG  IE GKADFE LEKKA E+
Sbjct  397  HISGMDTMARGLRNAVKILEEGSLSELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEF  456

Query  195  GEPKVPSAKQ  166
            GEPKV SAKQ
Sbjct  457  GEPKVSSAKQ  466



>gb|ABR16225.1| unknown [Picea sitchensis]
Length=399

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT  FL++ GL  EFKLNIECNHATLSGHSCHHE+E +RI G+LGNI
Sbjct  199  QEPTKHQYDWDAATTMGFLQRYGLAGEFKLNIECNHATLSGHSCHHELEMSRIYGMLGNI  258

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  D+ EATLVML+VIKNGGLAPGGFNFDAKLRRES DVED+FI 
Sbjct  259  DANTGDAQTGWDTDQFLTDIGEATLVMLTVIKNGGLAPGGFNFDAKLRRESVDVEDLFIG  318

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDTLARGLR+AAKL++DG L ELV KRY++ +S+LGA IE  +  FE LEKKA EW
Sbjct  319  HISGMDTLARGLRNAAKLLQDGKLSELVAKRYETLNSKLGALIEEEEVSFEELEKKAHEW  378

Query  195  GEPKVPSAKQELAEMILQSAL  133
            GEP + S KQELAEMI QS L
Sbjct  379  GEPPLSSGKQELAEMIFQSYL  399



>ref|XP_002991242.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
 gb|EFJ07670.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
Length=476

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GL D+FKLNIECNHATL+GHSC+HE+E +RING+LGNI
Sbjct  276  QEPTKHQYDWDAATAIGFLQKYGLKDDFKLNIECNHATLAGHSCYHELEVSRINGVLGNI  335

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF MD+AE T VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FI+
Sbjct  336  DANTGDAQTGWDTDQFLMDIAETTQVMLSVLQNGGLAPGGFNFDAKLRRESTDVEDLFIS  395

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMD +ARGLR+AAK++E+G+L  +V++RY SFDS LGA+IE G+  FE LE++AL  
Sbjct  396  HIAGMDAMARGLRNAAKILEEGTLPSIVKERYASFDSALGASIESGELGFEELEREALRM  455

Query  195  GEPKVPSAKQELAEMILQSAL  133
             EP   S KQELAEM+  +++
Sbjct  456  EEPLPASGKQELAEMVFYNSI  476



>ref|XP_002991182.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
 gb|EFJ07726.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
Length=478

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAAT   FL+K GL D+FKLNIECNHATL+GHSC+HE+E +RING+LGNI
Sbjct  278  QEPTKHQYDWDAATAIGFLQKYGLKDDFKLNIECNHATLAGHSCYHELEVSRINGVLGNI  337

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF MD+AE T VMLSV++NGGLAPGGFNFDAKLRRESTDVED+FI+
Sbjct  338  DANTGDAQTGWDTDQFLMDIAETTQVMLSVLQNGGLAPGGFNFDAKLRRESTDVEDLFIS  397

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMD +ARGLR+AAK++E+G+L  +V++RY SFDS LGA+IE G+  FE LE++AL  
Sbjct  398  HIAGMDAMARGLRNAAKILEEGTLPSIVKERYASFDSALGASIESGELGFEELEQEALRM  457

Query  195  GEPKVPSAKQELAEMILQSAL  133
             EP   S KQELAEM+  +++
Sbjct  458  EEPLPASGKQELAEMVFYNSI  478



>ref|XP_001774702.1| predicted protein [Physcomitrella patens]
 gb|EDQ60517.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 3/204 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLI---DEFKLNIECNHATLSGHSCHHEVETARINGLL  565
            Q PTKHQYDWDAATT  FL+  GL    +++KLN+ECNHATLSGHSCHHE+ETARI G+L
Sbjct  276  QEPTKHQYDWDAATTMGFLKNYGLSGTNNDYKLNLECNHATLSGHSCHHELETARIYGML  335

Query  564  GNIDANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDI  385
            G++DAN+GD QTGWDTDQF  DV+EATL+MLSVIKNGGLAPGGFNFDAKLRRES DVED+
Sbjct  336  GSVDANTGDAQTGWDTDQFLTDVSEATLIMLSVIKNGGLAPGGFNFDAKLRRESVDVEDL  395

Query  384  FIAHIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKA  205
            FIAHI GMDT+ARGLR+AAKL+E+G L +LV  RY SF+S LG  IE GK  FE LEK +
Sbjct  396  FIAHISGMDTIARGLRNAAKLLEEGRLTKLVEDRYSSFNSPLGKTIEEGKVGFEELEKIS  455

Query  204  LEWGEPKVPSAKQELAEMILQSAL  133
            LE  EP + S KQELAEMI  S +
Sbjct  456  LEAEEPPITSGKQELAEMIFYSYV  479



>emb|CAA64544.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
 prf||2209268A xylose isomerase
Length=479

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FL+K GL  EFK+N+ECNHATLSGHSCHHE+ETARIN +LGNI
Sbjct  279  QEPTKHQYDWDVATTFSFLQKFGLTGEFKINVECNHATLSGHSCHHELETARINDILGNI  338

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTD+F  D++EATL+M SV+KN GLAPGGFNF AKLRRESTDVED+FIA
Sbjct  339  DANTGDPQVGWDTDEFLTDISEATLIMSSVVKNDGLAPGGFNFYAKLRRESTDVEDLFIA  398

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMDT+ARG R+  KLIEDGSL ELVRKRYQSFD+E+GA IEG  +     +  +   
Sbjct  399  HISGMDTMARGRRNVVKLIEDGSLDELVRKRYQSFDTEIGAMIEGSSSFTAQCKYISAPM  458

Query  195  GEPKVPSAKQELAEMILQSAL  133
              P       ELAEM+ QSAL
Sbjct  459  IVPYDLLLPAELAEMLFQSAL  479



>ref|XP_005646804.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE22260.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
Length=471

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWDAATT  FL + GL DEFKLN+ECNHATL+GHSC HE++ A   G LGNI
Sbjct  268  QEPTKHQYDWDAATTMGFLNQYGLSDEFKLNVECNHATLAGHSCEHELQLASAYGKLGNI  327

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD QTGWDTDQF  D  EATLV   ++K GGLAPGG NFDAKLRRESTDV D+F  
Sbjct  328  DANTGDAQTGWDTDQFLTDPKEATLVAAVILKQGGLAPGGINFDAKLRRESTDVNDLFYG  387

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMD LARGLR+AA+++E+G L  +++ RY ++   +G  I  GK DF  LEK AL  
Sbjct  388  HISGMDALARGLRNAAQMLEEGILPGMIKDRYSTYSKGVGKKIRDGKVDFVELEKVALAS  447

Query  195  GEPK--VPSAKQELAEMILQSAL  133
             +P   +PSA+ EL E++L   +
Sbjct  448  ADPAEDLPSARAELYEIVLSRYI  470



>ref|XP_002506620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67878.1| predicted protein [Micromonas sp. RCC299]
Length=411

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 154/203 (76%), Gaps = 2/203 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q P+KHQYDWD  TTA FLR+ GL  +FKLN+ECNHATL+GHSC HE+ETA    +LG +
Sbjct  208  QEPSKHQYDWDVGTTAGFLREFGLEKDFKLNVECNHATLAGHSCSHEIETAVAMDMLGGL  267

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQ GWDTDQF  D  EA LV+ +++++ G APGG NFDAK RRESTDV D+  A
Sbjct  268  DANTGDPQVGWDTDQFMTDGREAALVLSAIVRSKGFAPGGINFDAKTRRESTDVNDLLYA  327

Query  375  HIGGMDTLARGLRSAAKLIE-DGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
            HIGGMD +A GL+ AAKL++ DG+L+ + R+RY S+ SELGA IE GKA  + LEK ALE
Sbjct  328  HIGGMDAMANGLKLAAKLVDPDGALERVKRERYSSWASELGAKIEKGKATLKELEKLALE  387

Query  198  W-GEPKVPSAKQELAEMILQSAL  133
              GEP V S KQELA+ I+ + +
Sbjct  388  ADGEPAVGSGKQELADNIIAAVV  410



>ref|XP_010065874.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065875.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065876.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
Length=467

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATTA+FLRK GL+ EFK+N+E NHATLSG SCHHE+ET R+NG  GN+
Sbjct  280  QEPTKHQYDWDVATTASFLRKYGLLGEFKINVEYNHATLSGRSCHHELETGRLNGRFGNL  339

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GD Q GWDTDQF  D+ EATLVMLSV++NGGLAPG     A +  ES DVED+FIA
Sbjct  340  DANTGDTQIGWDTDQFQTDIGEATLVMLSVVRNGGLAPG-----ASIYEESMDVEDLFIA  394

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIE  244
            HI GMDTLARG R+ AKLIEDGSL ELVRKRY+SFD+E GA IE
Sbjct  395  HISGMDTLARGFRNVAKLIEDGSLDELVRKRYESFDAECGAQIE  438



>gb|KIZ04907.1| xylose isomerase [Monoraphidium neglectum]
Length=472

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 158/205 (77%), Gaps = 4/205 (2%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYDWD ATT +FLRK GL  EFK+N+ECNHATLSGHSC HE+ETARING+LGNI
Sbjct  268  QEPTKHQYDWDVATTVSFLRKYGLEKEFKINVECNHATLSGHSCEHELETARINGVLGNI  327

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN+GDPQTGWDTDQF +D  EATL+ML+VI+NGGL  GGFNFDAKLRREST + D+F  
Sbjct  328  DANTGDPQTGWDTDQFLVDPREATLIMLAVIRNGGLGTGGFNFDAKLRRESTALVDLFYG  387

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSE--LGAAIEGGKADFELLEKKAL  202
            HI GMD LARGLR+AA L++ G+L +L  +RY S+ ++  +G  I  GK  F+ LEK AL
Sbjct  388  HISGMDALARGLRNAAALLDAGALTKLREERYASWGAKGGIGPKIIAGKVGFDDLEKFAL  447

Query  201  EWGEPK--VPSAKQELAEMILQSAL  133
               +P   V S  QELAE++L   L
Sbjct  448  SHPDPADDVGSGSQELAEILLDMHL  472



>ref|WP_034568836.1| xylose isomerase [Clostridiales bacterium oral taxon 876]
Length=440

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT  +FL+K GL   FK+NIE NHATL+GH+  HEV  ARING+LG++D 
Sbjct  238  PTKHQYDFDVATVMSFLQKYGLEKYFKVNIEANHATLAGHTFQHEVHLARINGMLGSLDI  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL+M  V+KNGG+ PGG NFDAK+RR S +VED+F+ +I
Sbjct  298  NQGDPNLGWDTDQFPTNIYDATLLMYEVLKNGGITPGGLNFDAKVRRASFEVEDLFLGYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDTLA+GL+ A K++E+G  + +V++RY+SF+  +G  I  GKADFE LEK AL    
Sbjct  358  AGMDTLAQGLKIAYKMLEEGEFENIVKERYKSFNEGIGKDIVEGKADFESLEKYALSHSS  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QEL E  L   +
Sbjct  418  IKNNSGRQELLEARLNQYI  436



>gb|ERI94441.1| xylose isomerase [Clostridiales bacterium oral taxon 876 str. 
F0540]
Length=455

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT  +FL+K GL   FK+NIE NHATL+GH+  HEV  ARING+LG++D 
Sbjct  253  PTKHQYDFDVATVMSFLQKYGLEKYFKVNIEANHATLAGHTFQHEVHLARINGMLGSLDI  312

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL+M  V+KNGG+ PGG NFDAK+RR S +VED+F+ +I
Sbjct  313  NQGDPNLGWDTDQFPTNIYDATLLMYEVLKNGGITPGGLNFDAKVRRASFEVEDLFLGYI  372

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDTLA+GL+ A K++E+G  + +V++RY+SF+  +G  I  GKADFE LEK AL    
Sbjct  373  AGMDTLAQGLKIAYKMLEEGEFENIVKERYKSFNEGIGKDIVEGKADFESLEKYALSHSS  432

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QEL E  L   +
Sbjct  433  IKNNSGRQELLEARLNQYI  451



>gb|ETK93389.1| xylose isomerase, partial [Phytophthora parasitica]
 gb|ETL46799.1| xylose isomerase, partial [Phytophthora parasitica]
Length=269

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  70   PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  129

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  130  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  189

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  190  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  249

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  250  PDHVSGKQELAELML  264



>gb|ETK93384.1| xylose isomerase [Phytophthora parasitica]
Length=287

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  88   PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  147

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  148  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  207

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  208  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  267

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  268  PDHVSGKQELAELML  282



>gb|ETL46794.1| xylose isomerase, partial [Phytophthora parasitica]
Length=307

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  108  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  167

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  168  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  227

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  228  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  287

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  288  PDHVSGKQELAELML  302



>ref|XP_001633389.1| predicted protein [Nematostella vectensis]
 gb|EDO41326.1| predicted protein [Nematostella vectensis]
Length=399

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PT+HQYD+DA T   FL+  GL   FKLNIE NH TL+GHS  H++  A   G+LG+IDA
Sbjct  201  PTRHQYDYDAQTVIGFLKTYGLDHHFKLNIEPNHTTLAGHSYEHDIVLASKVGMLGSIDA  260

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPM+V     +M ++I+ GGLAPGG NFD K+RRESTD+ED+FI+HI
Sbjct  261  NTGSPDLGWDTDQFPMNVKNCMFIMKAIIEQGGLAPGGLNFDCKVRRESTDIEDMFISHI  320

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MDTLAR LR AA LIE+G +  LV++RY SFDS +G+ IE G A  E LE   +  GE
Sbjct  321  GAMDTLARALRCAATLIEEGKMSGLVKERYSSFDSGIGSKIEKGLATLEELENFVMANGE  380

Query  189  PKVPSAKQELAEMIL  145
            P++ S KQE  E IL
Sbjct  381  PQLLSGKQEKYESIL  395



>gb|ETI53522.1| xylose isomerase [Phytophthora parasitica P1569]
Length=349

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  150  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  209

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  210  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  269

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  270  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  329

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  330  PDHVSGKQELAELML  344



>ref|XP_008900733.1| xylose isomerase [Phytophthora parasitica INRA-310]
 gb|ETN13656.1| xylose isomerase [Phytophthora parasitica INRA-310]
Length=452

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  253  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  312

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGGFNFDAK+RRESTD+EDIFIAHI
Sbjct  313  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGFNFDAKVRRESTDLEDIFIAHI  372

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  373  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  432

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  433  PDHVSGKQELAELML  447



>ref|XP_010738383.1| PREDICTED: xylose isomerase-like isoform X2 [Larimichthys crocea]
Length=365

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+  GL   FKLNIE NH TL+GHS  H+V  A   G+LG++D+
Sbjct  167  PCKHQYDYDAMSVIGFLKHYGLESHFKLNIEPNHTTLAGHSYEHDVVMASAFGMLGSVDS  226

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   TLVM ++++ GGL PGG NFDAK+RRESTD+ED+FIAHI
Sbjct  227  NTGSPDLGWDTDQFPMDIRNTTLVMKTIVEQGGLQPGGLNFDAKVRRESTDLEDLFIAHI  286

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR+A ++IEDG +  +V++RY SF   +G  +E G A  E +E    + GE
Sbjct  287  GAMDAFARGLRNAVRIIEDGLIAGMVKERYSSFSHGIGQKVEEGSATLEEMEAFITQKGE  346

Query  189  PKVPSAKQELAEMIL  145
            PKV S KQE  E I 
Sbjct  347  PKVTSGKQEKYESIF  361



>ref|XP_010792168.1| PREDICTED: xylose isomerase-like [Notothenia coriiceps]
Length=312

 Score =   229 bits (583),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 138/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD++A +   FL+  GL  +FKLNIE NH TL+GHS  H+V  A   G+LG++D+
Sbjct  114  PCKHQYDYEAVSVIGFLKYYGLEYDFKLNIEPNHTTLAGHSYEHDVVMASAFGMLGSVDS  173

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+  ATLVM ++I+ GGL PGG NFDAK+RRESTD+ED+FIAHI
Sbjct  174  NTGSPDLGWDTDQFPMDIRNATLVMKTIIEQGGLQPGGLNFDAKVRRESTDLEDLFIAHI  233

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MDT ARGLR+A ++IEDG +  +V+ RY SF   +   +E G A  E +E    + GE
Sbjct  234  GAMDTFARGLRNAVRIIEDGIIPGMVKDRYSSFSHGIWQKVEEGSASLEEMEDFIKQNGE  293

Query  189  PKVPSAKQELAEMIL  145
            PKV S KQE  E I 
Sbjct  294  PKVTSGKQEKYESIF  308



>gb|ETI53536.1| xylose isomerase [Phytophthora parasitica P1569]
Length=452

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  253  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  312

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  313  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  372

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  373  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  432

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  433  PDHVSGKQELAELML  447



>gb|ETP51333.1| xylose isomerase [Phytophthora parasitica P10297]
Length=452

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  253  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  312

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  313  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  372

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  373  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  432

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  433  PDHVSGKQELAELML  447



>gb|ETL77578.1| xylose isomerase [Phytophthora parasitica]
 gb|ETL99919.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM30630.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM53081.1| xylose isomerase [Phytophthora parasitica]
 gb|ETO82200.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETO82215.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETP23318.1| xylose isomerase [Phytophthora parasitica CJ01A1]
 gb|ETP23343.1| xylose isomerase [Phytophthora parasitica CJ01A1]
Length=452

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  253  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  312

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  313  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  372

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  373  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  432

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  433  PDHVSGKQELAELML  447



>gb|ETO82214.1| xylose isomerase [Phytophthora parasitica P1976]
Length=452

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  253  PMKHQYDYDAATVMAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  312

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +I+ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  313  NTGDPLVGWDTDQFLMDEKKAVLVMKKIIEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  372

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE GKA  E +   A E GE
Sbjct  373  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEQGKATLEEVAAYAKESGE  432

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  433  PDHVSGKQELAELML  447



>emb|CAF93733.1| unnamed protein product [Tetraodon nigroviridis]
Length=414

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+  GL  +FKLNIE NH TL+GHS  H+V  A   G+LG++DA
Sbjct  216  PCKHQYDYDAMSVIAFLKHYGLEGDFKLNIEPNHTTLAGHSYEHDVVMASAFGMLGSVDA  275

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMDV   TLVM +VI+ GGL PGG NFDAK+RRESTD+ED+FIAHI
Sbjct  276  NTGSPDLGWDTDQFPMDVRNTTLVMKTVIEQGGLQPGGLNFDAKVRRESTDMEDLFIAHI  335

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
              MD  ARGLR+AA+++EDG +  +V++RY SF  ++G  ++ G A  E +E    E GE
Sbjct  336  AAMDAFARGLRNAARIVEDGIMAAMVKERYSSFSRDIGQKVDEGSATLEEMEAFIKENGE  395

Query  189  PKVPSAKQELAEMILQSAL  133
            PK  S KQE  E I    +
Sbjct  396  PKTTSGKQEKYESIFNCYI  414



>ref|XP_010738382.1| PREDICTED: xylose isomerase-like isoform X1 [Larimichthys crocea]
Length=439

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+  GL   FKLNIE NH TL+GHS  H+V  A   G+LG++D+
Sbjct  241  PCKHQYDYDAMSVIGFLKHYGLESHFKLNIEPNHTTLAGHSYEHDVVMASAFGMLGSVDS  300

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   TLVM ++++ GGL PGG NFDAK+RRESTD+ED+FIAHI
Sbjct  301  NTGSPDLGWDTDQFPMDIRNTTLVMKTIVEQGGLQPGGLNFDAKVRRESTDLEDLFIAHI  360

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR+A ++IEDG +  +V++RY SF   +G  +E G A  E +E    + GE
Sbjct  361  GAMDAFARGLRNAVRIIEDGLIAGMVKERYSSFSHGIGQKVEEGSATLEEMEAFITQKGE  420

Query  189  PKVPSAKQELAEMILQSAL  133
            PKV S KQE  E I    +
Sbjct  421  PKVTSGKQEKYESIFNHYI  439



>ref|XP_003965907.1| PREDICTED: xylose isomerase-like [Takifugu rubripes]
Length=439

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 139/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+  GL  +FKLNIE NH TL+GHS  H++  A   G+LG++DA
Sbjct  241  PCKHQYDYDAMSVIGFLKHYGLERDFKLNIEPNHTTLAGHSYEHDIVMASAFGMLGSVDA  300

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   TLVM +V++ GGL PGG NFDAK+RRESTDVED+F+AH+
Sbjct  301  NTGSPDLGWDTDQFPMDIRNTTLVMKTVVEQGGLQPGGLNFDAKVRRESTDVEDLFVAHV  360

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
              MDT ARGLR+A ++IEDG +  +V+ RY SF  ++G  ++ G A  E +E    E GE
Sbjct  361  AAMDTFARGLRNAVRIIEDGIMAGMVKDRYSSFSRDIGQKVDEGSATLEEMEAFIKEKGE  420

Query  189  PKVPSAKQELAEMILQSAL  133
            PK+ S KQE  E I    +
Sbjct  421  PKMMSGKQETYESIFNRYI  439



>ref|WP_010588344.1| xylose isomerase [Schlesneria paludicola]
Length=436

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 142/201 (71%), Gaps = 3/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAA   NF R NGL+D  KLNIE NHATL+GH+  HE+E ARI G LG+IDA
Sbjct  237  PTKHQYDFDAAACLNFCRANGLLDHIKLNIETNHATLAGHTMMHELEYARIQGALGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFP D+   T  ML +++ GG+APGG NFDAK+RRES D  D+F AHI
Sbjct  297  NTGDLLLGWDTDQFPTDIYLTTQCMLVILEQGGIAPGGVNFDAKVRRESFDPIDLFHAHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKAL--EW  196
            G MD  ARG + AA + +DG LK+ V+KRY+SFD+ +GA IE GKA FE LEK  L  E 
Sbjct  357  GAMDAFARGTKIAAAIRKDGVLKDFVKKRYRSFDTGVGAEIESGKATFESLEKYVLGKET  416

Query  195  GEPKVPSAKQELAEMILQSAL  133
              P   S +QE+ E I+   L
Sbjct  417  LNPN-ESGRQEMLENIINQYL  436



>ref|WP_017895180.1| xylose isomerase [Clostridium tyrobutyricum]
 emb|CDL91629.1| Xylose isomerase [Clostridium tyrobutyricum DIVETGP]
Length=440

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 142/199 (71%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK  L   FK+NIE NHATL+GH+  HE++TARIN  LG++DA
Sbjct  238  PTKHQYDFDVAAVLAFLRKYELDKYFKINIEANHATLAGHTFQHEIQTARINNALGSLDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ + TL M  V+KNGG+APGG NFDAK+RR S + ED+F+A+I
Sbjct  298  NQGDPNLGWDTDQFPTNIYDTTLAMYEVLKNGGIAPGGLNFDAKVRRASFEPEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GLR A KL+EDG ++  ++++Y SF+S++G  I  GK  F  LEK ALE   
Sbjct  358  AGMDTFAKGLRVAYKLLEDGPIENFIKEKYSSFNSKIGKDIIEGKIGFNELEKYALENTS  417

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S +QE+ E I+   +
Sbjct  418  IENKSGRQEMLESIVNQYI  436



>ref|XP_009537176.1| hypothetical protein PHYSODRAFT_565503 [Phytophthora sojae]
 gb|EGZ07610.1| hypothetical protein PHYSODRAFT_565503 [Phytophthora sojae]
Length=409

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 138/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL  +FKLN+E NH TL+GH   H++  A    +LG++D 
Sbjct  210  PMKHQYDYDAATVIAFLHTYGLQHDFKLNVEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  269

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +++ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  270  NTGDPLVGWDTDQFLMDEKKAVLVMKKIVEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  329

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE G+A  E +   A E GE
Sbjct  330  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEDGRATLEEVAAYAKEAGE  389

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  390  PDHVSGKQELAELML  404



>ref|WP_036097976.1| xylose isomerase [Listeria floridensis]
 gb|EUJ28504.1| xylose isomerase [Listeria floridensis FSL S10-1187]
Length=435

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 147/199 (74%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P+KHQYD+DAATT  F++K GL ++FKLN+E NHATL+GH+  HE+  ARING LG+IDA
Sbjct  236  PSKHQYDFDAATTLQFIQKYGLENDFKLNLEANHATLAGHTFEHELTVARINGALGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP ++ + TL M  +++NGG+APGG NFDAK+RR + DVED+F+AHI
Sbjct  296  NQGDVLLGWDTDEFPTNIYDVTLTMREILENGGIAPGGINFDAKVRRSAFDVEDLFLAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT ARGL++AAKL +DG L+EL+ +RY SF + +GA+I   + D E L   ALE  +
Sbjct  356  AGMDTFARGLKNAAKLKQDGFLEELIAERYASFQTGIGASILADQEDLESLSTFALEHED  415

Query  189  PKVPSAKQELAEMILQSAL  133
             +V S+  E  + +L   +
Sbjct  416  AEVKSSHIEYVKNVLNDYM  434



>ref|WP_026658263.1| Xylose isomerase [Acholeplasma palmae]
 ref|YP_008636038.1| Xylose isomerase [Acholeplasma palmae J233]
 emb|CCV64223.1| Xylose isomerase [Acholeplasma palmae J233]
Length=439

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 135/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D+ATT  FLRKN L+ +F+LNIE NHATL+GH+  HE+ TARI G+ G+IDA
Sbjct  238  PTKHQYDFDSATTIGFLRKNDLLKDFRLNIEANHATLAGHTFQHEIATARIEGVFGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP +V +ATL M  V+K GG   GG NFDAK RR S  VED+ +A+I
Sbjct  298  NEGDLLLGWDTDQFPFNVYDATLCMYEVLKAGGFTDGGLNFDAKTRRPSNTVEDLLLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GLR A +LIED  L      RYQSF++E G  I   K   E L + AL+  E
Sbjct  358  HGMDTYALGLRKAVELIEDERLDNFKENRYQSFNTEFGQKILNNKITLEELTEHALKNQE  417

Query  189  PKVPSAKQELAEMILQSAL  133
            P V S KQE  EMI+   L
Sbjct  418  PDVKSGKQEYLEMIVNQIL  436



>ref|XP_002904118.1| xylose isomerase 1 [Phytophthora infestans T30-4]
 gb|EEY54296.1| xylose isomerase 1 [Phytophthora infestans T30-4]
Length=469

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 139/198 (70%), Gaps = 0/198 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL ++FKLNIE NH TL+GH   H++  A    +LG++D 
Sbjct  252  PMKHQYDYDAATVVAFLHTYGLQNDFKLNIEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  311

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +++ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  312  NTGDPLVGWDTDQFLMDEKKAVLVMKKIVEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  371

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L ELV++RY S+ S LG  IE G+A  E +   A E GE
Sbjct  372  GSMDCFARGLRQAAKLLEKNELGELVKQRYASWKSTLGERIEQGQATLEEVAAYAKESGE  431

Query  189  PKVPSAKQELAEMILQSA  136
            P   S KQELAE++  + 
Sbjct  432  PDHVSGKQELAELMWSTV  449



>ref|WP_016205623.1| xylose isomerase [Clostridium sartagoforme]
 gb|EOR28235.1| xylose isomerase [Clostridium sartagoforme AAU1]
Length=439

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 140/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLR  GL   FK+NIE NHATL+GH+  HEV  ARING+LG++D 
Sbjct  238  PTKHQYDFDVATVLAFLRNYGLDKYFKMNIEANHATLAGHTFQHEVALARINGVLGSLDI  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL+M  V+KNGG+  GG NFDAK+RR S +VED+F+ +I
Sbjct  298  NQGDPNLGWDTDQFPTNIYDATLLMYEVLKNGGIGQGGLNFDAKVRRASFEVEDLFLGYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDTLA+GLR A K++E+G  +  V +RY+SF   +G  I  GKADFE LEK AL    
Sbjct  358  AGMDTLAQGLRIAYKMLEEGEFEAAVAERYKSFTEGIGKDILEGKADFESLEKYALTNSL  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QEL E  L   +
Sbjct  418  IKNKSGRQELLEAKLNQYI  436



>emb|CDQ80418.1| unnamed protein product [Oncorhynchus mykiss]
Length=438

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+   L   FKLNIE NH TL+GHS  H+V  A + G+LG++D+
Sbjct  240  PCKHQYDYDAMSVIGFLKHYDLDSHFKLNIEPNHTTLAGHSYEHDVVMASVFGMLGSVDS  299

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   T++M +VI+ GGL PGG NFDAK+RRESTD+ED+FIAH+
Sbjct  300  NTGSPDLGWDTDQFPMDIRNTTMIMKTVIEQGGLQPGGLNFDAKVRRESTDLEDLFIAHV  359

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR+A ++IE+G +  +V++RY SF   +G  +E G    E LE    + GE
Sbjct  360  GAMDAFARGLRNAVRIIEEGVITSMVKERYMSFSHGIGQKVEDGSTSLEELEDFVKQNGE  419

Query  189  PKVPSAKQELAEMILQSAL  133
            PKV S KQE  E +    L
Sbjct  420  PKVTSGKQEKYETVFNHYL  438



>ref|XP_008321922.1| PREDICTED: xylose isomerase-like isoform X2 [Cynoglossus semilaevis]
Length=407

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P +HQYD+DA +   FL+  GL D FKLNIE NH TL+GHS  H++  A   G+LG++DA
Sbjct  209  PCRHQYDYDAMSVIGFLKHYGLQDHFKLNIEPNHTTLAGHSYEHDIVMASAFGMLGSVDA  268

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   TLVM ++I+ GGL PGG NFDAK+RRESTD+ D+FIAHI
Sbjct  269  NTGSPDLGWDTDQFPMDIKNTTLVMKTIIEQGGLQPGGLNFDAKVRRESTDLVDLFIAHI  328

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR+A ++++DG +  +V +RY SF   LG  ++ G A  E +E   ++ GE
Sbjct  329  GAMDAFARGLRNAVRIMDDGIMTGMVMERYSSFSHGLGHKVDNGSATLEEMEDFVIQNGE  388

Query  189  PKVPSAKQELAEMILQSAL  133
            P+V S KQE  E I    +
Sbjct  389  PEVKSGKQEKYESIFNHYI  407



>ref|XP_006636149.1| PREDICTED: xylose isomerase-like [Lepisosteus oculatus]
Length=378

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 139/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+   L   FKLNIE NH TL+GHS  H++  A   G+LG++D+
Sbjct  180  PCKHQYDYDAMSVIGFLKHFELDSYFKLNIEPNHTTLAGHSYEHDIIMASAFGMLGSVDS  239

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   T+VM  VI+ GGL PGG NFDAK+RRESTD+ED+FIAH+
Sbjct  240  NTGSPDLGWDTDQFPMDIKNTTMVMKCVIEQGGLQPGGLNFDAKVRRESTDLEDLFIAHV  299

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MDT ARGLRSA ++IE+G + +++++RY SF S +G+ +E G A    LE+   + GE
Sbjct  300  GAMDTFARGLRSAVQIIEEGVIAQMLQQRYLSFSSGIGSMVEEGTATLVELEEFIKQNGE  359

Query  189  PKVPSAKQELAEMILQSAL  133
            PK  S KQE  E I    L
Sbjct  360  PKTTSGKQEKYESIFNHYL  378



>ref|XP_008290598.1| PREDICTED: xylose isomerase-like [Stegastes partitus]
Length=440

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+  GL   FKLNIE NH TL+GHS  H+V  A   G+LG++D+
Sbjct  242  PCKHQYDYDAMSVIGFLKHYGLESHFKLNIEPNHTTLAGHSYEHDVVMASAFGMLGSVDS  301

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   TLVM ++I+ GGL PGG NFDAK+RRESTD+ED+FIAHI
Sbjct  302  NTGSPDLGWDTDQFPMDIRNTTLVMKTIIEQGGLQPGGLNFDAKVRRESTDLEDLFIAHI  361

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR+A +++EDG +  ++++RY SF   LG  +E G A  E +E    + GE
Sbjct  362  GAMDAFARGLRNAVRILEDGLIGGMLKERYSSFSHGLGQKVEEGSATLEEMEAFVNQNGE  421

Query  189  PKVPSAKQELAEMILQSAL  133
            PKV S KQE  E I    +
Sbjct  422  PKVTSGKQEKYESIFNHYI  440



>ref|WP_044593090.1| xylose isomerase, partial [Peptoclostridium difficile]
Length=228

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  21   PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  80

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  81   NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  140

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  141  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  200

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  201  IKNKSGRQEMLEAILNRYI  219



>gb|ADD61976.1| putative protein [uncultured organism]
Length=291

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 138/201 (69%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+ H+  HE+  AR NG+ G+IDA
Sbjct  88   PTKHQYDFDTATVLGFLRKYGLDKDFKMNIEANHATLAQHTFQHELRVARDNGVFGSIDA  147

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP +  +ATL M  V+K GG   GG NFDAK RR S  +EDIF+++I
Sbjct  148  NQGDPLLGWDTDQFPTNAYDATLCMYEVLKAGGFTNGGLNFDAKARRGSYTMEDIFLSYI  207

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL++AAK+IEDG L + V  RY S+ + +GA I  GKAD E LEK A+E GE
Sbjct  208  AGMDTFALGLKAAAKIIEDGRLDKFVDDRYASWTTGIGADIIAGKADMESLEKYAVEKGE  267

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QE  E +L   +
Sbjct  268  VTDSLSSGRQEYLESVLNQIM  288



>emb|CBK25455.2| unnamed protein product [Blastocystis hominis]
Length=435

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DA T   FLRK GL  +FKLNIE NH TL+GH   H++  A   G+LG++DA
Sbjct  237  PTKHQYDYDAQTVIGFLRKYGLEKDFKLNIEPNHTTLAGHDYEHDIVFACNEGMLGSVDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFPMDV +A +VM  +I+ GGL  GG NFDA +RRESTD+ED FIAHI
Sbjct  297  NTGDTLLGWDTDQFPMDVKKAVIVMYHIIRAGGLHSGGLNFDAHVRRESTDMEDRFIAHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MDT AR L    K++ D   +E+V KRY+S+ + +GA IE G+A FE  EK  LE G+
Sbjct  357  GAMDTFARALLIVEKIMNDKIYQEMVDKRYESYTTGIGARIENGEATFEECEKYILENGK  416

Query  189  PKVPSAKQELAEMIL  145
            P+  SAKQE  EM+L
Sbjct  417  PEPQSAKQEKFEMLL  431



>ref|XP_010883508.1| PREDICTED: xylose isomerase-like [Esox lucius]
Length=501

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DA +   FL+  GL   FKLNIE NH TL+GHS  H++  A + G+LG++D+
Sbjct  303  PCKHQYDYDAMSVIGFLKHFGLDSHFKLNIEPNHTTLAGHSYEHDIVMASVFGMLGSVDS  362

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   T+VM +V++ GGL  GG NFDAK+RRESTD+ED+FIAHI
Sbjct  363  NTGSPDLGWDTDQFPMDIRNTTMVMKTVVEQGGLKTGGLNFDAKVRRESTDIEDLFIAHI  422

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  +RGLR+A +++EDG +  +V++RY SF   +G  +E G A  E LE    + GE
Sbjct  423  GAMDAFSRGLRNAVRILEDGVITSMVKERYMSFSHGIGQKVEDGSASLEDLEDFVKQNGE  482

Query  189  PKVPSAKQELAEMILQSAL  133
            PKV S KQE  E +    L
Sbjct  483  PKVTSGKQEKYETVFNHYL  501



>ref|XP_002739772.1| PREDICTED: xylose isomerase-like [Saccoglossus kowalevskii]
Length=189

 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 136/188 (72%), Gaps = 0/188 (0%)
 Frame = -2

Query  696  TTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDT  517
            T   FL+   L +++KLNIE NH TL+GH   H++  A   G+LG++D+N+G P  GWDT
Sbjct  2    TVIAFLKHYNLDNQYKLNIEPNHTTLAGHGYEHDIVMASAFGMLGSVDSNTGSPDLGWDT  61

Query  516  DQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLR  337
            DQFPMD+   TLVM +V+  GGL PGG NFDAK+RREST+++D+FIAHIG MD+ ARGLR
Sbjct  62   DQFPMDIKNTTLVMKAVLDQGGLKPGGLNFDAKVRRESTNLQDMFIAHIGAMDSFARGLR  121

Query  336  SAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELA  157
            +A K+I+DG L  LV++RY S+ +++GA IE  K  FE LEK A+E GEPK  S +QE  
Sbjct  122  NAVKIIKDGVLPNLVQERYSSYTNDIGAKIEKNKTSFEELEKYAMEQGEPKKISGQQEKY  181

Query  156  EMILQSAL  133
            E IL + +
Sbjct  182  ESILNNYI  189



>ref|WP_039037140.1| xylose isomerase [Pseudoalteromonas sp. ECSMB14103]
Length=439

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 141/204 (69%), Gaps = 5/204 (2%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL +E K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLHKHGLQNEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TL+M  ++KNGG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLIMYEILKNGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  ELG +I  G+   E L   AL  
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELSDFVEKRYAGWKEELGRSILNGEQSLESL--SALVH  415

Query  195  GE---PKVPSAKQELAEMILQSAL  133
            G+   PK  S +QEL E I+   L
Sbjct  416  GQDINPKQVSGRQELLENIVNRYL  439



>gb|EQF74127.1| xylose isomerase [Peptoclostridium difficile CD212]
Length=272

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  65   PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  124

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  125  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  184

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  185  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  244

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  245  IKNKSGRQEMLEAILNRYI  263



>ref|XP_008321921.1| PREDICTED: xylose isomerase-like isoform X1 [Cynoglossus semilaevis]
Length=439

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P +HQYD+DA +   FL+  GL D FKLNIE NH TL+GHS  H++  A   G+LG++DA
Sbjct  241  PCRHQYDYDAMSVIGFLKHYGLQDHFKLNIEPNHTTLAGHSYEHDIVMASAFGMLGSVDA  300

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   TLVM ++I+ GGL PGG NFDAK+RRESTD+ D+FIAHI
Sbjct  301  NTGSPDLGWDTDQFPMDIKNTTLVMKTIIEQGGLQPGGLNFDAKVRRESTDLVDLFIAHI  360

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR+A ++++DG +  +V +RY SF   LG  ++ G A  E +E   ++ GE
Sbjct  361  GAMDAFARGLRNAVRIMDDGIMTGMVMERYSSFSHGLGHKVDNGSATLEEMEDFVIQNGE  420

Query  189  PKVPSAKQELAEMILQSAL  133
            P+V S KQE  E I    +
Sbjct  421  PEVKSGKQEKYESIFNHYI  439



>ref|WP_020532079.1| hypothetical protein [Flexithrix dorotheae]
Length=438

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P+KHQYD+DAAT   FL + GL D+FKLNIE NHATL+GH+  H++  A  + +LG+IDA
Sbjct  240  PSKHQYDFDAATVIGFLHQQGLADDFKLNIEANHATLAGHTFAHDIRVAADHKMLGSIDA  299

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTD FP D+ +AT VM+ ++++GGL  GGFNFDAK+RR STD+EDIFI+HI
Sbjct  300  NQGDYQNGWDTDYFPHDIYDATEVMMVLLESGGLGKGGFNFDAKVRRNSTDLEDIFISHI  359

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  ARGL  A K++++ +  +L + RY SFDS  GAA E G+ + E L + A+E GE
Sbjct  360  AGMDIFARGLLVADKILKETNFTQLKKDRYSSFDSGKGAAYEKGELNLEALREIAVEVGE  419

Query  189  PKVPSAKQELAEMILQSAL  133
            PK  S KQEL E ++   +
Sbjct  420  PKKISGKQELFESLVNQCI  438



>ref|XP_009537174.1| hypothetical protein PHYSODRAFT_306712 [Phytophthora sojae]
 gb|EGZ07608.1| hypothetical protein PHYSODRAFT_306712 [Phytophthora sojae]
Length=587

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 138/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL   GL  +FKLN+E NH TL+GH   H++  A    +LG++D 
Sbjct  388  PMKHQYDYDAATVIAFLHTYGLQHDFKLNVEPNHTTLAGHDYEHDIYYAASYKMLGSVDC  447

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MD  +A LVM  +++ GGLAPGG NFDAK+RRESTD+EDIFIAHI
Sbjct  448  NTGDPLVGWDTDQFLMDEKKAVLVMKKIVEIGGLAPGGLNFDAKVRRESTDLEDIFIAHI  507

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGLR AAKL+E   L E+V++RY S+ S LG  IE G+A  E +   A E GE
Sbjct  508  GSMDCFARGLRQAAKLLEKNELGEMVKQRYASWKSALGERIEDGRATLEEVAAYAKEAGE  567

Query  189  PKVPSAKQELAEMIL  145
            P   S KQELAE++L
Sbjct  568  PDHVSGKQELAELML  582



>gb|ELU13203.1| hypothetical protein CAPTEDRAFT_149382 [Capitella teleta]
Length=442

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DA T   FL+  GL  +FK+N+E NH TL+GH   H++  A   G+LG+ID+
Sbjct  244  PTKHQYDYDAMTVIAFLKNFGLEKDFKINVEPNHTTLAGHCYEHDIVMASAFGMLGSIDS  303

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD    T+VM +V++ GG+ PGG NFDAK+RREST+V D+FIAHI
Sbjct  304  NTGSPDLGWDTDQFPMDTKACTMVMKTVLEQGGIQPGGLNFDAKVRRESTEVSDMFIAHI  363

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD  ARGL++AA+LIEDG +K+ +  RY+SF  ++GA I+ G A  E  E   L+ GE
Sbjct  364  GAMDAFARGLKNAARLIEDGIIKKNLEARYKSFSVDIGAKIKAGSATLEECEAFILKNGE  423

Query  189  PKVPSAKQELAEMIL  145
            PK  S KQE  E +L
Sbjct  424  PKKTSGKQEHFESML  438



>ref|XP_004356776.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
 gb|ELR24876.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
Length=437

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FL+   L  ++K+NIE NH TL+GH+  HE+  A   G LG+IDA
Sbjct  239  PTKHQYDFDTAAVVAFLKSYNLDKDYKVNIEANHCTLAGHTFEHELTYASAYGFLGSIDA  298

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GDP  GWDTDQF MDV + TL M  V++ GGL PGG NFDAKLRRES+D+ED+FI HI
Sbjct  299  NTGDPLLGWDTDQFNMDVKQTTLAMQVVLRQGGLQPGGLNFDAKLRRESSDLEDLFIGHI  358

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT ARGL +AA+L E+G+ +    +RY S+  ELG  I  G+  F  LE+ AL+ GE
Sbjct  359  AGMDTFARGLLAAARLEEEGTFQAWRDERYASWKGELGQKIVSGQVTFAELEQFALQAGE  418

Query  189  PKVPSAKQELAEMIL  145
            PK  SAKQE  EM+L
Sbjct  419  PKQVSAKQEKYEMLL  433



>ref|WP_019027960.1| xylose isomerase [Colwellia piezophila]
Length=438

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 138/198 (70%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+G+  E  +NIE NHATL+GHS HHEV  A   G+LG+I
Sbjct  237  QEPTKHQYDYDTATVAGFLHKHGIAGEVHVNIEANHATLAGHSFHHEVAVACAEGILGSI  296

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLVM  ++KNGGL  GGFNFD KLRR+S + +D+FIA
Sbjct  297  DANRGDMQNGWDTDQFPNDVAECTLVMYEILKNGGLDTGGFNFDTKLRRQSCERDDLFIA  356

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AAKLIED  L   V +RY  +  +LG +I  G    + L K  L+ 
Sbjct  357  HIGGMDTMAKALLNAAKLIEDAPLSNFVDERYAGWKGQLGQSIMSGDHSLDSLSKLVLDN  416

Query  195  G-EPKVPSAKQELAEMIL  145
               PK  S +QEL E I+
Sbjct  417  DINPKQESGRQELLENIV  434



>ref|XP_003387079.1| PREDICTED: xylose isomerase-like [Amphimedon queenslandica]
Length=460

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 141/199 (71%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DA T  +FL+  GL  +FKLNIE NH TL+GH   H+V  A   G+LG+ID+
Sbjct  260  PTKHQYDYDAQTVISFLKTYGLDTDFKLNIEPNHTTLAGHGHEHDVVVASKFGMLGSIDS  319

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPM++   TL+M ++I+ GGLAPGG NFD K+RRES D++D+FIAHI
Sbjct  320  NTGSPDLGWDTDQFPMEIKNTTLIMKAIIEQGGLAPGGLNFDCKVRRESIDLQDLFIAHI  379

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MD+ ARGL  A +L   G +++ V+ RY S+DS +G++IE GKA  E LE+     G 
Sbjct  380  GAMDSFARGLMCAVELFNQGVMEKCVKDRYSSYDSGIGSSIENGKASLEQLEEYIKANGF  439

Query  189  PKVPSAKQELAEMILQSAL  133
            P   S +QE+ E++  +AL
Sbjct  440  PTPTSGQQEMYEVLFNNAL  458



>gb|EFX66553.1| hypothetical protein DAPPUDRAFT_218978 [Daphnia pulex]
Length=399

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 139/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PT+HQYD+DA T  +FLR+  L ++FKLNIE NH TL+GH   H+V  A   G+LG+IDA
Sbjct  201  PTRHQYDYDAQTVMSFLRQFNLQNDFKLNIEPNHTTLAGHGYEHDVVMASTFGILGSIDA  260

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMD+   T VML VI+ GG+ PGG NFDAK+RREST+ +D+FIAHI
Sbjct  261  NTGSPDLGWDTDQFPMDIRACTAVMLQVIRQGGVQPGGLNFDAKVRRESTNTKDLFIAHI  320

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
              MD+ ARGLR+A+K++EDG +   +++RY SF+S  G  I  G  D E  E+   + GE
Sbjct  321  AAMDSFARGLRNASKIVEDGIMARHLKERYISFESGFGLKICNGLTDLEECEEFIHQHGE  380

Query  189  PKVPSAKQELAEMILQSAL  133
            P++ S +QE  E I    L
Sbjct  381  PEMISGQQEHCEAIFNRYL  399



>ref|WP_007061694.1| xylose isomerase [Clostridium carboxidivorans]
 gb|EET86757.1| xylose isomerase [Clostridium carboxidivorans P7]
 gb|EFG89380.1| xylose isomerase [Clostridium carboxidivorans P7]
Length=440

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 139/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L + FK+NIE NHATL+GH+  HE+  AR N +LG++DA
Sbjct  238  PTKHQYDFDVATVLGFLRKYKLENYFKVNIEANHATLAGHTFQHEICLARNNNVLGSLDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL M  ++KNGG+APGG NFDAK+RR S + ED+F+++I
Sbjct  298  NQGDPHLGWDTDQFPTNIYDATLAMYEILKNGGIAPGGLNFDAKVRRASFEPEDLFLSYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GLR A KL++DG ++  +++RY SF + +G  I  GK  FE LEK AL    
Sbjct  358  AGMDTFAKGLRIAYKLLQDGPIENFIKERYSSFSTGIGKDIVDGKVGFEELEKYALSNNV  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QE  E I+   +
Sbjct  418  MNNKSGRQEYLESIVNQYI  436



>gb|ERM41646.1| xylose isomerase [Clostridium difficile P68]
Length=316

 Score =   221 bits (562),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  109  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINDVLGSIDA  168

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  169  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  228

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  229  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  288

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  289  IKNKSGRQEMLEAILNRYI  307



>ref|WP_010556356.1| xylose isomerase [Pseudoalteromonas marina]
 gb|ERG25884.1| xylose isomerase [Pseudoalteromonas marina mano4]
Length=439

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL +E K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLHKHGLQNEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TL+M  ++KNGG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLIMYEILKNGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  ELG +I  G+   E L   AL  
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELSDFVEKRYAGWKEELGQSILNGEQSLESL--SALVH  415

Query  195  GE---PKVPSAKQELAEMIL  145
            G+   P+  S +QEL E I+
Sbjct  416  GQNINPEQVSGRQELLENIV  435



>ref|WP_016710605.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 139/198 (70%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL DE K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLHKHGLQDEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLVM  ++K+GGL  GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLVMYEILKSGGLTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  +LG +I  G+   E L     E 
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELADFVEKRYAGWKEDLGQSILKGEQSLESLAALVHEN  417

Query  195  G-EPKVPSAKQELAEMIL  145
              +PK  S +QEL E I+
Sbjct  418  NIDPKQVSGRQELLENIV  435



>ref|WP_008131330.1| xylose isomerase [Pseudoalteromonas sp. BSi20480]
 dbj|GAA76310.1| xylose isomerase [Pseudoalteromonas sp. BSi20480]
Length=439

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 138/202 (68%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL +E K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLHKHGLQNEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TL+M  ++KNGG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLIMYEILKNGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  ELG +I  G+   E L     + 
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELSDFVEKRYAGWKEELGQSILNGEQSLESLSALVHQQ  417

Query  195  G-EPKVPSAKQELAEMILQSAL  133
               P+  S +QEL E I+   L
Sbjct  418  NINPEQVSGRQELLENIVNRYL  439



>gb|AAR09155.1| xylose isomerase [Mannheimia granulomatis]
Length=239

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +E K+NIE NHATL+GH+  HE+ TA   G+ G+I
Sbjct  36   QEPTKHQYDYDVATVYGFLKQFGLENEIKMNIEANHATLAGHTFQHEIATATALGIFGSI  95

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E TLVM  ++K GG   GGFNFDAK+RR+STD  D+F A
Sbjct  96   DANRGDPQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHA  155

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIG MD LA  L+ AAK+ ED +L+++V  RY  ++ +LG  I  GKA  E L K     
Sbjct  156  HIGAMDVLALSLKQAAKMFEDQTLQKVVDNRYAGWNQDLGQQILTGKASLEALAKIVETQ  215

Query  195  G-EPKVPSAKQELAEMILQSAL  133
            G +PK  S +QE  E ++ S +
Sbjct  216  GLDPKPVSGQQEYLENLVNSYI  237



>ref|WP_039882234.1| xylose isomerase [Mesotoga infera]
Length=440

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK GL + FK N+E NHATL+GH+  HE+  ARIN LLG++DA
Sbjct  237  PTKHQYDFDVANALAFLRKFGLEENFKFNVEANHATLAGHTFQHELRFARINDLLGSVDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP D+   TL M  +IKNGGL PGG NFDAK+RR S D  D+FI HI
Sbjct  297  NQGDPLLGWDTDQFPTDLYSTTLGMYEIIKNGGLNPGGLNFDAKVRRGSYDERDLFIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL++AAKLI++G+L+ L++ RY+S+ S +G  I  G ADF  LE+  ++   
Sbjct  357  AGMDTFALGLKAAAKLIDEGTLESLLKDRYRSYQSGVGKEITEGIADFRSLEEYIIDKKN  416

Query  189  PKVPSAKQELAEMILQSAL  133
            P    + QE  E ++  A+
Sbjct  417  PLPEPSNQEYLERLVNWAI  435



>emb|CCU83726.1| Xylose isomerase [Mesotoga infera]
Length=446

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK GL + FK N+E NHATL+GH+  HE+  ARIN LLG++DA
Sbjct  243  PTKHQYDFDVANALAFLRKFGLEENFKFNVEANHATLAGHTFQHELRFARINDLLGSVDA  302

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP D+   TL M  +IKNGGL PGG NFDAK+RR S D  D+FI HI
Sbjct  303  NQGDPLLGWDTDQFPTDLYSTTLGMYEIIKNGGLNPGGLNFDAKVRRGSYDERDLFIGHI  362

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL++AAKLI++G+L+ L++ RY+S+ S +G  I  G ADF  LE+  ++   
Sbjct  363  AGMDTFALGLKAAAKLIDEGTLESLLKDRYRSYQSGVGKEITEGIADFRSLEEYIIDKKN  422

Query  189  PKVPSAKQELAEMILQSAL  133
            P    + QE  E ++  A+
Sbjct  423  PLPEPSNQEYLERLVNWAI  441



>ref|WP_014731027.1| xylose isomerase [Mesotoga prima]
 gb|AFK07082.1| xylose isomerase [Mesotoga prima MesG1.Ag.4.2]
Length=440

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK GL + FK N+E NHATL+GH+  HE+  ARIN LLG++DA
Sbjct  237  PTKHQYDFDVANALAFLRKFGLEENFKFNVEANHATLAGHTFQHELRFARINDLLGSVDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP D+   TL M  +IKNGGL PGG NFDAK+RR S D  D+FI HI
Sbjct  297  NQGDPLLGWDTDQFPTDLYSTTLGMYEIIKNGGLNPGGLNFDAKVRRGSYDERDLFIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL++AAKLI++G+L+ L++ RY S+ S +G  I  G ADF  LE+  ++   
Sbjct  357  AGMDTFALGLKAAAKLIDEGTLESLLKDRYSSYQSGVGKEITEGIADFRSLEEYIIDKKN  416

Query  189  PKVPSAKQELAEMILQSAL  133
            P    + QE  E ++  A+
Sbjct  417  PLPEPSNQEYLERLVNWAI  435



>gb|EFP62823.1| putative xylose isomerase [Erysipelotrichaceae bacterium 3_1_53]
Length=300

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D  T   FL+  GL D F+LNIE NHATL+ H+  HE+  ARING+LG++DA
Sbjct  100  PTKHQYDFDVQTVIGFLKTYGLDDRFQLNIEANHATLASHTFQHELNMARINGMLGSVDA  159

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  +++ GGL  GG NFDAK+RRES  +EDI  A+I
Sbjct  160  NQGDMLLGWDTDQFPTNLYDATLAMYEILQTGGLKSGGLNFDAKVRRESFTMEDIAYAYI  219

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GLR+AA L+EDG LK+ V++RY+S+   +G  I  GK DF  L   AL    
Sbjct  220  AGMDTYAKGLRTAALLLEDGILKQAVKERYESYTYGIGKKISEGKTDFRELSAYALSLPT  279

Query  189  PKVPSAKQELAEMILQSAL*K  127
              + S KQE  E IL   L K
Sbjct  280  ITIGSGKQERLERILSDYLVK  300



>ref|WP_018756053.1| xylose isomerase [Paenibacillus terrigena]
Length=437

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT NFLR  GL D FKLN+E NHATL+GH+  HE+  A ING+LG++DA
Sbjct  236  PTKHQYDFDAATTMNFLRTYGLQDHFKLNLEANHATLAGHTFEHEIRVASINGMLGSLDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP D+ + TL M  V+KNGG+  GG NFDAK+RR S + ED+F AHI
Sbjct  296  NQGDMLLGWDTDEFPQDLTQTTLTMYEVLKNGGIGRGGVNFDAKVRRASFEQEDLFFAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+GL+ AAKLIED  L+E+V  RY+SF   +GA I  G A  + LE  A +   
Sbjct  356  AGMDAYAKGLKVAAKLIEDRVLEEVVESRYRSFQVGIGAEIAAGTATLKSLEAYAYQNHP  415

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S +QE  + ++   L
Sbjct  416  IRNVSGRQERIKAVVNEYL  434



>ref|WP_028537509.1| MULTISPECIES: xylose isomerase [Paenibacillus]
Length=438

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL D FKLN+E NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  236  PTKHQYDFDAATTIAFLQKYGLQDHFKLNLEANHATLAGHTFEHELRVARINNMLGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP D+   TL M  ++KNGGL  GG NFDAK+RR S + ED+F AHI
Sbjct  296  NQGDMLLGWDTDEFPTDLYAVTLAMYEILKNGGLGSGGVNFDAKVRRTSFEPEDLFYAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
             GMDT A+GL+ A K+IED  ++ L+ +RY SF S +GA I  GKA+F+ LE  ALE
Sbjct  356  AGMDTFAKGLKVAGKMIEDNFIENLIEERYASFKSGIGADIVSGKANFKTLEAYALE  412



>gb|EOS54587.1| xylose isomerase [Paenibacillus barengoltzii G22]
Length=439

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL D FKLN+E NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAATTIAFLQKYGLQDHFKLNLEANHATLAGHTFEHELRVARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP D+   TL M  ++KNGGL  GG NFDAK+RR S + ED+F AHI
Sbjct  297  NQGDMLLGWDTDEFPTDLYAVTLAMYEILKNGGLGSGGVNFDAKVRRTSFEPEDLFYAHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
             GMDT A+GL+ A K+IED  ++ L+ +RY SF S +GA I  GKA+F+ LE  ALE
Sbjct  357  AGMDTFAKGLKVAGKMIEDNFIENLIEERYASFKSGIGADIVSGKANFKTLEAYALE  413



>gb|EES74125.1| xylose isomerase [Paenibacillus sp. oral taxon 786 str. D14]
Length=439

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL D FKLN+E NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAATTIAFLQKYGLQDHFKLNLEANHATLAGHTFEHELRVARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP D+   TL M  ++KNGGL  GG NFDAK+RR S + ED+F AHI
Sbjct  297  NQGDMLLGWDTDEFPTDLYAVTLAMYEILKNGGLGSGGVNFDAKVRRTSFEPEDLFYAHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
             GMDT A+GL+ A K+IED  ++ L+ +RY SF S +GA I  GKA+F+ LE  ALE
Sbjct  357  AGMDTFAKGLKVAGKMIEDNFIENLIEERYASFKSGIGADIVSGKANFKTLEAYALE  413



>ref|WP_036644393.1| xylose isomerase [Paenibacillus sp. oral taxon 786]
Length=438

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL D FKLN+E NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  236  PTKHQYDFDAATTIAFLQKYGLQDHFKLNLEANHATLAGHTFEHELRVARINNMLGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP D+   TL M  ++KNGGL  GG NFDAK+RR S + ED+F AHI
Sbjct  296  NQGDMLLGWDTDEFPTDLYAVTLAMYEILKNGGLGSGGVNFDAKVRRTSFEPEDLFYAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
             GMDT A+GL+ A K+IED  ++ L+ +RY SF S +GA I  GKA+F+ LE  ALE
Sbjct  356  AGMDTFAKGLKVAGKMIEDNFIENLIEERYASFKSGIGADIVSGKANFKTLEAYALE  412



>ref|WP_038164239.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=437

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 141/196 (72%), Gaps = 1/196 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD DAA   NFLR+  L+  FKLN+E NHATL+GHS  HE+E A   G LG++DA
Sbjct  238  PTKHQYDSDAAACLNFLREYDLLPYFKLNLETNHATLAGHSMQHEMEVAGAAGALGSLDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQF  D + AT +ML+ +K GGL  GG NFDAK+RRES D ED+F +HI
Sbjct  298  NTGDLLLGWDTDQFLTDASTATQMMLTTLKYGGLTTGGVNFDAKVRRESVDPEDLFYSHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMDT ARGL++AA +  DG L + V++RY ++D+ LGA+IE GK  F  LE  ALE GE
Sbjct  358  GGMDTFARGLKNAAAIRADGRLGDFVKQRYSTWDTGLGASIEAGKESFSSLEAFALEKGE  417

Query  189  P-KVPSAKQELAEMIL  145
              +VPS +QE  E ++
Sbjct  418  ATQVPSGRQEFLENLV  433



>ref|WP_010074860.1| xylose isomerase [Clostridium cellulovorans]
 gb|ADL50361.1| xylose isomerase [Clostridium cellulovorans 743B]
Length=439

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+ H+  HEV  AR+NG+LG++D 
Sbjct  238  PTKHQYDFDVATVLGFLRKYNLEKYFKMNIEANHATLAQHTFQHEVAVARVNGVLGSLDV  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +AT+VM  V+KNGG+APGG NFDAK RR S + ED+F+++I
Sbjct  298  NQGDPNLGWDTDQFPTNIYDATMVMYEVLKNGGIAPGGLNFDAKTRRASFEPEDLFLSYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT+A+GLR A  L++D  L+    +RY++F   +G  I  GK DFE LEK ALE   
Sbjct  358  AGMDTMAKGLRVAYSLLDDAVLENNTSERYKTFSEGIGKDIVEGKVDFESLEKYALENSV  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QE  E ++   +
Sbjct  418  ISNKSGRQEYLESVVNQYI  436



>ref|WP_009959227.1| xylose isomerase [Verrucomicrobium spinosum]
Length=437

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 141/196 (72%), Gaps = 1/196 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD DAA   NFLR+  L+  FKLN+E NHATL+GHS  HE+E A   G LG++DA
Sbjct  238  PTKHQYDSDAAACLNFLREYDLLPYFKLNLETNHATLAGHSMQHEMEVAGAAGALGSLDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQF  D + AT +ML+ +K GGL  GG NFDAK+RRES D ED+F +HI
Sbjct  298  NTGDLLLGWDTDQFLTDASTATQMMLTALKYGGLTTGGVNFDAKVRRESVDPEDLFYSHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMDT ARGL++AA +  DG L + V++RY ++D+ LGA+IE GK  F  LE  ALE GE
Sbjct  358  GGMDTFARGLKNAAAIRADGRLGDFVKQRYSTWDTGLGASIEAGKESFSSLEAFALEKGE  417

Query  189  P-KVPSAKQELAEMIL  145
              +VPS +QE  E ++
Sbjct  418  ATQVPSGRQEYLENLV  433



>ref|XP_005090167.1| PREDICTED: xylose isomerase-like [Aplysia californica]
Length=338

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DA T   FLR  GL  E KLNIE NH TL+GHS  H+V  A    +LG++D+
Sbjct  140  PTKHQYDYDAMTVIAFLRTYGLEKEIKLNIEPNHTTLAGHSYEHDVVMASAYNMLGSVDS  199

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+G P  GWDTDQFPMDV  ATL+M  +++ GGL PGG NFD K+RRESTD++D+FI+HI
Sbjct  200  NTGSPDLGWDTDQFPMDVKNATLLMKVLLRQGGLQPGGLNFDCKVRRESTDLKDMFISHI  259

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            G MDT AR L+ AAK+ ++  + + V +RY++F S +GA IE G    E LE+  L+ GE
Sbjct  260  GAMDTFARALKCAAKIFDEEVISKQVEERYKTFQSGIGAKIESGDTTLEELEEYVLQNGE  319

Query  189  PKVPSAKQELAEMILQSAL  133
            P   S +QE  E +L   L
Sbjct  320  PSQISGQQEHFENMLNYYL  338



>ref|WP_026462632.1| xylose isomerase [Adhaeribacter aquaticus]
Length=444

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT   FL K GL D+FKLN+E NHATL+ H+  HE++ A   G+LG+IDA
Sbjct  246  PTKHQYDFDAATVIGFLNKFGLQDDFKLNLETNHATLANHTFAHELQVAVDAGMLGSIDA  305

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D+ E T  ML +++ GG+  GG NFDAKLRR STD++D+F AHI
Sbjct  306  NRGDYQNGWDTDQFPVDLYELTEAMLVILEGGGIMTGGVNFDAKLRRNSTDLDDLFHAHI  365

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL  AA ++E    K++ ++RY SFDS  G A E GK  FE L + A+  GE
Sbjct  366  GGMDAFARGLLIAADVLEKSDYKKIRQQRYASFDSGDGQAFEQGKLTFEELTQIAIRNGE  425

Query  189  PKVPSAKQELAEMILQSAL  133
            P+  S KQEL E I+   +
Sbjct  426  PQQISGKQELLENIINQYI  444



>ref|WP_018751681.1| xylose isomerase [Paenibacillus sanguinis]
Length=438

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PT HQYD+DAATT +FL+K GL D FKLN+E NHATL+GH+  HE++ ARIN +LG+IDA
Sbjct  236  PTTHQYDFDAATTISFLQKYGLQDHFKLNLEANHATLAGHTFQHELQVARINNMLGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTD+FP D+   TL M  +++NGG+  GG NFDAK+RR S + ED+F AHI
Sbjct  296  NQGDPLLGWDTDEFPTDMYAVTLAMYEILQNGGIGSGGVNFDAKVRRGSFEPEDLFYAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
             GMD+ ARGL+ A KL+ED   ++L+ +RY SF + +GA I  GKA+F+ LE  AL+
Sbjct  356  AGMDSFARGLKVAGKLVEDKFFEQLLEERYASFKTGIGADIVSGKANFKTLEAYALQ  412



>ref|WP_032079132.1| xylose isomerase [Clostridium drakei]
Length=440

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L + FK+NIE NHATL+GH+  HE+  AR N +LG++DA
Sbjct  238  PTKHQYDFDVATVLGFLRKYKLENYFKVNIEANHATLAGHTFQHEICLARNNNVLGSLDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL M  ++KNG +APGG NFDAK+RR S + ED+F+++I
Sbjct  298  NQGDPHLGWDTDQFPTNIYDATLAMYEILKNGDIAPGGLNFDAKVRRASFEPEDLFLSYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GLR A KL+ DG ++  +++RY SF + +G  I  GKA FE LEK AL    
Sbjct  358  AGMDTFAKGLRIAYKLLHDGPIENFIKERYSSFSTGIGKDIVDGKAGFEELEKYALSNNT  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QE  E I+   +
Sbjct  418  MNNQSGRQEYLESIVNQYI  436



>ref|WP_043090972.1| xylose isomerase, partial [Xanthomonas sp. SHU166]
Length=201

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+D+AT   FLR++GL  +FKLNIE NHATLSGHS  H+++ A   GLLG+IDA
Sbjct  1    PMKHQYDFDSATVVGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLLGSIDA  60

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N G+PQ GWDTDQFP+D+ +    ML V++ GGLAPGG NFDAK+RRES+D +D+FIAHI
Sbjct  61   NRGNPQNGWDTDQFPVDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDLFIAHI  120

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL  A  L+    L++  R+RY SFDS  GAA   G +    L   A + GE
Sbjct  121  GGMDAFARGLEVAHALLTASPLEQWRRERYASFDSGAGAAFAAGTSTLADLATHAAQAGE  180

Query  189  PKVPSAKQELAEMILQSAL  133
            P   S +QE  E ++   L
Sbjct  181  PTQRSGRQEAYENLINQYL  199



>gb|EGI71574.1| xylose isomerase [Pseudoalteromonas haloplanktis ANT/505]
Length=308

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 136/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D A+ A FL K+GL DE K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  107  QEPTKHQYDYDTASVAGFLHKHGLQDEIKVNIEANHATLAGHSFHHEIAVACAKGIMGSI  166

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLV+  ++KNGG   GGFNFD KLRR+S + +D+FI 
Sbjct  167  DANRGDMQNGWDTDQFPNDVAECTLVVYEILKNGGFTTGGFNFDTKLRRQSCERDDLFIG  226

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIG MDT+A+ L +AA +IE G L + V KRY  +  +LG +I  G+   E L     E 
Sbjct  227  HIGCMDTMAKALLNAAAMIEGGELSDFVEKRYAGWKEDLGQSILKGEQSLESLAALVHEN  286

Query  195  G-EPKVPSAKQELAEMIL  145
               PK  S +QEL E I+
Sbjct  287  DIYPKQVSGRQELLENIV  304



>ref|WP_013626379.1| xylose isomerase [Planctomyces brasiliensis]
 gb|ADY57635.1| D-xylose isomerase [Planctomyces brasiliensis DSM 5305]
Length=436

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 134/196 (68%), Gaps = 1/196 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A   NFLR+ GL D  K+NIE NHATL+GHS  HE+E ARI  +LG+IDA
Sbjct  237  PTKHQYDFDVAACVNFLRQYGLEDTVKMNIETNHATLAGHSMMHEMEYARIQDMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFP D+   T  ML ++K GGL PGG NFDAK+RRES D  D+F AHI
Sbjct  297  NTGDLLLGWDTDQFPTDIYLTTQCMLVILKQGGLKPGGINFDAKVRRESFDPTDLFYAHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARG + AA +  DG L + V+ RY S+DS +G  IE G A+FE L K  L+ GE
Sbjct  357  GGMDAFARGAKIAAAIRADGVLDDFVKDRYSSYDSGVGQEIEDGSANFESLSKYMLDKGE  416

Query  189  PKV-PSAKQELAEMIL  145
                 S +QE  E I+
Sbjct  417  ADANTSGRQEYLENII  432



>ref|WP_038670249.1| xylose isomerase [Ruminococcus bicirculans]
 emb|CCO03825.1| xylose isomerase [Ruminococcus bicirculans]
Length=441

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 138/201 (69%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+ H+  HE+  AR NG+ G+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYGLDKDFKMNIEANHATLAQHTFQHELRVARDNGVFGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP +  +ATL M  V+K GG   GG NFDAK RR S  +EDIF+++I
Sbjct  298  NQGDPLLGWDTDQFPTNAYDATLCMYEVLKAGGFTNGGLNFDAKARRGSYTMEDIFLSYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL++AAK+IEDG L + V  RY S+ + +GA I  GKAD E LEK A+E GE
Sbjct  358  AGMDTFALGLKAAAKIIEDGRLDKFVDDRYASWTTGIGADIIAGKADMESLEKYAVEKGE  417

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QE  E +L   +
Sbjct  418  VTDSLSSGRQEYLESVLNQIM  438



>ref|WP_022287212.1| xylose isomerase [Ruminococcus sp. CAG:57]
 emb|CDC67329.1| xylose isomerase [Ruminococcus sp. CAG:57]
Length=441

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 138/201 (69%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+ H+  HE+  AR NG+ G+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYGLDKDFKMNIEANHATLAQHTFQHELRVARDNGVFGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP +  +ATL M  V+K GG   GG NFDAK RR S  +EDIF+++I
Sbjct  298  NQGDPLLGWDTDQFPTNAYDATLCMYEVLKAGGFTNGGLNFDAKARRGSYTMEDIFLSYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL++AAK+IEDG L + V  RY S+ + +GA I  GKAD E LEK A+E GE
Sbjct  358  AGMDTFALGLKAAAKIIEDGRLDKFVDDRYASWTTGIGADIIAGKADMESLEKYAVEKGE  417

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QE  E +L   +
Sbjct  418  VTDSLSSGRQEYLESVLNQIM  438



>ref|WP_036626617.1| xylose isomerase [Paenibacillus macerans]
 gb|KFN11524.1| beta-xylosidase [Paenibacillus macerans]
Length=438

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL D FKLN+E NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  236  PTKHQYDFDAATTIAFLQKYGLQDHFKLNLEANHATLAGHTFEHELRVARINNMLGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTD+FP D+   TL M  +++NGGL  GG NFDAK+RR S + ED+F AHI
Sbjct  296  NQGDPLLGWDTDEFPTDLYAVTLAMYEILQNGGLGSGGVNFDAKVRRGSFEPEDLFYAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALE  199
             GMD+ A+GL+ A KLIED    +L+ +RY SF + +GA I  GKA+F+ LE  AL+
Sbjct  356  AGMDSFAKGLKVAGKLIEDKFFDKLIEERYASFKTGIGADIVSGKANFKTLEAYALQ  412



>ref|WP_013238479.1| MULTISPECIES: xylose isomerase [Clostridium]
 gb|ADK14887.1| predicted xylose isomerase [Clostridium ljungdahlii DSM 13528]
 gb|AGY78133.1| Xylose isomerase [Clostridium autoethanogenum DSM 10061]
Length=440

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L D FK+NIE NHATL+GH+  HE+  AR N  LG++DA
Sbjct  238  PTKHQYDFDVATVLGFLRKYKLEDYFKINIEANHATLAGHTFQHEICLARNNNALGSLDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP +V + TL M  V+KNGG+APGG NFDAK+RR S + ED+F+A+I
Sbjct  298  NQGDPHLGWDTDQFPTNVYDTTLSMYEVLKNGGIAPGGLNFDAKVRRASFEPEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD+ A+GLR A KL++D  ++  +++RY SF + +G  I  GK  F+ LEK ALE   
Sbjct  358  AGMDSFAKGLRVAYKLLQDAPIENFIKERYSSFSTGIGKDIVDGKVGFDELEKYALENNV  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QE  E ++   +
Sbjct  418  INNKSGRQEYLESVVNQYI  436



>ref|WP_029450677.1| xylose isomerase [Clostridium algidicarnis]
Length=437

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 133/201 (66%), Gaps = 0/201 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT   FLRK  L+D+FKLNIE NHATL+GH+  HE+  ARING+ G++DA
Sbjct  237  PTKHQYDFDAATVIGFLRKYDLMDDFKLNIEANHATLAGHTFPHELAVARINGVFGSVDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP DV EATL ML +IK GG   GG NFDAK+RR S   EDI   +I
Sbjct  297  NQGDSLLGWDTDQFPTDVKEATLSMLEIIKAGGFTNGGLNFDAKVRRPSFTFEDIVYGYI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL  A ++IEDG + E + KRY S++S +G  I   +   E LE   LE  E
Sbjct  357  SGMDTFALGLIKAYEVIEDGRIDEFIEKRYASYESGIGKKILNNEVTLEELEAYTLENKE  416

Query  189  PKVPSAKQELAEMILQSAL*K  127
              + S +QE  E IL   L K
Sbjct  417  RPMESGRQEYLETILNQILYK  437



>ref|WP_016601082.1| xylose isomerase, partial [Yersinia pestis]
Length=328

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 133/195 (68%), Gaps = 1/195 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL  E K+NIE NHATL+GHS HHE+ +A   G+ G++
Sbjct  125  QEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSV  184

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E TLVM  ++K GG   GG NFDAK+RR+STD  D+F  
Sbjct  185  DANRGDPQLGWDTDQFPNSVEENTLVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYG  244

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIG MDT+A  L+ AAK+IEDG L ++V KRY  ++SELG  I  GK   E L + A + 
Sbjct  245  HIGAMDTMALALKFAAKMIEDGQLDQIVAKRYAGWNSELGQQILQGKMSLEELSRYASQH  304

Query  195  G-EPKVPSAKQELAE  154
               P+  S  QEL E
Sbjct  305  NLNPQHQSGHQELLE  319



>ref|WP_037562869.1| xylose isomerase [Spirochaeta sp. JC202]
 gb|KGM43000.1| xylose isomerase [Spirochaeta sp. JC202]
Length=437

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT  +FLR   L D FKLNIE NHATL+GH+  H++  A I+G LG+IDA
Sbjct  239  PTKHQYDFDAATVLSFLRAYDLFDHFKLNIEANHATLAGHTFEHDLTVASIDGKLGSIDA  298

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQF  D A  TL ML V+K GG+  GG NFDAK RR S D  D+F AHI
Sbjct  299  NVGDPLLGWDTDQFATDPASCTLAMLVVLKQGGIGSGGLNFDAKPRRGSFDEIDLFYAHI  358

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT ARGL +A ++IEDG L + ++ RY S+   +G     G+  FE LE+  L+ G+
Sbjct  359  SGMDTFARGLLAAHQIIEDGVLDDFIKTRYASYQEGIGQRTMNGQESFESLEQYVLQQGD  418

Query  189  PKVPSAKQELAEMILQSAL  133
            P   S +QE+ E IL S +
Sbjct  419  PAFKSGRQEMLESILHSYV  437



>ref|WP_038172460.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=436

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P+ HQYD D+A   NFLR+ GL++ FKLNIE NHATL+GH+  HE+E A   G LG+IDA
Sbjct  238  PSTHQYDSDSAACLNFLREYGLLEHFKLNIETNHATLAGHTMRHELEVALAAGALGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFP D+   T +ML ++K GG   GG NFDAK+RRES +  D+F AHI
Sbjct  298  NTGDELIGWDTDQFPTDIYLTTEIMLVLLKMGGFTSGGLNFDAKVRRESFEPVDLFHAHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL+ AA +IEDG L   V++RY +FD+ +GA IE G+  FE LE   L+ GE
Sbjct  358  GGMDAFARGLKIAAAIIEDGRLDAFVKQRYSTFDNGIGAQIERGEVGFEELEAYTLKNGE  417

Query  189  PKVPSAKQELAEMILQ  142
            P + S +QE+ E ++ 
Sbjct  418  PPIGSGRQEMLENLVN  433



>ref|WP_028514448.1| xylose isomerase [Ruminococcus flavefaciens]
Length=438

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 136/201 (68%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+ H+  HE+  AR NG+ G+IDA
Sbjct  235  PTKHQYDFDTATVLGFLRKYGLDKDFKMNIEANHATLAQHTFQHELRVARDNGVFGSIDA  294

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ + T+ M  VIK GG   GG NFDAK RR S   EDIF+++I
Sbjct  295  NQGDPLLGWDTDQFPTNIYDTTMCMYEVIKAGGFTNGGLNFDAKARRGSFTPEDIFLSYI  354

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A G R+A KLIEDG + + V  RY S+ + +GA I  GKADF  LEK ALE GE
Sbjct  355  AGMDAFALGFRAALKLIEDGRIDKFVEDRYASWKTGIGADIIAGKADFASLEKYALEKGE  414

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QE+ E I+ + L
Sbjct  415  VTASLTSGRQEMLESIVNNVL  435



>ref|WP_024599023.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL DE K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLYKHGLQDEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLV+  ++K GG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLVVYEILKMGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  +LG +I  G+   E L     E 
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELSDFVEKRYAGWKEDLGQSILNGEQSLESLSALVHEN  417

Query  195  G-EPKVPSAKQELAEMIL  145
              +PK  S +QEL E I+
Sbjct  418  NIDPKQVSGRQELLENIV  435



>ref|WP_024594232.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL DE K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLYKHGLQDEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLV+  ++K GG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLVVYEILKMGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  +LG +I  G+   E L     E 
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELTDFVEKRYAGWKEDLGQSILNGEQSLESLSALVHEN  417

Query  195  G-EPKVPSAKQELAEMIL  145
              +PK  S +QEL E I+
Sbjct  418  NIDPKQVSGRQELLENIV  435



>ref|WP_007585153.1| xylose isomerase [Pseudoalteromonas sp. BSi20429]
 dbj|GAA68798.1| xylose isomerase [Pseudoalteromonas sp. BSi20429]
Length=439

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL DE K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLYKHGLQDEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLV+  ++K GG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLVVYEILKMGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  +LG +I  G+   E L     E 
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELTDFVEKRYAGWKEDLGQSILNGEQSLESLSALVHEN  417

Query  195  G-EPKVPSAKQELAEMIL  145
              +PK  S +QEL E I+
Sbjct  418  NIDPKQVSGRQELLENIV  435



>ref|WP_005654109.1| xylose isomerase [Bacteroides stercoris]
 gb|EDS15937.1| xylose isomerase [Bacteroides stercoris ATCC 43183]
 gb|AEK21499.1| xylose isomerase [Bacteroides stercoris]
Length=438

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD D  T   FL+ +GL  +FK+NIE NHATL+GH+  HE+  A  NG+LG+IDA
Sbjct  240  PTKHQYDADTETVVGFLKAHGLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDA  299

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D  E T  M+ +I+NGG   GG NFDAK RR STD+EDIFIAHI
Sbjct  300  NRGDYQNGWDTDQFPIDNYELTQAMMQIIRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHI  359

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD +AR L SAAKL+E+   K+++  RY SFDS  G   E GK   E +   A   GE
Sbjct  360  AGMDVMARALESAAKLLEESPYKKMLADRYASFDSGKGKEFEEGKLTLEDVVAYAKANGE  419

Query  189  PKVPSAKQELAEMIL  145
            PK  S KQEL E I+
Sbjct  420  PKQTSGKQELYEAIV  434



>ref|WP_021376347.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE83572.1| xylose isomerase [Peptoclostridium difficile CD69]
 gb|KJF63558.1| xylose isomerase [Peptoclostridium difficile]
Length=445

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +  +++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFIKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_034536238.1| xylose isomerase [Bacteroides stercoris]
 gb|ADD61712.1| putative protein [uncultured organism]
Length=438

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD D  T   FL+ +GL  +FK+NIE NHATL+GH+  HE+  A  NG+LG+IDA
Sbjct  240  PTKHQYDVDTETVVGFLKAHGLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDA  299

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D  E T  M+ +I+NGG   GG NFDAK RR STD+EDIFIAHI
Sbjct  300  NRGDYQNGWDTDQFPIDNYELTQAMMQIIRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHI  359

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD +AR L SAAKL+E+   K+++  RY SFDS  G   E GK   E +   A   GE
Sbjct  360  AGMDVMARALESAAKLLEESPYKKMLADRYASFDSGKGKEFEEGKLTLEDVVAYAKANGE  419

Query  189  PKVPSAKQELAEMIL  145
            PK  S KQEL E I+
Sbjct  420  PKQTSGKQELYEAIV  434



>ref|WP_007375167.1| MULTISPECIES: xylose isomerase [Pseudoalteromonas]
 gb|EKS14609.1| xylose isomerase [Pseudoalteromonas sp. Bsw20308]
 gb|KDC52315.1| xylose isomerase [Pseudoalteromonas citrea]
 gb|KHM51124.1| xylose isomerase [Pseudoalteromonas flavipulchra NCIMB 2033 = 
ATCC BAA-314]
 gb|KID34426.1| xylose isomerase [Pseudoalteromonas distincta]
Length=439

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT A FL K+GL DE K+NIE NHATL+GHS HHE+  A   G++G+I
Sbjct  238  QEPTKHQYDYDTATVAGFLYKHGLQDEIKVNIEANHATLAGHSFHHEIAVACAEGIMGSI  297

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP DVAE TLV+  ++K GG   GGFNFD KLRR+S + +D+FI 
Sbjct  298  DANRGDMQNGWDTDQFPNDVAECTLVVYEILKMGGFTTGGFNFDTKLRRQSCERDDLFIG  357

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMDT+A+ L +AA +IE G L + V KRY  +  +LG +I  G+   E L     E 
Sbjct  358  HIGGMDTMAKALLNAAAMIEGGELTDFVEKRYAGWKEDLGQSILNGEQSLESLSALVHEN  417

Query  195  G-EPKVPSAKQELAEMIL  145
              +PK  S +QEL E I+
Sbjct  418  NIDPKQVSGRQELLENIV  435



>ref|WP_013289876.1| xylose isomerase [Caldicellulosiruptor obsidiansis]
 gb|ADL41871.1| xylose isomerase [Caldicellulosiruptor obsidiansis OB47]
Length=438

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAA    FL+K  L   FKLNIE NHATL+GH  HHE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHELRFARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP DV   TL M  VIK GG   GG NFDAK+RR S ++ED+ I HI
Sbjct  297  NMGDLLLGWDTDQFPTDVRLTTLAMYEVIKMGGFDKGGLNFDAKVRRSSFELEDLVIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY+S+   +GA I  G+ADF+ LE+ AL   +
Sbjct  357  AGMDAFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVSGQADFKTLEEYALNLSQ  416

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S KQEL EMIL   +
Sbjct  417  IENKSGKQELLEMILNKYM  435



>ref|WP_009959507.1| xylose isomerase [Verrucomicrobium spinosum]
Length=436

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 138/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P+ HQYD D+A   NFLR+ GL++ FKLNIE NHATL+GH+  HE+E A   G LG+IDA
Sbjct  238  PSTHQYDSDSAACLNFLREYGLLEHFKLNIETNHATLAGHTMRHELEVALAAGALGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFP D+   T +ML ++K GG   GG NFDAK+RRES +  D+F AHI
Sbjct  298  NTGDELIGWDTDQFPTDIYLTTEIMLVLLKMGGFTTGGLNFDAKVRRESFEPVDLFHAHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL+ AA +IEDG L+  +++RY +FDS +GA IE G   FE LE   L+ GE
Sbjct  358  GGMDAFARGLKIAAAIIEDGRLEGFLKQRYSTFDSGIGAQIERGDVGFEELEAYTLKNGE  417

Query  189  PKVPSAKQELAEMIL  145
            P + S +QE+ E ++
Sbjct  418  PAIGSGRQEMLENLV  432



>ref|WP_013411463.1| xylose isomerase [Caldicellulosiruptor owensensis]
 gb|ADQ04052.1| xylose isomerase [Caldicellulosiruptor owensensis OL]
Length=438

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAA    FL+K  L   FKLNIE NHATL+GH  HHE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHELRFARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP DV   TL M  VIK GG   GG NFDAK+RR S ++ED+ I HI
Sbjct  297  NMGDLLLGWDTDQFPTDVRLTTLAMYEVIKMGGFDKGGLNFDAKVRRSSFELEDLVIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY+S+   +GA I  G+ADF+ LE+ AL   +
Sbjct  357  AGMDAFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVSGQADFKTLEEYALNLSQ  416

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S KQEL EMIL   +
Sbjct  417  IENKSGKQELLEMILNKYM  435



>ref|WP_022103428.1| xylose isomerase [Bacteroides stercoris CAG:120]
 emb|CDA49117.1| xylose isomerase [Bacteroides stercoris CAG:120]
Length=455

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD D  T   FL+ +GL  +FK+NIE NHATL+GH+  HE+  A  NG+LG+IDA
Sbjct  257  PTKHQYDADTETVVGFLKAHGLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDA  316

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D  E T  M+ +I+NGG   GG NFDAK RR STD+EDIFIAHI
Sbjct  317  NRGDYQNGWDTDQFPIDNYELTQAMMQIIRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHI  376

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD +AR L SAAKL+E+   K+++  RY SFDS  G   E GK   E +   A   GE
Sbjct  377  AGMDVMARALESAAKLLEESPYKKMLADRYASFDSGKGKEFEEGKLTLEDVVAYAKANGE  436

Query  189  PKVPSAKQELAEMIL  145
            PK  S KQEL E I+
Sbjct  437  PKQTSGKQELYEAIV  451



>gb|EPH17343.1| xylose isomerase [Bacteroides stercoris CC31F]
Length=456

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD D  T   FL+ +GL  +FK+NIE NHATL+GH+  HE+  A  NG+LG+IDA
Sbjct  258  PTKHQYDVDTETVVGFLKAHGLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDA  317

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D  E T  M+ +I+NGG   GG NFDAK RR STD+EDIFIAHI
Sbjct  318  NRGDYQNGWDTDQFPIDNYELTQAMMQIIRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHI  377

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD +AR L SAAKL+E+   K+++  RY SFDS  G   E GK   E +   A   GE
Sbjct  378  AGMDVMARALESAAKLLEESPYKKMLADRYASFDSGKGKEFEEGKLTLEDVVAYAKANGE  437

Query  189  PKVPSAKQELAEMIL  145
            PK  S KQEL E I+
Sbjct  438  PKQTSGKQELYEAIV  452



>ref|WP_035132135.1| xylose isomerase [Flavobacterium beibuense]
 gb|KGO82653.1| xylose isomerase [Flavobacterium beibuense F44-8]
Length=440

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 141/198 (71%), Gaps = 0/198 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT   F+ K GL D+FKLNIE NHATL+GH+  HE++ A   GLLG+IDA
Sbjct  242  PTKHQYDFDAATCIGFINKFGLQDDFKLNIEVNHATLAGHTFEHELQVAADAGLLGSIDA  301

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D+ E T  M+ ++++GGL  GG NFDAK+RR S D+ED FIAH+
Sbjct  302  NRGDYQNGWDTDQFPIDIYETTQAMMVLLQSGGLTTGGVNFDAKVRRNSIDLEDKFIAHV  361

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT ARGL  A  ++++ +  +L ++RYQSFD   GA  E G+   E L + A + GE
Sbjct  362  SGMDTFARGLICAEHVLKNTNYLKLRKERYQSFDGGNGAKFEKGELTLENLSEIARQQGE  421

Query  189  PKVPSAKQELAEMILQSA  136
            P+  S +QEL E I+ +A
Sbjct  422  PQPISGRQELFEQIIANA  439



>ref|WP_009089925.1| xylose isomerase [Elizabethkingia anophelis]
 gb|EHM96710.1| xylose isomerase [Elizabethkingia anophelis Ag1]
 gb|ELR79690.1| xylose isomerase [Elizabethkingia anophelis R26]
Length=442

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT   FLR+ GL D+FKLN+E NHATL+GH+  HE++ A   GLLG+IDA
Sbjct  244  PTKHQYDYDAATVIGFLRQYGLADDFKLNLEVNHATLAGHTFQHELQVAADAGLLGSIDA  303

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP ++ E T  ML +++ GGL  GG NFDAK+RR STD ED+F AHI
Sbjct  304  NRGDEQNGWDTDQFPYNINELTESMLIILEAGGLQGGGVNFDAKIRRNSTDTEDLFFAHI  363

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  AR L +A K++ + S  +  R+RYQSFD+  GA  E G    E L   A + GE
Sbjct  364  GGMDLFARALITADKILGESSYLQFRRERYQSFDTGKGAEFEKGNLFLEDLYHFAAKNGE  423

Query  189  PKVPSAKQELAEMILQSAL  133
            P+V S KQE  E ++   +
Sbjct  424  PEVRSGKQEFLENLINRYI  442



>ref|WP_008302073.1| xylose isomerase [Glaciecola agarilytica]
 dbj|GAC03229.1| xylose isomerase [Glaciecola agarilytica NO2]
Length=439

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +EFK+NIE NHATL+GHS  HEV TA   GL G+I
Sbjct  236  QEPTKHQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E +LV+  ++K GG   GGFNFD KLRR+S+D +D+FIA
Sbjct  296  DANRGDPQLGWDTDQFPNSVEELSLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIA  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMD LA GL+ AA++IE+  L ++V KRY  ++ ELG  I+GG+   E L    ++ 
Sbjct  356  HIGGMDHLAMGLKKAAQMIENDFLGQVVSKRYAGWNGELGKGIQGGEFTLESLANLCVDK  415

Query  195  G-EPKVPSAKQELAEMILQSAL  133
              +P+  S +QEL E  + + L
Sbjct  416  DLQPQHVSGQQELLENKVNNVL  437



>ref|WP_014625278.1| xylose isomerase [Spirochaeta thermophila]
 gb|AEJ61949.1| Xylose isomerase [Spirochaeta thermophila DSM 6578]
Length=440

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 135/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK  L+  FK+NIE NHATL+ H+  HE+  ARING+LG++D 
Sbjct  239  PTKHQYDFDVAAVYGFLRKYDLLPYFKVNIEMNHATLAYHTFQHELHFARINGILGSMDV  298

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ E TL M  VIKNGG+APGG NFDAK+RR S + EDIFIAHI
Sbjct  299  NQGDYLLGWDTDQFPTNIYETTLAMYEVIKNGGIAPGGLNFDAKVRRGSFEPEDIFIAHI  358

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  ARG + A KL+ED ++++ V +RY S+   +G  I  GK  FE LE   ++  E
Sbjct  359  AGMDAFARGFKVAWKLLEDKAIEKHVEERYASYREGIGKKIVEGKVGFEDLEAYIIDKAE  418

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QEL E +L   L
Sbjct  419  IKNASGRQELLEAVLNRYL  437



>ref|WP_009891378.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_006200085.1| xylose isomerase [Peptoclostridium difficile BI1]
 gb|EQH96874.1| xylose isomerase [Clostridium difficile F253]
 gb|EQJ38592.1| xylose isomerase [Clostridium difficile P23]
 gb|EQJ77358.1| xylose isomerase [Clostridium difficile P45]
 gb|EQK85731.1| xylose isomerase [Clostridium difficile P31]
Length=445

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_021369126.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE42109.1| xylose isomerase [Peptoclostridium difficile CD41]
 gb|EQF66993.1| xylose isomerase [Peptoclostridium difficile CD201]
Length=445

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_009898127.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_001089578.1| xylose isomerase [Peptoclostridium difficile 630]
 emb|CAJ69956.1| Xylose isomerase [Peptoclostridium difficile 630]
 gb|EQE01648.1| xylose isomerase [Peptoclostridium difficile CD3]
 gb|EQE08496.1| xylose isomerase [Peptoclostridium difficile CD13]
 gb|EQE15056.1| xylose isomerase [Peptoclostridium difficile CD17]
 gb|EQE18626.1| xylose isomerase [Peptoclostridium difficile CD18]
 gb|EQE20922.1| xylose isomerase [Peptoclostridium difficile CD21]
 gb|EQE25993.1| xylose isomerase [Peptoclostridium difficile CD22]
 gb|EQE29593.1| xylose isomerase [Peptoclostridium difficile CD34]
 gb|EQE32510.1| xylose isomerase [Peptoclostridium difficile CD38]
 gb|EQE40998.1| xylose isomerase [Peptoclostridium difficile CD39]
 gb|EQE47185.1| xylose isomerase [Peptoclostridium difficile CD42]
 gb|EQE52245.1| xylose isomerase [Peptoclostridium difficile CD43]
 gb|EQE56340.1| xylose isomerase [Peptoclostridium difficile CD44]
 gb|EQE59925.1| xylose isomerase [Peptoclostridium difficile CD45]
 gb|EQE61807.1| xylose isomerase [Peptoclostridium difficile CD46]
 gb|EQE67835.1| xylose isomerase [Peptoclostridium difficile CD47]
 gb|EQE73383.1| xylose isomerase [Peptoclostridium difficile CD49]
 gb|EQE76032.1| xylose isomerase [Peptoclostridium difficile CD51]
 gb|EQE78106.1| xylose isomerase [Peptoclostridium difficile CD68]
 gb|EQE89803.1| xylose isomerase [Peptoclostridium difficile CD70]
 gb|EQE90036.1| xylose isomerase [Peptoclostridium difficile CD104]
 gb|EQE95031.1| xylose isomerase [Peptoclostridium difficile CD109]
 gb|EQF01536.1| xylose isomerase [Peptoclostridium difficile CD129]
 gb|EQF01725.1| xylose isomerase [Peptoclostridium difficile CD131]
 gb|EQF04489.1| xylose isomerase [Peptoclostridium difficile CD132]
 gb|EQF08956.1| xylose isomerase [Peptoclostridium difficile CD133]
 gb|EQF13448.1| xylose isomerase [Peptoclostridium difficile CD144]
 gb|EQF17676.1| xylose isomerase [Peptoclostridium difficile CD149]
 gb|EQF25157.1| xylose isomerase [Peptoclostridium difficile CD159]
 gb|EQF30719.1| xylose isomerase [Peptoclostridium difficile CD165]
 gb|EQF35439.1| xylose isomerase [Peptoclostridium difficile CD166]
 gb|EQF38595.1| xylose isomerase [Peptoclostridium difficile CD169]
 gb|EQF43727.1| xylose isomerase [Peptoclostridium difficile CD170]
 gb|EQF49602.1| xylose isomerase [Peptoclostridium difficile CD178]
 gb|EQF51757.1| xylose isomerase [Peptoclostridium difficile CD181]
 gb|EQF59063.1| xylose isomerase [Peptoclostridium difficile CD200]
 gb|EQF60209.1| xylose isomerase [Peptoclostridium difficile CD196]
 gb|EQF74925.1| xylose isomerase [Peptoclostridium difficile CD211]
 gb|EQF79514.1| xylose isomerase [Peptoclostridium difficile 342]
 gb|EQF85662.1| xylose isomerase [Peptoclostridium difficile 655]
 gb|EQF87405.1| xylose isomerase [Peptoclostridium difficile 824]
 gb|EQF93982.1| xylose isomerase [Peptoclostridium difficile 840]
 gb|EQF94288.1| xylose isomerase [Peptoclostridium difficile 842]
 gb|EQG00794.1| xylose isomerase [Peptoclostridium difficile 6041]
 gb|EQG04453.1| xylose isomerase [Peptoclostridium difficile 6042]
 gb|EQG07308.1| xylose isomerase [Peptoclostridium difficile 6057]
 gb|EQG08669.1| xylose isomerase [Peptoclostridium difficile DA00044]
 gb|EQG17277.1| xylose isomerase [Peptoclostridium difficile DA00062]
 gb|EQG21796.1| xylose isomerase [Peptoclostridium difficile DA00114]
 gb|EQG27364.1| xylose isomerase [Peptoclostridium difficile DA00126]
 gb|EQG31616.1| xylose isomerase [Peptoclostridium difficile DA00129]
 gb|EQG32925.1| xylose isomerase [Peptoclostridium difficile DA00128]
 gb|EQG39021.1| xylose isomerase [Clostridium difficile DA00131]
 gb|EQG41765.1| xylose isomerase [Clostridium difficile DA00132]
 gb|EQG44081.1| xylose isomerase [Clostridium difficile DA00134]
 gb|EQG50860.1| xylose isomerase [Clostridium difficile DA00141]
 gb|EQG55523.1| xylose isomerase [Clostridium difficile DA00142]
 gb|EQG55697.1| xylose isomerase [Clostridium difficile DA00145]
 gb|EQG58956.1| xylose isomerase [Clostridium difficile DA00149]
 gb|EQG64463.1| xylose isomerase [Clostridium difficile DA00154]
 gb|EQG67823.1| xylose isomerase [Clostridium difficile DA00160]
 gb|EQG74313.1| xylose isomerase [Clostridium difficile DA00165]
 gb|EQG74989.1| xylose isomerase [Clostridium difficile DA00167]
 gb|EQG80554.1| xylose isomerase [Clostridium difficile DA00183]
 gb|EQG82128.1| xylose isomerase [Clostridium difficile DA00174]
 gb|EQG90093.1| xylose isomerase [Clostridium difficile DA00191]
 gb|EQG91727.1| xylose isomerase [Clostridium difficile DA00189]
 gb|EQG93286.1| xylose isomerase [Clostridium difficile DA00193]
 gb|EQH01415.1| xylose isomerase [Clostridium difficile DA00196]
 gb|EQH02374.1| xylose isomerase [Clostridium difficile DA00195]
 gb|EQH07253.1| xylose isomerase [Clostridium difficile DA00197]
 gb|EQH11286.1| xylose isomerase [Clostridium difficile DA00203]
 gb|EQH16986.1| xylose isomerase [Clostridium difficile DA00210]
 gb|EQH19049.1| xylose isomerase [Clostridium difficile DA00212]
 gb|EQH21244.1| xylose isomerase [Clostridium difficile DA00211]
 gb|EQH27947.1| xylose isomerase [Clostridium difficile DA00215]
 gb|EQH33652.1| xylose isomerase [Clostridium difficile DA00238]
 gb|EQH33729.1| xylose isomerase [Clostridium difficile DA00232]
 gb|EQH35646.1| xylose isomerase [Clostridium difficile DA00216]
 gb|EQH40082.1| xylose isomerase [Clostridium difficile DA00244]
 gb|EQH46390.1| xylose isomerase [Clostridium difficile DA00246]
 gb|EQH48431.1| xylose isomerase [Clostridium difficile DA00245]
 gb|EQH54096.1| xylose isomerase [Clostridium difficile DA00261]
 gb|EQH59051.1| xylose isomerase [Clostridium difficile DA00273]
 gb|EQH60142.1| xylose isomerase [Clostridium difficile DA00275]
 gb|EQH63488.1| xylose isomerase [Clostridium difficile DA00256]
 gb|EQH67395.1| xylose isomerase [Clostridium difficile DA00305]
 gb|EQH69872.1| xylose isomerase [Clostridium difficile DA00306]
 gb|EQH74613.1| xylose isomerase [Clostridium difficile DA00307]
 gb|EQH79245.1| xylose isomerase [Clostridium difficile DA00310]
 gb|EQH81328.1| xylose isomerase [Clostridium difficile DA00313]
 gb|EQH86870.1| xylose isomerase [Clostridium difficile F152]
 gb|EQH92463.1| xylose isomerase [Clostridium difficile F249]
 gb|EQH98070.1| xylose isomerase [Clostridium difficile F314]
 gb|EQI04458.1| xylose isomerase [Clostridium difficile Y10]
 gb|EQI09688.1| xylose isomerase [Clostridium difficile Y21]
 gb|EQI16335.1| xylose isomerase [Clostridium difficile Y41]
 gb|EQI20016.1| xylose isomerase [Clostridium difficile Y155]
 gb|EQI24220.1| xylose isomerase [Clostridium difficile Y171]
 gb|EQI28648.1| xylose isomerase [Clostridium difficile Y184]
 gb|EQI33282.1| xylose isomerase [Clostridium difficile Y215]
 gb|EQI37326.1| xylose isomerase [Clostridium difficile Y202]
 gb|EQI40230.1| xylose isomerase [Clostridium difficile Y231]
 gb|EQI45261.1| xylose isomerase [Clostridium difficile Y247]
 gb|EQI50233.1| xylose isomerase [Clostridium difficile Y270]
 gb|EQI54457.1| xylose isomerase [Clostridium difficile Y266]
 gb|EQI55619.1| xylose isomerase [Clostridium difficile Y307]
 gb|EQI56034.1| xylose isomerase [Clostridium difficile Y312]
 gb|EQI64060.1| xylose isomerase [Clostridium difficile Y343]
 gb|EQI65175.1| xylose isomerase [Clostridium difficile Y358]
 gb|EQI71845.1| xylose isomerase [Clostridium difficile Y381]
 gb|EQI77153.1| xylose isomerase [Clostridium difficile Y384]
 gb|EQI78026.1| xylose isomerase [Clostridium difficile Y401]
 gb|EQI78173.1| xylose isomerase [Clostridium difficile P1]
 gb|EQI84893.1| xylose isomerase [Clostridium difficile P2]
 gb|EQI90063.1| xylose isomerase [Clostridium difficile P3]
 gb|EQI98886.1| xylose isomerase [Clostridium difficile P6]
 gb|EQJ08241.1| xylose isomerase [Clostridium difficile P8]
 gb|EQJ14493.1| xylose isomerase [Clostridium difficile P9]
 gb|EQJ15166.1| xylose isomerase [Clostridium difficile P11]
 gb|EQJ22276.1| xylose isomerase [Clostridium difficile P15]
 gb|EQJ29066.1| xylose isomerase [Clostridium difficile P19]
 gb|EQJ33738.1| xylose isomerase [Clostridium difficile P21]
 gb|EQJ34478.1| xylose isomerase [Clostridium difficile P20]
 gb|EQJ44681.1| xylose isomerase [Clostridium difficile P25]
 gb|EQJ45644.1| xylose isomerase [Clostridium difficile P24]
 gb|EQJ57731.1| xylose isomerase [Clostridium difficile P32]
 gb|EQJ67025.1| xylose isomerase [Clostridium difficile P42]
 gb|EQJ70774.1| xylose isomerase [Clostridium difficile P36]
 gb|EQJ87881.1| xylose isomerase [Clostridium difficile P50]
 gb|EQJ89221.1| xylose isomerase [Clostridium difficile P49]
 gb|EQJ94626.1| xylose isomerase [Clostridium difficile P51]
 gb|EQJ99998.1| xylose isomerase [Clostridium difficile P61]
 gb|EQK02305.1| xylose isomerase [Clostridium difficile P59]
 gb|EQK04229.1| xylose isomerase [Clostridium difficile P78]
 gb|EQK10687.1| xylose isomerase [Clostridium difficile P69]
 gb|EQK16957.1| xylose isomerase [Clostridium difficile P72]
 gb|EQK37729.1| xylose isomerase [Clostridium difficile P77]
 gb|EQK49092.1| xylose isomerase [Clostridium difficile F480]
 gb|EQK51346.1| xylose isomerase [Clostridium difficile F525]
 gb|EQK54747.1| xylose isomerase [Clostridium difficile F200]
 gb|EQK58237.1| xylose isomerase [Clostridium difficile F548]
 gb|EQK64361.1| xylose isomerase [Clostridium difficile F601]
 gb|EQK68079.1| xylose isomerase [Clostridium difficile CD90]
 gb|EQK69966.1| xylose isomerase [Clostridium difficile CD92]
 gb|EQK72693.1| xylose isomerase [Clostridium difficile CD111]
 gb|EQK74047.1| xylose isomerase [Clostridium difficile CD113]
 gb|EQK80012.1| xylose isomerase [Clostridium difficile CD127]
 gb|EQK85900.1| xylose isomerase [Clostridium difficile P30]
 gb|EQL05253.1| xylose isomerase [Clostridium difficile CD88]
 gb|EQL06681.1| xylose isomerase [Clostridium difficile CD86]
 gb|ERM23750.1| xylose isomerase [Clostridium difficile P41]
 gb|ERM24697.1| xylose isomerase [Clostridium difficile P33]
 gb|ERM26495.1| xylose isomerase [Clostridium difficile DA00130]
 gb|ERM34891.1| xylose isomerase [Clostridium difficile P64]
 gb|ERM45012.1| xylose isomerase [Clostridium difficile F665]
 gb|ERM46949.1| xylose isomerase [Clostridium difficile P53]
 emb|CCL09474.1| Xylose isomerase [Peptoclostridium difficile E16]
 emb|CCL27325.1| Xylose isomerase [Clostridium difficile T11]
 emb|CCL31303.1| Xylose isomerase [Clostridium difficile E15]
 emb|CCL35322.1| Xylose isomerase [Peptoclostridium difficile T23]
 emb|CCL39146.1| Xylose isomerase [Clostridium difficile E19]
 emb|CCL43343.1| Xylose isomerase [Clostridium difficile E24]
 emb|CCL47357.1| Xylose isomerase [Clostridium difficile T42]
 emb|CCL54438.1| Xylose isomerase [Clostridium difficile E14]
 emb|CCL58589.1| Xylose isomerase [Peptoclostridium difficile T17]
 emb|CCL62121.1| Xylose isomerase [Clostridium difficile E9]
 emb|CCL66125.1| Xylose isomerase [Clostridium difficile E7]
 emb|CCL70060.1| Xylose isomerase [Clostridium difficile T3]
 emb|CCL73732.1| Xylose isomerase [Clostridium difficile E28]
 emb|CCL77430.1| Xylose isomerase [Clostridium difficile E23]
 emb|CCL81265.1| Xylose isomerase [Clostridium difficile E12]
 emb|CCL84764.1| Xylose isomerase [Clostridium difficile T19]
 emb|CCL88962.1| Xylose isomerase [Clostridium difficile T10]
 emb|CCL92635.1| Xylose isomerase [Clostridium difficile T14]
 emb|CCL96886.1| Xylose isomerase [Peptoclostridium difficile T61]
 gb|EZR29626.1| xylose isomerase [Peptoclostridium difficile]
 emb|CDS88891.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CDS89521.1| xylose isomerase [Peptoclostridium difficile]
 emb|CDT71017.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CEJ99702.1| Xylose isomerase [Peptoclostridium difficile]
 gb|AJP12826.1| xylose isomerase [Peptoclostridium difficile 630]
Length=445

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_029487833.1| xylose isomerase [Epulopiscium sp. 'N.t. morphotype B']
Length=438

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+GH+  HE+  AR+N + G+IDA
Sbjct  237  PTKHQYDFDVATVVGFLRKYGLDKDFKMNIEANHATLAGHTFQHELNVARVNNVFGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP +V + TL ML VIK GG   GG NFDAK+RR S  +EDI +A+I
Sbjct  297  NQGDLLLGWDTDQFPTNVYDTTLCMLEVIKAGGFTNGGLNFDAKVRRASYTMEDIILAYI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL+ A K+IEDG + E V +RY S+ + +GA I  G+ + E LEK ALE   
Sbjct  357  SGMDTFALGLKIANKIIEDGRIDEFVSRRYASYKTGIGADIIAGRTNLEELEKYALELPP  416

Query  189  PKVPSAKQELAEMILQSAL  133
             +    KQE  E +  + +
Sbjct  417  VEPHPGKQEYLEAVFNNVM  435



>ref|WP_021423576.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQJ65588.1| xylose isomerase [Clostridium difficile P38]
Length=445

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLGKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_022428254.1| xylose isomerase [Ruminococcus sp. CAG:403]
 emb|CDE29758.1| xylose isomerase [Ruminococcus sp. CAG:403]
Length=240

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 134/201 (67%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT   FLRK  L  +FKLNIE NHATL+ H+  HE+  AR NG+ G+IDA
Sbjct  37   PTKHQYDFDAATVLGFLRKYDLDKDFKLNIEANHATLAQHTFQHELRVARENGVFGSIDA  96

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL M  V+K GG   GG NFDAK RR S   EDIF ++I
Sbjct  97   NQGDPLLGWDTDQFPTNIYDATLCMYEVLKAGGFTNGGLNFDAKARRGSYTPEDIFYSYI  156

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL+ A KLI DG L + V  RY S+++ +GAAI  G A  E LE+ AL  GE
Sbjct  157  AGMDTFALGLKLADKLITDGRLDQFVADRYASWNTGIGAAIINGTATLEDLEQYALNKGE  216

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QEL E  L + L
Sbjct  217  VTDSLTSGRQELLEATLNNIL  237



>ref|WP_021421788.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQJ55091.1| xylose isomerase [Clostridium difficile P29]
Length=445

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLESILNRYI  436



>ref|WP_014757233.1| MULTISPECIES: xylose isomerase [Thermoanaerobacterium]
 ref|YP_006390910.1| Xylose isomerase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|AFK85311.1| Xylose isomerase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|ETO38801.1| Xylose isomerase [Thermoanaerobacterium aotearoense SCUT27]
 gb|AIE39924.1| xylose isomerase [Thermoanaerobacterium saccharolyticum]
Length=439

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 132/199 (66%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK GL   FK+NIE NHATL+ H   HE+  ARING+LG+IDA
Sbjct  238  PTKHQYDFDVANVLAFLRKYGLDKYFKVNIEANHATLAFHDFQHELRYARINGVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFP D+   TL M  VIK GG   GG NFDAK+RR S + ED+F+ HI
Sbjct  298  NTGDMLLGWDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFLGHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY S+   +GA I  GKADF+ LEK ALE  +
Sbjct  358  AGMDAFAKGFKVAYKLVKDGVFDKFIEERYASYKDGIGADIVSGKADFKSLEKYALEHSQ  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QEL E IL   L
Sbjct  418  IVNKSGRQELLESILNQYL  436



>ref|WP_012570371.1| xylose isomerase [Coxiella burnetii]
 gb|ACJ18944.1| xylose isomerase [Coxiella burnetii CbuG_Q212]
Length=436

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FL+++GL  EFK+NIE NHATL+GHS  HE+  A  N + G++DA
Sbjct  238  PTKHQYDFDVATVYAFLQRHGLEKEFKVNIEANHATLAGHSFAHEIAYACANDIFGSVDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDPQ GWDTDQFP+D+ E  LV+  ++K+GG   GGFNFDAKLRR+S D+ED+F AHI
Sbjct  298  NRGDPQLGWDTDQFPIDLQETVLVLYLILKHGGFTSGGFNFDAKLRRQSLDLEDLFYAHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWG-  193
             G+DTLARGL  AA +IE+  LK    KRYQ++   L A +  GK DFE + K+AL+   
Sbjct  358  SGIDTLARGLLIAATIIENDKLKTTKEKRYQAWKEPLNANMLSGKLDFETIAKRALDNNL  417

Query  192  EPKVPSAKQELAEMIL  145
            +PK  S +QE  E  L
Sbjct  418  DPKPTSGEQEKLERWL  433



>ref|WP_044878597.1| xylose isomerase [Paenibacillus sp. IHBB 10380]
 gb|AJS60158.1| xylose isomerase [Paenibacillus sp. IHBB 10380]
Length=439

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 134/190 (71%), Gaps = 1/190 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K  L   FKLN+E NHATL+GH+  HE+  ARING+LG++DA
Sbjct  236  PTKHQYDYDAATTIAFLQKYNLDKHFKLNLEANHATLAGHTFDHEIRVARINGMLGSLDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP DV +ATL M  V+KNGG+  GG NFDAK+RR S + ED+F+AHI
Sbjct  296  NQGDMLLGWDTDEFPTDVYDATLTMYEVLKNGGIGRGGVNFDAKVRRASFEAEDLFLAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL+ AAKLIED   ++ + KRY SF   +GA +  GKA    L + AL    
Sbjct  356  AGMDTYAKGLKVAAKLIEDRVFEDFIEKRYSSFSEGIGADVVSGKATLTSLAEYALNNEN  415

Query  189  P-KVPSAKQE  163
            P K  S +QE
Sbjct  416  PRKNQSGRQE  425



>ref|WP_007985011.1| MULTISPECIES: xylose isomerase [Glaciecola]
 gb|AEE24646.1| xylose isomerase [Glaciecola sp. 4H-3-7+YE-5]
 dbj|GAC08661.1| xylose isomerase [Glaciecola chathamensis S18K6]
Length=439

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +EFK+NIE NHATL+GHS  HEV TA   GL G+I
Sbjct  236  QEPTKHQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E +LV+  ++K GG   GGFNFD KLRR+S+D +D+FIA
Sbjct  296  DANRGDPQLGWDTDQFPNSVEELSLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIA  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMD LA GL+ AA++IE+  L ++V KRY  ++ ELG  I+GG+   E L    ++ 
Sbjct  356  HIGGMDHLAMGLKKAAQMIENDFLGQVVSKRYAGWNGELGKGIQGGEFTLESLANLCVDK  415

Query  195  G-EPKVPSAKQELAEMILQSAL  133
              +P+  S +QEL E  + + L
Sbjct  416  DLQPQHVSGQQELLENKVNNVL  437



>ref|WP_013043164.1| xylose isomerase [Coraliomargarita akajimensis]
 gb|ADE54442.1| xylose isomerase [Coraliomargarita akajimensis DSM 45221]
Length=434

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 135/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P+ HQYD D+A   NFLR+ GL+D+F+LNIE NHATL+GH+  HE+  A    +LG+IDA
Sbjct  236  PSTHQYDSDSAACLNFLREYGLMDKFRLNIETNHATLAGHTMEHELTVAMNANMLGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP D+   T VML V++ GG   GG NFDAK RRES +  D+  AHI
Sbjct  296  NRGDELIGWDTDQFPTDIYLTTQVMLCVLEMGGFTTGGLNFDAKRRRESHEPIDLMHAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL+ AA + EDG L   V+ RY SFDS+LGA IE G   F+ LEK AL  GE
Sbjct  356  GGMDAFARGLKIAAAIREDGRLANFVKDRYSSFDSDLGAKIEAGNCSFDELEKLALSAGE  415

Query  189  PKVPSAKQELAEMILQSAL  133
            P + S +QE+ E ++   L
Sbjct  416  PSLASGRQEMLENLVNEFL  434



>ref|WP_028405759.1| xylose isomerase [Bacillus sp. J13]
Length=438

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 140/200 (70%), Gaps = 1/200 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL   FKLN+E NHATL+GH+  HE+  ARING+LG++DA
Sbjct  236  PTKHQYDFDAATTIAFLQKYGLDKHFKLNLEANHATLAGHTFEHELRVARINGMLGSLDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP+++ +ATL +  V+ NGGL  GG NFDAK+RR S + ED+F+AHI
Sbjct  296  NQGDMLIGWDTDEFPVNIYDATLTLYEVLMNGGLGRGGVNFDAKVRRPSFEPEDLFLAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL+ AAKLIED   ++ + KRY SF   +GA +  GKA    L + AL    
Sbjct  356  AGMDTYAKGLKVAAKLIEDRVFEDFIEKRYSSFKEGIGADVVAGKATLASLAEYALNNDS  415

Query  189  P-KVPSAKQELAEMILQSAL  133
            P K  S +QE+ + IL   +
Sbjct  416  PRKNESGRQEMLKAILNQYI  435



>gb|EHJ36230.1| xylose isomerase [Peptoclostridium difficile 70-100-2010]
Length=454

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  247  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  306

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  307  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  366

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  367  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  426

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  427  IKNKSGRQEMLEAILNRYI  445



>ref|WP_012816370.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_003219374.1| xylose isomerase [Peptoclostridium difficile R20291]
 emb|CBA65635.1| xylose isomerase [Peptoclostridium difficile CD196]
 emb|CBE06558.1| xylose isomerase [Peptoclostridium difficile R20291]
Length=454

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  247  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  306

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  307  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  366

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  367  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  426

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  427  IKNKSGRQEMLEAILNRYI  445



>ref|WP_021388228.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQF46170.1| xylose isomerase [Peptoclostridium difficile CD175]
Length=445

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_009906213.1| xylose isomerase [Peptoclostridium difficile]
 emb|CCK88406.1| Xylose isomerase [Peptoclostridium difficile T5]
 emb|CCK91841.1| Xylose isomerase [Peptoclostridium difficile T20]
 emb|CCK95551.1| Xylose isomerase [Peptoclostridium difficile E1]
 emb|CCK99539.1| Xylose isomerase [Peptoclostridium difficile E10]
Length=445

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_021361041.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE03070.1| xylose isomerase [Peptoclostridium difficile CD8]
 gb|EQE03425.1| xylose isomerase [Peptoclostridium difficile CD9]
 gb|EQI94371.1| xylose isomerase [Clostridium difficile P5]
 gb|EQJ05263.1| xylose isomerase [Clostridium difficile P7]
 gb|EQJ16852.1| xylose isomerase [Clostridium difficile P13]
 gb|EQJ77004.1| xylose isomerase [Clostridium difficile P46]
 gb|EQJ80819.1| xylose isomerase [Clostridium difficile P48]
 gb|EQK14534.1| xylose isomerase [Clostridium difficile P70]
 gb|EQK27028.1| xylose isomerase [Clostridium difficile P73]
 gb|EQK29846.1| xylose isomerase [Clostridium difficile P75]
 gb|ERM33438.1| xylose isomerase [Clostridium difficile P37]
Length=445

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNIARINDVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_021393548.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQG16946.1| xylose isomerase [Peptoclostridium difficile DA00065]
 gb|EQK20169.1| xylose isomerase [Clostridium difficile P71]
 gb|EQK28958.1| xylose isomerase [Clostridium difficile P74]
 emb|CCL03401.1| Xylose isomerase [Peptoclostridium difficile E13]
 emb|CCL08382.1| Xylose isomerase [Peptoclostridium difficile CD002]
Length=445

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_007131701.1| xylose isomerase [Paenibacillus lactis]
 gb|EHB59569.1| xylose isomerase [Paenibacillus lactis 154]
Length=438

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 140/200 (70%), Gaps = 1/200 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT  FL+K GL   FKLN+E NHATL+GH+  HE+  ARING+LG++DA
Sbjct  236  PTKHQYDFDAATTIAFLQKYGLDKHFKLNLEANHATLAGHTFEHELRVARINGMLGSLDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP+++ +ATL +  V+ NGGL  GG NFDAK+RR S + ED+F+AHI
Sbjct  296  NQGDMLIGWDTDEFPVNIYDATLTLYEVLMNGGLGRGGVNFDAKVRRPSFEPEDLFLAHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL+ AAKLIED   ++ + KRY SF   +GA +  GKA    L + AL    
Sbjct  356  AGMDTYAKGLKVAAKLIEDRVFEDFIEKRYSSFKEGIGADVVAGKATLASLAEYALNNDS  415

Query  189  P-KVPSAKQELAEMILQSAL  133
            P K  S +QE+ + IL   +
Sbjct  416  PRKNESGRQEMLKAILNQYI  435



>ref|WP_029501331.1| xylose isomerase [Lachnoclostridium phytofermentans]
Length=438

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+GH+  HE+  AR+NG+ G++DA
Sbjct  238  PTKHQYDFDTATVLGFLRKYGLEKDFKMNIEANHATLAGHTFEHELALARVNGVFGSVDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP DV  ATL ML V+K GG   GG NFDAK+RR S + +DI   +I
Sbjct  298  NQGDPNLGWDTDQFPTDVHSATLAMLEVLKAGGFTNGGLNFDAKVRRGSFEFDDIAYGYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A GL  AA++IEDG + + V  RY S+ + +G AI  G    E LE+  L   E
Sbjct  358  AGMDTFALGLIKAAEIIEDGRIAKFVEDRYASYKTGIGKAIVDGTTSLEELEQYVLTHNE  417

Query  189  PKVPSAKQELAEMILQSAL  133
            P + S +QE+ E I+ + L
Sbjct  418  PVMQSGRQEVLESIVNNIL  436



>ref|WP_006450750.1| hypothetical protein, partial [Xanthomonas gardneri]
 gb|EGD18900.1| hypothetical protein XGA_2470 [Xanthomonas gardneri ATCC 19865]
Length=235

 Score =   213 bits (543),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 135/199 (68%), Gaps = 1/199 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+D+AT   FLR++GL  +FKLNIE NHATLSGHS  H+++ A   GLLG+IDA
Sbjct  36   PMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLLGSIDA  95

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N G+PQ GWDTDQFP D+ +    ML V++ GGLAPGG NFDAK+RRES+D +D+F+AHI
Sbjct  96   NRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDLFLAHI  155

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL  A  L+    L++   +RY SFDS  GAA   G +    + K A    E
Sbjct  156  GGMDAFARGLEVANALLTSSPLEQWRAERYASFDSGAGAAFADGTSTLVDVAKHA-AGNE  214

Query  189  PKVPSAKQELAEMILQSAL  133
            PK  S +QE  E ++   L
Sbjct  215  PKQLSGRQEAYENLINQYL  233



>ref|WP_022019645.1| xylose isomerase [Bacteroides sp. CAG:661]
 emb|CCZ48270.1| xylose isomerase [Bacteroides sp. CAG:661]
Length=438

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD D  T   FLR +GL  +FK+NIE NHATL+GH+  HE+  A  NG+LG+IDA
Sbjct  240  PTKHQYDVDTETVIGFLRAHGLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDA  299

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D  E    M+ +I+ GG   GG NFDAK RR STD+EDIFIAHI
Sbjct  300  NRGDYQNGWDTDQFPIDNFELIQAMMQIIRGGGFKDGGTNFDAKTRRNSTDLEDIFIAHI  359

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD +AR L SAAKL+E+   ++++ +RY SFDS LG   E GK   E +   A   GE
Sbjct  360  SGMDAMARALESAAKLLEESPYRQMLAQRYASFDSGLGKDFEDGKLTLEDIVAYAKRNGE  419

Query  189  PKVPSAKQELAEMIL  145
            PK  S KQEL E I+
Sbjct  420  PKQISGKQELYEAIV  434



>ref|WP_015923669.1| xylose isomerase [Halothermothrix orenii]
 gb|ACL70700.1| xylose isomerase [Halothermothrix orenii H 168]
Length=439

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT  +FL+K  L   FKLNIE NHATL+GH+  HE+  +RING+LG++DA
Sbjct  238  PTKHQYDFDAATVISFLKKYDLDKHFKLNIEANHATLAGHTFQHELHVSRINGMLGSVDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ E TL M  ++KNGGL PGG NFDAK+RR S +  D+F AHI
Sbjct  298  NQGDLLLGWDTDQFPTNIYETTLAMYEILKNGGLEPGGLNFDAKVRRASFEPVDLFYAHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  ARGL+ A KL+E G L++ + +RY+S+ + +G  I  G+  F+ LE  AL  G+
Sbjct  358  AGMDAFARGLKVAHKLLESGELEDFISERYKSYRNGIGEKIVKGEVGFKELEDYALNNGK  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QEL E I+   +
Sbjct  418  ITNVSGRQELLESIVNKYI  436



>ref|WP_029228039.1| xylose isomerase [Caldicellulosiruptor acetigenus]
Length=438

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAA    FL+K  L   FKLNIE NHATL+GH  HHE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHELRFARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP DV   TL M  VIK GG   GG NFDAK+RR S ++ED+ I HI
Sbjct  297  NMGDLLLGWDTDQFPTDVRLTTLAMYEVIKMGGFDKGGLNFDAKVRRGSFELEDLVIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY+S+   +GA I  G+ADF+ LE+ AL   +
Sbjct  357  AGMDAFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVSGQADFKTLEEYALNLSK  416

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S KQEL EMIL   +
Sbjct  417  IENKSGKQELLEMILNKYM  435



>ref|WP_007106886.1| xylose isomerase [Glaciecola polaris]
 dbj|GAC35123.1| xylose isomerase [Glaciecola polaris LMG 21857]
Length=439

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 139/202 (69%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +EFK+NIE NHATL+GHS  HEV TA   GL G+I
Sbjct  236  QEPTKHQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD Q GWDTDQFP  V E TLV+  ++K GG   GGFNFD KLRR+S+D +D+FIA
Sbjct  296  DANRGDAQLGWDTDQFPNSVEELTLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIA  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMD LA GL+ AAK+IE   L + V KRY  ++ +LG  I+GG    E L K  ++ 
Sbjct  356  HIGGMDHLAMGLKKAAKMIESDFLGQAVSKRYAGWNGDLGKGIQGGDFTLESLSKLCIDK  415

Query  195  G-EPKVPSAKQELAEMILQSAL  133
              +PK  S +QEL E  + + L
Sbjct  416  NLQPKHVSGQQELLENKVNNVL  437



>ref|WP_013433194.1| xylose isomerase [Caldicellulosiruptor kristjanssonii]
 gb|ADQ41469.1| xylose isomerase [Caldicellulosiruptor kristjanssonii I77R1B]
Length=438

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAA    FL+K  L   FKLNIE NHATL+GH  HHE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHELRFARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP DV   TL M  VIK GG   GG NFDAK+RR S ++ED+ I HI
Sbjct  297  NMGDLLLGWDTDQFPTDVRLTTLAMYEVIKAGGFDKGGLNFDAKVRRGSFELEDLVIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY+S+   +GA I  G+ADF+ LE+ AL   +
Sbjct  357  AGMDAFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVSGQADFKTLEEYALNLSK  416

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S KQEL EMIL   +
Sbjct  417  IENKSGKQELLEMILNKYM  435



>ref|WP_044003575.1| xylose isomerase [Hymenobacter swuensis]
 gb|AHJ99526.1| xylose isomerase [Hymenobacter swuensis DY53]
Length=443

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 139/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT   FL++ GL D+F LN+E NHATL+GH+  HE++ A   G+LG++DA
Sbjct  245  PTKHQYDFDAATVIGFLKEYGLQDDFMLNLEVNHATLAGHTFQHELQVAADAGMLGSMDA  304

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP ++ E T  ML ++++GG+ PGG NFDAK RR STD+EDIFIAHI
Sbjct  305  NRGDYQNGWDTDQFPNNLNELTESMLIILEHGGIKPGGINFDAKTRRNSTDLEDIFIAHI  364

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT AR L +A  ++E  S ++   +RY SFD+  GAA E G+   E L + A E GE
Sbjct  365  AGMDTFARALVTADNILEKSSYRKFRTERYASFDAGAGAAFEKGQLTLEDLRRIAHEAGE  424

Query  189  PKVPSAKQELAEMILQSAL  133
            P + S KQE  E I+   +
Sbjct  425  PTMRSGKQEWLEAIINQYI  443



>ref|XP_002591809.1| hypothetical protein BRAFLDRAFT_123544 [Branchiostoma floridae]
 gb|EEN47820.1| hypothetical protein BRAFLDRAFT_123544 [Branchiostoma floridae]
Length=189

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = -2

Query  696  TTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDT  517
            T   FL+  GL  ++KLNIE NH TL+GH   H+V  A   G+LG+ID+N+G P  GWDT
Sbjct  2    TVIGFLKHFGLEKDYKLNIEPNHTTLAGHGYEHDVVMAAAFGMLGSIDSNTGSPDLGWDT  61

Query  516  DQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLR  337
            DQFPMDV   T+VM +V++ GGLAPGG NFD K+RRESTD+ED+FI+H+G MD  ARGL+
Sbjct  62   DQFPMDVKNCTMVMKTVLEMGGLAPGGLNFDCKVRRESTDLEDMFISHVGAMDAFARGLK  121

Query  336  SAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELA  157
            SAAK++++G L  LV++RY SF S +GA I  G A  E  E   ++ GEPK  S KQE  
Sbjct  122  SAAKVLQEGVLTRLVKERYLSFSSGIGARIAKGTATMEECEDYIMQKGEPKAASGKQEKF  181

Query  156  EMIL  145
            E IL
Sbjct  182  ETIL  185



>gb|EFH05881.1| xylose isomerase [Clostridium difficile NAP08]
 gb|EFH17349.1| xylose isomerase [Clostridium difficile NAP07]
Length=454

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  247  PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  306

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  307  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  366

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  367  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  426

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  427  IKNKSGRQEMLEAILNRYI  445



>ref|WP_006990989.1| MULTISPECIES: xylose isomerase [Alteromonadales]
 dbj|GAC22838.1| xylose isomerase [Glaciecola mesophila KMM 241]
Length=439

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 140/202 (69%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +EFK+NIE NHATL+GHS  HEV TA   GL G+I
Sbjct  236  QEPTKHQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E +LV+  ++K GG   GGFNFD KLRR+S+D +D+FIA
Sbjct  296  DANRGDPQLGWDTDQFPNSVEELSLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIA  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMD LA GL+ AA +IE+  L + V KRY  ++ ELG  I+GG  + E L    ++ 
Sbjct  356  HIGGMDHLAMGLKKAALMIENDFLGQAVSKRYAGWNGELGKGIQGGDFNLESLANLCVDK  415

Query  195  G-EPKVPSAKQELAEMILQSAL  133
              +PK  S +QEL E  + + L
Sbjct  416  NLQPKHVSGQQELLENKVNNVL  437



>gb|AIF26293.1| putative xylose isomerase, partial [uncultured bacterium Lq_025_E06]
Length=374

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 135/195 (69%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD D  T   FLR NGL  +FK+NIE NHATL+GH+  HE+  AR NG LG+IDA
Sbjct  175  PTKHQYDVDTETVIGFLRANGLDKDFKVNIEVNHATLAGHTFEHELTVARENGFLGSIDA  234

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D  E T  M+ VI NGGL  GG NFDAKLRR STD EDIFIAHI
Sbjct  235  NRGDAQNGWDTDQFPVDAYELTQAMMQVILNGGLGNGGTNFDAKLRRSSTDPEDIFIAHI  294

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
              MD +A  L +AA ++E+  L ++V++RY SFDS LG   E GKA  E L K A   GE
Sbjct  295  SAMDAMAHALLNAATVLEESPLCQMVKERYASFDSGLGKQFEEGKATLEDLYKYAKAVGE  354

Query  189  PKVPSAKQELAEMIL  145
            P V S KQEL E +L
Sbjct  355  PTVASGKQELYETLL  369



>gb|EHJ32437.1| xylose isomerase [Peptoclostridium difficile 002-P50-2011]
Length=454

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  247  PTKHQYDFDTATVLGFLRKYNLDKYFKVNIEANHATLAGHTFQHELNIARINNVLGSIDA  306

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  307  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  366

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  367  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  426

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  427  IKNKSGRQEMLEAILNRYI  445



>ref|WP_015392438.1| xylose isomerase XylA [Clostridium saccharoperbutylacetonicum]
 gb|AGF56119.1| xylose isomerase XylA [Clostridium saccharoperbutylacetonicum 
N1-4(HMT)]
Length=439

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FL+K  L   FK+NIE NHATL+ H+  HE+  ARIN  LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLKKYNLDKYFKVNIEANHATLAQHTFQHELNFARINNFLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ +ATL M  ++KNGGLAPGG NFDAK+RR S + ED+F+A+I
Sbjct  298  NQGDPMLGWDTDQFPTNIYDATLAMYEILKNGGLAPGGVNFDAKVRRASFEKEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL+ A KL+E+G L+  ++ +Y SF   +G  I  GK   + LE  AL+  E
Sbjct  358  AGMDTFAKGLKVAHKLLENGELENFIKNKYASFSEGIGKEIVEGKVGLKELEAYALKNNE  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QEL E I+   +
Sbjct  418  ITNKSGRQELLEAIVNQYI  436



>ref|WP_014041981.1| xylose isomerase [Caldicellulosiruptor lactoaceticus]
 gb|AEM73030.1| Xylose isomerase [Caldicellulosiruptor lactoaceticus 6A]
Length=438

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAA    FL+K  L   FKLNIE NHATL+GH  HHE+  ARIN +LG+IDA
Sbjct  237  PTKHQYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHELRFARINNMLGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP DV   TL M  VIK GG   GG NFDAK+RR S ++ED+ I HI
Sbjct  297  NMGDLLLGWDTDQFPTDVRLTTLAMYEVIKAGGFDKGGLNFDAKVRRGSFELEDLVIGHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY+S+   +GA I  G+ADF+ LE+ AL   +
Sbjct  357  AGMDAFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVSGQADFKTLEEYALNLSK  416

Query  189  PKVPSAKQELAEMILQSAL  133
             +  S KQEL EMIL   +
Sbjct  417  IENKSGKQELLEMILNKYM  435



>ref|WP_037440177.1| xylose isomerase [Sphingobacterium antarcticum]
 gb|KEQ30250.1| xylose isomerase [Sphingobacterium antarcticus 4BY]
Length=443

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 140/199 (70%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT  +FLR+  L+++FKLN+E NHATL+GH+  HEV+ A   GLLG++DA
Sbjct  245  PTKHQYDYDAATVISFLRQYDLLEDFKLNLEVNHATLAGHTFQHEVQVAADAGLLGSMDA  304

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP ++ E T  ML V++ GGL  GG NFDAK+RR STD  D+F AHI
Sbjct  305  NRGDYQNGWDTDQFPNNINEVTEAMLIVLEAGGLQGGGINFDAKIRRNSTDAADLFHAHI  364

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMDT AR L +A ++++     ++ ++RY SFDS  G+  E GK   E L + A++ GE
Sbjct  365  GGMDTFARALVTADQILQHSDYTKIRKERYASFDSGAGSDFEAGKMTLEGLREYAIQQGE  424

Query  189  PKVPSAKQELAEMILQSAL  133
            P+  S KQEL E I+   +
Sbjct  425  PETISGKQELLENIINRYI  443



>ref|WP_024860181.1| xylose isomerase [Ruminococcus flavefaciens]
Length=437

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 134/201 (67%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+ H+  HE+  AR NG+ G+IDA
Sbjct  234  PTKHQYDFDTATVLGFLRKYGLDKDFKMNIEANHATLAQHTFQHELRVARDNGVFGSIDA  293

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ + T+ M  VIK GG   GG NFDAK RR S   EDIF ++I
Sbjct  294  NQGDPLLGWDTDQFPTNIYDTTMCMYEVIKAGGFTNGGLNFDAKARRGSFTPEDIFYSYI  353

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A G R+A KL+EDG + +    RY S+ S +GA I  GKADF  LEK ALE GE
Sbjct  354  AGMDAFALGFRAALKLVEDGRIDKFTEDRYASWKSGIGADIIAGKADFASLEKYALEKGE  413

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QE+ E I+ + L
Sbjct  414  VTASLSSGRQEMLESIVNNVL  434



>ref|WP_022618581.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CCL15498.1| Xylose isomerase [Peptoclostridium difficile T22]
 emb|CCL19498.1| Xylose isomerase [Clostridium difficile E25]
 emb|CCL23442.1| Xylose isomerase [Clostridium difficile T15]
 emb|CCL50480.1| Xylose isomerase [Clostridium difficile T6]
Length=445

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  +RIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNISRINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_038506942.1| xylose isomerase [Cellulophaga lytica]
 gb|AIM61890.1| xylose isomerase [Cellulophaga lytica]
Length=441

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+D+AT   FLRK GL  +FK+NIE NHATL+ H+  HE++ A   G+LG+IDA
Sbjct  243  PMKHQYDFDSATAIGFLRKYGLDKDFKINIEVNHATLAQHTFQHELQVAANEGMLGSIDA  302

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP ++ E T  ML  +K+GGL  GG NFDAK+RR STD+ED+F+AHI
Sbjct  303  NRGDYQNGWDTDQFPNNIQETTEAMLVFLKSGGLQGGGVNFDAKIRRNSTDLEDVFLAHI  362

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GG DT AR L +A K+I   +  EL +KRY SFDS  G   E GK + + L K ALE GE
Sbjct  363  GGADTFARALLTADKIITSSAYDELRKKRYASFDSGKGKDFEDGKLNLQDLHKIALENGE  422

Query  189  PKVPSAKQELAEMILQSAL  133
              + S KQEL E I+   +
Sbjct  423  LDLISGKQELFENIINQYI  441



>ref|WP_005769174.1| xylose isomerase [Coxiella burnetii]
 gb|EAX33351.1| xylose isomerase [Coxiella burnetii 'MSU Goat Q177']
 gb|EDR36202.1| xylose isomerase [Coxiella burnetii Q321]
 gb|ACJ19819.1| xylose isomerase [Coxiella burnetii CbuK_Q154]
 gb|AIT62837.1| Xylose isomerase [Coxiella burnetii str. Namibia]
Length=436

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 138/196 (70%), Gaps = 1/196 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FL++ GL  EFK+NIE NHATL+GHS  HE+  A  N + G++DA
Sbjct  238  PTKHQYDFDVATVYAFLQRYGLEKEFKVNIEANHATLAGHSFAHEIAYACANDIFGSVDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDPQ GWDTDQFP+D+ E  LV+  ++K+GG   GGFNFDAKLRR+S D+ED+F AHI
Sbjct  298  NRGDPQLGWDTDQFPIDLQETVLVLYLILKHGGFTSGGFNFDAKLRRQSLDLEDLFYAHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWG-  193
             G+DTLARGL  AA +IE+  LK    KRYQ++   L A +  GK DFE + K+AL+   
Sbjct  358  SGIDTLARGLLIAATIIENDKLKTTKEKRYQAWKEPLNANMLSGKLDFETIAKRALDNNL  417

Query  192  EPKVPSAKQELAEMIL  145
            +PK  S +QE  E  L
Sbjct  418  DPKPTSGEQEKLERWL  433



>ref|WP_021412148.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQI20652.1| xylose isomerase [Clostridium difficile Y165]
Length=445

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   +K+NIE NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  238  PTKHQYDFDTATVLGFLRKYNLDKYYKMNIEANHATLAGHTFQHELNIARINNVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  298  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  358  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  417

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  418  IKNKSGRQEMLEAILNRYI  436



>ref|WP_034646410.1| xylose isomerase [Cellulophaga geojensis]
 gb|EWH12674.1| xylose isomerase [Cellulophaga geojensis KL-A]
Length=441

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+D+AT   FLRK GL  +FK+NIE NHATL+ H+  HE++ A   G+LG+IDA
Sbjct  243  PMKHQYDFDSATAIGFLRKYGLDKDFKINIEVNHATLAQHTFQHELQVAANEGMLGSIDA  302

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP ++ E T  ML  +K+GGL  GG NFDAK+RR STD+ED+F+AHI
Sbjct  303  NRGDYQNGWDTDQFPNNIQETTEAMLVFLKSGGLQGGGVNFDAKIRRNSTDLEDVFLAHI  362

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GG DT AR L +A K+I   +  EL +KRY SFDS  G   E GK + + L K ALE GE
Sbjct  363  GGADTFARALLTADKIITSSAYDELRKKRYASFDSGKGKDFEDGKLNLQDLHKIALENGE  422

Query  189  PKVPSAKQELAEMILQSAL  133
              + S KQEL E I+   +
Sbjct  423  LDLISGKQELFENIINQYI  441



>ref|WP_012341741.1| xylose isomerase [Histophilus somni]
 sp|B0UT19.1|XYLA_HISS2 RecName: Full=Xylose isomerase [Haemophilus somnus 2336]
 gb|ACA32619.1| xylose isomerase [Haemophilus somnus 2336]
Length=439

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 137/202 (68%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +E K+NIE NHATL+GH+  HE+ TA   G+ G+I
Sbjct  236  QEPTKHQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHTFQHEIATATSLGIFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E TL M  ++K GG   GGFNFDAK+RR+STD  D+F A
Sbjct  296  DANRGDPQLGWDTDQFPNSVEENTLAMYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHA  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIG MD LA  L+ AAK+IED +L+++V  RY  +D ELG  I  GKA  E L K     
Sbjct  356  HIGAMDVLALSLKRAAKMIEDQTLQKVVDNRYAGWDQELGQKILSGKASLEDLAKIVETQ  415

Query  195  G-EPKVPSAKQELAEMILQSAL  133
            G +PK  S +QE  E ++ S L
Sbjct  416  GLDPKPVSGQQEYLENLVNSYL  437



>ref|WP_027072689.1| xylose isomerase [Luteimonas sp. J29]
Length=444

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 139/202 (69%), Gaps = 1/202 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+D+AT A FL+++GL  +F LNIE NHATLSGH+  H+++ A  +GLLG+IDA
Sbjct  244  PMKHQYDFDSATVAGFLKEHGLEKDFSLNIEANHATLSGHTFEHDLQVASDHGLLGSIDA  303

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N G+PQ GWDTDQFP D+ +    ML V++ GGL PGG NFDAK RRESTD+ED+FIAHI
Sbjct  304  NRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGL-PGGLNFDAKPRRESTDMEDLFIAHI  362

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL  A  L+ D   ++  ++RY SFDS  GA  E GK     L   A + GE
Sbjct  363  GGMDAFARGLEVAHALLNDSPWEQWRKERYASFDSGPGADFEAGKLSLADLVAHAAKHGE  422

Query  189  PKVPSAKQELAEMILQSAL*KR  124
            P+  S KQE  E +L   L +R
Sbjct  423  PQQTSGKQERYENLLNQYLLRR  444



>ref|WP_028518112.1| xylose isomerase [Ruminococcus flavefaciens]
Length=437

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 134/201 (67%), Gaps = 2/201 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK GL  +FK+NIE NHATL+ H+  HE+  +R NG+ G+IDA
Sbjct  234  PTKHQYDFDTATVLGFLRKYGLDKDFKMNIEANHATLAQHTFQHELRVSRDNGVFGSIDA  293

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GDP  GWDTDQFP ++ + T+ M  VIK GG   GG NFDAK RR S   EDIF ++I
Sbjct  294  NQGDPLLGWDTDQFPTNIYDTTMCMYEVIKAGGFTNGGLNFDAKARRGSFTPEDIFYSYI  353

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A G R+A KLIEDG + +    RY S+ S +GA I  GKADF  LEK ALE GE
Sbjct  354  AGMDAFALGFRAALKLIEDGRIDKFTEDRYSSWTSGIGADIIAGKADFASLEKYALEKGE  413

Query  189  --PKVPSAKQELAEMILQSAL  133
                + S +QE+ E I+ + L
Sbjct  414  VTASLSSGRQEMLESIVNNVL  434



>ref|WP_044480420.1| xylose isomerase [Paenibacillus sp. GD11]
Length=438

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 139/196 (71%), Gaps = 0/196 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAATT +FL+K GL D+FKLN+E NHATL+GH+  HE+  ARIN +LG+IDA
Sbjct  236  PTKHQYDFDAATTISFLQKYGLQDKFKLNLEANHATLAGHTFEHELRVARINNMLGSIDA  295

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTD+FP D+   TL M  +I+NGGL  GG NFDAK+RR S + ED+F +HI
Sbjct  296  NQGDMLLGWDTDEFPTDLYAVTLAMYEIIENGGLGSGGVNFDAKVRRSSFEPEDLFYSHI  355

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL+ AA++ E+  +  L+ +RY SF S +GA I  GKA+F+ LE  ALE  +
Sbjct  356  AGMDTFAKGLKVAARMKEEKFIDGLIDERYASFKSGIGADILSGKANFKTLEAYALEHSD  415

Query  189  PKVPSAKQELAEMILQ  142
             +  S   EL +  L 
Sbjct  416  IRNKSNHLELVKARLN  431



>gb|EFF45521.1| xylose isomerase [Xanthomonas fuscans subsp. aurantifolii str. 
ICPB 11122]
Length=202

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 133/199 (67%), Gaps = 1/199 (1%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+D+AT   FLR++GL  +FKLNIE NHATLSGHS  H+++ A   GLLG+IDA
Sbjct  3    PMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLLGSIDA  62

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N G+PQ GWDTDQFP D+ +    ML V++ GGLAPGG NFDAK+RRES+D +D+F+AHI
Sbjct  63   NRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDLFLAHI  122

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGL  A  L+    L++   +RY SFDS  GA    GK     L K A     
Sbjct  123  GGMDAFARGLEVANALLTASPLEQWRAERYASFDSGAGADFAAGKTTLADLAKHA-AGNA  181

Query  189  PKVPSAKQELAEMILQSAL  133
            P+  S +QE  E ++   L
Sbjct  182  PRQISGRQEAYENLINQYL  200



>ref|WP_012064875.1| xylose isomerase [Alkaliphilus metalliredigens]
 gb|ABR49915.1| xylose isomerase [Alkaliphilus metalliredigens QYMF]
Length=437

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D  T   FLRK  LID+FKLNIE NHATL+GH+  HE+  ARING+LG++DA
Sbjct  237  PTKHQYDFDTMTVLGFLRKYNLIDDFKLNIEANHATLAGHTFQHELAMARINGVLGSVDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+KNGG+APGG NFDAK+RR S   +D+FIA+I
Sbjct  297  NQGDLLLGWDTDQFPTNIYDATLSMYEVLKNGGIAPGGLNFDAKVRRGSFKPDDLFIAYI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ DG L+  V KRY+S+ + +G  I      FE L + AL+  +
Sbjct  357  VGMDTFAKGLLVADKLLTDGVLENFVTKRYESYTAGIGKKIIEDATSFEELAEYALKHDK  416

Query  189  PKVPSAKQELAEMILQSAL*K  127
              + S +QE+ E I+   + K
Sbjct  417  IVLESGRQEMLEDIVNRYIYK  437



>ref|WP_034634309.1| xylose isomerase, partial [Bacillus okhensis]
 gb|KHF37733.1| xylose isomerase, partial [Bacillus okhensis]
Length=213

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 126/192 (66%), Gaps = 0/192 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL+K  L   FK NIE NHATL+GH+  HE+ TARING+LG++
Sbjct  8    QEPTKHQYDFDVATGLAFLQKYDLQHTFKFNIEANHATLAGHTFEHELRTARINGMLGSV  67

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GD   GWDTD+FP D+   TL M  ++KN GL  GG NFDAK+RR S D +D+F A
Sbjct  68   DANQGDTLLGWDTDEFPTDLYSTTLAMYEILKNDGLGTGGLNFDAKVRRGSFDTDDLFHA  127

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HI GMD  A G + A +LIED  L E V  RY SF S +G  I  GK DF  LE+ AL  
Sbjct  128  HIAGMDAFAIGTKVAQRLIEDKVLDEFVADRYSSFTSGIGLDIVEGKTDFHKLEQHALSL  187

Query  195  GEPKVPSAKQEL  160
             E    S +QEL
Sbjct  188  KEIGNKSGRQEL  199



>ref|WP_011576446.1| xylose isomerase [Pseudoalteromonas atlantica]
 sp|Q15PG0.1|XYLA_PSEA6 RecName: Full=Xylose isomerase [Pseudoalteromonas atlantica T6c]
 gb|ABG42228.1| D-xylose isomerase [Pseudoalteromonas atlantica T6c]
Length=439

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 140/202 (69%), Gaps = 1/202 (0%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +EFK+NIE NHATL+GHS  HEV TA   GL G+I
Sbjct  236  QEPTKHQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ GWDTDQFP  V E +LV+  ++K GG   GGFNFD KLRR+S+D +D+FIA
Sbjct  296  DANRGDPQLGWDTDQFPNSVEELSLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIA  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEW  196
            HIGGMD LA GL+ AA +IE+  L + V KRY  ++ ELG  I+GG  + E L    ++ 
Sbjct  356  HIGGMDHLAIGLKKAALMIENDFLGQAVSKRYAGWNGELGKGIQGGDFNLESLANLCVDK  415

Query  195  G-EPKVPSAKQELAEMILQSAL  133
              +PK  S +QEL E  + + L
Sbjct  416  NLQPKHVSGQQELLENKVNNVL  437



>ref|WP_035133012.1| xylose isomerase [Flavobacterium beibuense]
 gb|KGO81625.1| xylose isomerase [Flavobacterium beibuense F44-8]
Length=440

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 133/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P KHQYD+DAAT   FL K GL D+FKLNIE NHATL+GH+  HE++ A   G+LG+IDA
Sbjct  242  PMKHQYDFDAATCIGFLNKFGLQDDFKLNIEVNHATLAGHTFEHELQVAANAGMLGSIDA  301

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP+D+ E T  ML  ++NGG+  GG NFDAK+RR S D ED FIAHI
Sbjct  302  NRGDYQNGWDTDQFPIDIYEITQAMLVFLQNGGVKGGGINFDAKVRRNSIDYEDKFIAHI  361

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  ARGL  A  ++ + +  EL   RY SFDS  GAA E GK   + L   A E G 
Sbjct  362  SGMDVFARGLICADHILNNTNYSELKATRYMSFDSGNGAAFENGKLKLQNLSDIARENGN  421

Query  189  PKVPSAKQELAEMILQSAL  133
            PK  S +QEL E I+ +A 
Sbjct  422  PKPRSGRQELFEQIIANAY  440



>gb|EHJ34457.1| xylose isomerase [Peptoclostridium difficile 050-P50-2011]
Length=454

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 136/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D AT   FLRK  L   FK+NIE NHATL+GH+  HE+  +RIN +LG+IDA
Sbjct  247  PTKHQYDFDTATVLGFLRKYNLDKYFKMNIEANHATLAGHTFQHELNISRINNVLGSIDA  306

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP ++ +ATL M  V+K GG+APGGFNFD+K+RR S +VED+F+A+I
Sbjct  307  NQGDLLLGWDTDQFPTNIYDATLAMYEVLKQGGIAPGGFNFDSKVRRASFEVEDLFLAYI  366

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMDT A+GL  A KL+ED   +   ++RY SF   +G  I  GK  F+ LE  AL+   
Sbjct  367  AGMDTFAKGLLIAHKLLEDEVFENFTKERYASFSEGIGKDIVEGKVGFKELESYALQMPV  426

Query  189  PKVPSAKQELAEMILQSAL  133
             K  S +QE+ E IL   +
Sbjct  427  IKNKSGRQEMLEAILNRYI  445



>ref|WP_035601129.1| xylose isomerase [Haloferula sp. BvORR071]
Length=435

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 133/199 (67%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            P+ HQYD D+A   NFLR+  L+D FKLNIE NHATL+GH+  HE+  A   G LG+IDA
Sbjct  237  PSTHQYDSDSAACLNFLRQYNLLDHFKLNIETNHATLAGHTMEHELTVAMDAGALGSIDA  296

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD   GWDTDQFP D+   T VML +++ GG   GG NFDAK RRES +  D+F AHI
Sbjct  297  NQGDELLGWDTDQFPSDLYGTTKVMLKLLEMGGFTTGGLNFDAKRRRESHEPVDLFHAHI  356

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  ARGLR AA + EDG +   V+ RY S+D+ +GA IE GK DF+ L   AL  GE
Sbjct  357  GGMDAFARGLRVAAAIREDGRISNFVKTRYSSWDNGIGAEIEAGKMDFDQLSDWALRNGE  416

Query  189  PKVPSAKQELAEMILQSAL  133
            P V S +QEL E IL   L
Sbjct  417  PVVASGRQELMENILNELL  435



>ref|WP_013298905.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum]
 sp|P29441.2|XYLA_THETC RecName: Full=Xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL69948.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=439

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 131/199 (66%), Gaps = 0/199 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+D A    FLRK  L   FK+NIE NHATL+ H   HE+  ARING+LG+IDA
Sbjct  238  PTKHQYDFDVANVLAFLRKYDLDKYFKVNIEANHATLAAHDFQHELRYARINGVLGSIDA  297

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N+GD   GWDTDQFP D+   TL M  VIK GG   GG NFDAK+RR S + ED+F+ HI
Sbjct  298  NTGDMLLGWDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFLGHI  357

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
             GMD  A+G + A KL++DG   + + +RY S+   +GA I  GKADF+ LEK ALE  E
Sbjct  358  AGMDAFAKGFKVAYKLVKDGVFDKFIEERYASYKDGIGADIVSGKADFKSLEKYALEHSE  417

Query  189  PKVPSAKQELAEMILQSAL  133
                S +QE+ E IL   L
Sbjct  418  IVNKSGRQEMLESILNQYL  436



>ref|WP_035688493.1| xylose isomerase [Avibacterium paragallinarum]
Length=439

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = -2

Query  735  QGPTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNI  556
            Q PTKHQYD+D AT   FL++ GL +E K+NIE NHATL+GHS HHE+ TA   G+ G+I
Sbjct  236  QEPTKHQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHSFHHEIATAYALGIFGSI  295

Query  555  DANSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIA  376
            DAN GDPQ+GWDTDQFP  V E TLVM  ++KNGG   GGFNFDAK+RR+S D  D+F  
Sbjct  296  DANRGDPQSGWDTDQFPNSVEENTLVMYEILKNGGFTTGGFNFDAKIRRQSNDPYDLFYG  355

Query  375  HIGGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFE----LLEKK  208
            HIG +D LA  LR AA +I+D  L++LV +RY  +DS+LG AI  G    E    L+E +
Sbjct  356  HIGAIDVLALSLRRAADMIQDQQLQKLVEQRYSGWDSQLGKAILSGNTSLEALAQLVETQ  415

Query  207  ALEWGEPKVPSAKQELAEMILQSAL  133
             L    P+  S +QE  E ++   +
Sbjct  416  NL---NPQPVSGQQEYLENLVNRYI  437



>ref|WP_002997116.1| xylose isomerase [Sphingobacterium spiritivorum]
 gb|EFK59380.1| xylose isomerase [Sphingobacterium spiritivorum ATCC 33861]
Length=442

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 135/195 (69%), Gaps = 0/195 (0%)
 Frame = -2

Query  729  PTKHQYDWDAATTANFLRKNGLIDEFKLNIECNHATLSGHSCHHEVETARINGLLGNIDA  550
            PTKHQYD+DAAT  +FLR+  L+D+FKLN+E NHATL+GH+  HE++ A   GLLG+IDA
Sbjct  244  PTKHQYDYDAATVISFLRQYDLLDDFKLNLEVNHATLAGHTFQHELQVAADAGLLGSIDA  303

Query  549  NSGDPQTGWDTDQFPMDVAEATLVMLSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI  370
            N GD Q GWDTDQFP ++ E T  ML +++ GG   GG NFDAK+RR STD ED+F AHI
Sbjct  304  NRGDEQNGWDTDQFPYNINELTESMLIILEAGGFQGGGINFDAKIRRNSTDREDLFFAHI  363

Query  369  GGMDTLARGLRSAAKLIEDGSLKELVRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE  190
            GGMD  AR L  A K++E  S  +L ++RYQSFD+  GA  E G    E L   A   GE
Sbjct  364  GGMDLFARALLIADKILEKSSYLQLRKERYQSFDTGKGAEFEKGNLSLEDLRDFAAANGE  423

Query  189  PKVPSAKQELAEMIL  145
            P+V S KQE  E ++
Sbjct  424  PEVKSGKQEFLENLI  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500